1P3FC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fC00
5JA4B 1AOID 5B24A 3UTAC 4H9QB 5AVBD 3RELB 4YM6C 1BH9B 4ZUXC 3C1CC 4LD9B 3B0DC 3AZKB 5AV8C 3MGSB 4R8PC 3WTPB 3C1BA 2HIOD 1P3GB 5DNMC 1B67A 1EQZA 4H9PA 4NFTA 5AVCB 5AV6B 2F8NH 3MGQA 1S32A 3NQJB 4H9NB 3W97A 3AN2D 1P3LA 4CAYB 3AZFA 2NZDD 3LZ1C 3KSYA 4J8WC 1P3ID 2NQBC 3X1VB 3B0BA 4J8XB 5CHLB 4QLCA 5KDMB 1KX4D 3AZED 2YFVB 3UTBB 3WKJD 4ZBJC 3AZHB 5CPJA 1AOIC 3X1UD 5AVBC 5BNVA 3KUYD 3B6FA 4NE6A 1M18A 5JA4A 4H9QA 5FUGB 3RELA 1BH9A 3A6NB 3AZJB 4LD9A 3AZKA 2HIOC 3AZLD 4H9SA 5GXQD 1HQ3D 3MGSA 4EO5B 1ZLAB 3WTPA 1KX3B 5B31D 4WV4B 5BNXB 3AN2C 4YS3B 3AFAB 2NZDC 5AVCA 5AV6A 1P3MD 3NQJA 4H9NA 1P3IC 4CAYA 3REJD 3LJAD 5F99D 3W99D 3X1VA 3V9RB 1TZYB 4J8XA 1KX4C 3AZEC 3MGRD 1KX5D 1ID3D 3WKJC 4WU9D 3W96D 5KDMA 3X1UC 4KGCD 3KUYC 2YFVA 2BYKA 3UTBA 3WA9A 4Z5TB 3AZHA 5B0YB 1P3AC 4E44A 4X23D 1KU5A 1P3KB 5C3IC 3AZLC 2CV5B 4HGAB 4KUDB 5B2JD 5GXQC 3X1TD 1HQ3C 3A6NA 4J8UD 3MGPD 4XUJD 5B31C 1H3OB 1ZLAA 1P3FD 1P3MC 1KX3A 5BNXA 5B2ID 4JJNB 1TAFA 3AFAA 3UT9B 4YS3A 3REJC 3MNNB 4WU8D 3LJAC 3W98B 5B32G 3AV2D 5GSUB 5F99C 5AV9D 2PYOD 3W99C 4J8VB 1M1AB 4Z2MG 3REHB 4XZQD 3MGRC 3W96C 1KX5C 3AZND 4WU9C 5CPIB 1F1EA 4G91B 1ID3C 2F8ND 3V9RA 1TZYA 4UUZB 1P3BB 2FJ7D 4G92B 4KGCC 2CWEA 3B0CW 5B0ZB 5B32B 3REKB 3KXBB 5E5AB 3AZID 3X1SD 3B6GD 5B33B 4X23C 4AWLC 4KHAA 3REIA 4Z5TA 1P34D 5AV8D 3C1BB 3UTAB 5B2JC 3VH5T 3X1TC 1P3KA 4J8UC 4YM6B 4ZUXB 3MGPC 4XUJC 3O62D 3B0DB 3C1CB 3W97B 2CV5A 1P3FC 4R8PB 5B2IC 1H3OA 5B40D 4WU8C 4QLCB 3AV2C 4JJNA 5AV9C 2PYOC 3UT9A 1F66D 4XZQC 5AV5D 3MNNA 1EQZD 3W98A 3LZ1B 4Z66D 5GSUA 3AZNC 4J8WB 4J8VA 1M1AA 2NQBB 3REHA 2FJ7C 1N1JB 3B6FB 5CPIA 5CPKD 3AZIC 3B6GC 3X1SC 4UUZA 1P3BA 5B0ZA 2HUEC 5B32A 3REKA 3KXBA 4ZBJB 5E5AA 1P34C 1AOIB 3WAAA 3NQUB 5B33A 5AVBB 5B1LB 3O62C 1M19D 3UTAA 5DNND 1WWSA 4YM6A 4ZUXA 3C1CA 2HIOB 5B40C 3WTPE 3AYWD 1U35D 4R8PA 4WNNB 1F66C 5DNMA 5AV5C 2NZDB 1EQZC 3LELD 4Z66C 5GT3D 1P3GD 1P3IB 3LZ1A 3WA9B 2BYKB 5GT0D 5CP6D 4J8WA 3AZMD 5CPKC 2NQBA 1N1JA 3AZEB 3WKJB 1P3AD 3X1VD 4J8XD 3KWQD 5B31G 5B1MD 1Q9CA 1M19C 1AOIA 3NQUA 5BS7C 5DNNC 5AVBA 5B1LA 3UTBD 1P3OD 5C3IB 1TAFB 2JSSA 2AROD 3AZLB 5GXQB 3AYWC 1U35C 5B31B 2HIOA 3AZJD 3LELC 5GT3C 4H9RB 1P3MB 4WNNA 5AY8D 3AN2A 1P3GC 2NZDA 3LJAB 1P3PD 5GT0C 5CP6C 3AZMC 5F99B 1P3IA 3AFAD 3REIB 4KHAB 1KX5B 1ID3B 3X1VC 4J8XC 3KWQC 3VH5A 3LZ0D 1KX4A 4KGCB 3AZEA 3WKJA 5B1MC 4DRBA 1TZYD 4M6BA 3TU4D 3KUYA 3UTBC 1P3OC 5JRGD 1BFMA 2AROC 3AV1D 3MVDD 5B0YD 3MGPB 4XUJB 3AZLA 5GXQA 3AZJC 1P3FB 2F8NG 5B31A 5B2IB 5AY8C 4KUDD 3VH6A 4WU8B 2IO5B 3R45B 4EO5C 1P3PC 4H9RA 1P3MA 5AV9B 3AFAC 3REJA 3LJAA 5F99A 3WAAB 3UT9D 2F8NB 2RVQD 1B6WA 3AZGD 3LZ0C 2FJ7B 1KX5A 3W96A 1ID3A 3AZIB 3B6GB 1TZYC 3TU4C 3VH5W 4E45A 4KGCA 2YFWB 2HUEB 5B24D 5JRGC 1P34B 5AV8B 3AV1C 4WZSB 3MVDC 5E5AD 5B0YC 5DNMB 5B2JA 3X1TA 3MGPA 4XUJA 3C1BD 4KUDC 1WWIA 5B40B 3MGQD 1P3FA 1S32D 3W97D 5B2IA 1P3LD 3VH6W 2BYMB 3VH6T 3AZFD 1F66B 4WU8A 3R45A 3AV2A 4Z66B 5AV9A 3UT9C 2RVQC 4XZQA 3AZGC 4QLCD 3AZNA 2F8NA 2FJ7A 5CPJD 4G91C 5B24C 3AZIA 3B6GA 3X1SA 4G92C 3B6FD 1M18D 2YFWA 1P34A 5E5AC 5AV8A 1M19B 5G49B 3RELD 4LD9D 3AZKD 3O62A 3C1BC 3AN2B 5BT1D 5B1LD 3MGSD 3AYWB 3WTPD 3MGQC 1U35B 1S32C 3W97C 1P3LC 4NE5A 3AZFC 5B40A 5AVCD 5AV6D 3LELB 5GT3B 2BYMA 1F66A 5AV5A 1KX4B 4QLCC 1JFIA 4Z66A 5GT0B 5CP6B 3AZMB 4Z2MH 3X1UB 3KUYB 5CPJC 1ULYA 5CPKA 1P3AB 3WA9D 3KWQB 3B6FC 1M18C 3AZHD 5B1MB 1HTAA 3RELC 1HQ3B 4LD9C 3AZKC 1P3OB 1M19A 2AROB 4H9SC 5G49A 5BS7A 5DNNA 3A6ND 5BT1C 5B1LC 3MGSC 2LY8A 3WTPC 2L5AA 4CSRB 3REJB 5AVCC 1ZLAD 5AV6C 3AYWA 1U35A 1KX3D 4YS3D 3W99B 5AY8B 3MGRB 3LELA 1P3PB 5GT3A 4WU9B 3W96B 1P3GA 5GT0A 5CP6A 3AZMA 3X1UA 4AWLB 4X23B 3WA9C 3LZ0B 3AZHC 1P3AA 5BO0B 1A7WA 3REID 3TU4B 5B2JB 3KWQA 3X1TB 4Z5TD 4J8UB 5B1MA 5JRGB 3AV1B 4H9OB 1HQ3A 3A6NC 1P3KD 1P3OA 3MVDB 2CV5D 2AROA 1ZLAC 3AV2B 1KX3C 4NE3A 4YS3C 2PYOB 4CSRA 4XZQB 5FUGA 1R4VA 3AZJA 4JJND 3AZNB 3W99A 5AY8A 3MNND 3W98D 3MGRA 1P3PA 5GSUD 4WU9A 4J8VD 1M1AD 3REHD 3X1SB 3AZGB 5CPID 1BH8B 3REIC 4X23A 1P3BD 3LZ0A 5B0ZD 4Z5TC 5B32D 3REKD 3KXBD 3WAAD 3O62B 5B24B 5BO0A 5B33D 3TU4A 1P3KC 4J8UA 3B0CT 3UTAD 5JRGA 2CV5C 4HGAC 3AV1A 4H9OA 4YM6D 4ZUXD 3C1CD 3MVDA 5B0YA 4DRAA 5AV5B 2F8NK 1EQZB 4H9PB 1JFIB 4R8PD 4JJNC 3MGQB 2PYOA 1S32B 5DNMD 3MNNC 1P3LB 4KUDA 3AZFB 3W98C 5GSUC 4J8VC 5CPKB 1M1AC 3REHC 2IO5C 3LZ1D 5CPIC 4J8WD 2NQBD 1P3BC 3AZGA 5B0ZC 5B32C 3REKC 3KXBC 3WAAC 5CPJB 1BH8A 5B33C 5DNNB 5BNVB 1M18B
chains in the Genus database with same CATH superfamily
5JA4B 1AOID 5B24A 3UTAC 4H9QB 5AVBD 3RELB 4YM6C 1BH9B 4ZUXC 3C1CC 4LD9B 3B0DC 3AZKB 5AV8C 3MGSB 4R8PC 3WTPB 3C1BA 2HIOD 1P3GB 5DNMC 1B67A 1EQZA 4H9PA 4NFTA 5AVCB 5AV6B 2F8NH 3MGQA 3H0RC 1S32A 3NQJB 4H9NB 3W97A 3AN2D 1P3LA 4CAYB 3AZFA 2NZDD 3LZ1C 3KSYA 4J8WC 1P3ID 2NQBC 3X1VB 3B0BA 4J8XB 5CHLB 4QLCA 1PZRA 2Y2NA 5KDMB 1KX4D 3AZED 2YFVB 3UTBB 3WKJD 4ZBJC 3AZHB 5CPJA 1AOIC 3X1UD 5AVBC 5BNVA 3KUYD 4DQYB 4NE6A 1M18A 3B6FA 5JA4A 2Y2PA 4H9QA 2VQRA 5FUGB 3RELA 1BH9A 3A6NB 3AZJB 4LD9A 3AZKA 2HIOC 3AZLD 4H9SA 5GXQD 1HQ3D 3MGSA 4EO5B 1ZLAB 3WTPA 1KX3B 5B31D 4WV4B 5BNXB 3AN2C 4YS3B 3AFAB 2NZDC 1Z2CB 5AVCA 5AV6A 3F6TA 1P3MD 3NQJA 4H9NA 1P3IC 3KFUG 4CAYA 3REJD 3LJAD 5F99D 3W99D 3X1VA 3V9RB 1TZYB 4J8XA 1KX4C 3AZEC 3MGRD 1KX5D 1ID3D 3WKJC 4WU9D 3W96D 3EPLA 5KDMA 3X1UC 4KGCD 3KUYC 2YFVA 2BYKA 3UTBA 3WA9A 4Z5TB 3AZHA 5B0YB 1P3AC 4E44A 4X23D 2Y2JA 1KU5A 1P3KB 5C3IC 3AZLC 2CV5B 4HGAB 4KUDB 5B2JD 5GXQC 3X1TD 1HQ3C 3A6NA 4J8UD 3MGPD 4XUJD 5B31C 2W8SA 1H3OB 4WJ3C 1ZLAA 1P3FD 1P3MC 1KX3A 5BNXA 5B2ID 4JJNB 1TAFA 3AFAA 3UT9B 4YS3A 3REJC 3MNNB 4WU8D 3LJAC 3W98B 5B32G 3AV2D 2DQNC 5GSUB 5AV9D 5F99C 3W99C 4J8VB 1M1AB 2PYOD 4Z2MG 3REHB 4XZQD 2ZM5A 3MGRC 3W96C 1KX5C 3AZND 4WU9C 5CPIB 1F1EA 4G91B 1ID3C 2F8ND 3V9RA 1TZYA 4UUZB 1P3BB 2FJ7D 4G92B 4KGCC 3A1KA 2CWEA 3B0CW 5B0ZB 5B32B 3REKB 3KXBB 5E5AB 3AZID 3X1SD 3B6GD 3H0LC 5B33B 4X23C 4AWLC 4KHAA 3REIA 2UWXA 4Z5TA 1P34D 5AV8D 3C1BB 3UTAB 5B2JC 3VH5T 3X1TC 1P3KA 4J8UC 4YM6B 4ZUXB 3MGPC 4XUJC 3O62D 3B0DB 3C1CB 3W97B 2CV5A 2Y2KA 2BG1A 1P3FC 4R8PB 5B2IC 1H3OA 5B40D 4WU8C 4QLCB 3AV2C 4JJNA 5AV9C 2PYOC 3UT9A 1F66D 4XZQC 5AV5D 3MNNA 2Y2LA 1EQZD 3W98A 3LZ1B 4Z66D 5GSUA 3AZNC 4J8WB 4J8VA 1M1AA 2NQBB 3REHA 2FJ7C 1N1JB 3B6FB 5CPIA 5CPKD 3AZIC 3B6GC 3X1SC 4UUZA 1P3BA 5B0ZA 2HUEC 5B32A 3REKA 3KXBA 4ZBJB 5E5AA 1P34C 1AOIB 3WAAA 3NQUB 5B33A 5AVBB 5B1LB 3O62C 1M19D 3UTAA 5DNND 1WWSA 4YM6A 4ZUXA 3C1CA 2HIOB 5B40C 3WTPE 3AYWD 1U35D 4R8PA 4WNNB 1F66C 5DNMA 5AV5C 2NZDB 1EQZC 3LELD 4Z66C 5GT3D 1P3GD 1P3IB 3LZ1A 3WA9B 2BYKB 5GT0D 5CP6D 4J8WA 3AZMD 5CPKC 2NQBA 1N1JA 2Y2QA 3AZEB 3WKJB 2DF4C 1P3AD 3X1VD 2Y2HA 4J8XD 3KWQD 5B31G 5B1MD 1Q9CA 1M19C 1AOIA 3NQUA 5BS7C 5DNNC 5AVBA 5B1LA 3UTBD 1P3OD 5C3IB 1TAFB 2AROD 2JSSA 3AZLB 5GXQB 3AYWC 1U35C 2XD5A 5B31B 2HIOA 3AZJD 1T3UA 3LELC 5GT3C 4H9RB 1P3MB 4WNNA 5AY8D 3AN2A 1P3GC 2NZDA 3LJAB 1P3PD 5GT0C 5CP6C 3AZMC 5F99B 1P3IA 3AFAD 3REIB 4KHAB 1KX5B 1ID3B 3X1VC 4J8XC 2Y2OA 3VH5A 3LZ0D 3KWQC 1KX4A 4KGCB 3AZEA 3WKJA 3A1IA 5B1MC 4DRBA 1TZYD 4M6BA 3TU4D 3KUYA 3UTBC 1P3OC 5JRGD 1BFMA 2AROC 3AV1D 3MVDD 5B0YD 3MGPB 4XUJB 3AZLA 2ZY3A 5GXQA 3AZJC 1P3FB 2F8NG 5B31A 5B2IB 5AY8C 4KUDD 3VH6A 4WU8B 2IO5B 3R45B 4EO5C 1P3PC 2ZY2A 4H9RA 3H0MC 1P3MA 5AV9B 3AFAC 3REJA 3LJAA 5F99A 3WAAB 3UT9D 2F8NB 2RVQD 1B6WA 2J8PA 3AZGD 3LZ0C 2FJ7B 1KX5A 3W96A 1ID3A 2Y2GA 3AZIB 3B6GB 1TZYC 3TU4C 3VH5W 4E45A 4KGCA 2YFWB 2HUEB 5B24D 5JRGC 1P34B 5AV8B 3AV1C 4WZSB 3MVDC 5E5AD 5B0YC 3AL0C 5DNMB 5B2JA 3X1TA 3MGPA 4XUJA 3C1BD 4KUDC 1WWIA 5B40B 3EPHA 3MGQD 1P3FA 1S32D 3W97D 5B2IA 1P3LD 3VH6W 2BYMB 3VH6T 3AZFD 1F66B 4WU8A 3R45A 3AV2A 4Z66B 5AV9A 3UT9C 2RVQC 4XZQA 3AZGC 4QLCD 3AZNA 2F8NA 2FJ7A 5CPJD 4G91C 5B24C 3AZIA 3B6GA 3X1SA 4UPKA 4G92C 3B6FD 1M18D 2YFWA 1P34A 5E5AC 5AV8A 1M19B 5G49B 3RELD 4LD9D 3AZKD 3O62A 3C1BC 3AN2B 5BT1D 5B1LD 3MGSD 3AYWB 3WTPD 3MGQC 1U35B 1S32C 3W97C 2ZY5A 1P3LC 4NE5A 3AZFC 5B40A 5AVCD 5AV6D 3P5JB 3LELB 5GT3B 2BYMA 1F66A 5AV5A 1KX4B 4QLCC 1JFIA 4Z66A 5GT0B 5CP6B 3AZMB 4Z2MH 3X1UB 3KUYB 1W2EA 5CPJC 3FDDA 1ULYA 5CPKA 1P3AB 3WA9D 3KWQB 3B6FC 1M18C 3AZHD 5B1MB 1HTAA 3RELC 1HQ3B 4LD9C 3AZKC 1P3OB 1M19A 2AROB 4H9SC 5G49A 5BS7A 5DNNA 3A6ND 5BT1C 5B1LC 3MGSC 3EPKA 2LY8A 3WTPC 2L5AA 4CSRB 3REJB 5AVCC 1ZLAD 5AV6C 3AYWA 1U35A 1KX3D 4YS3D 3W99B 5AY8B 3MGRB 3LELA 1P3PB 5GT3A 4WU9B 3W96B 2ZY4A 1P3GA 2Y2MA 3EPJA 5GT0A 5CP6A 3AZMA 3X1UA 4AWLB 4X23B 3WA9C 3LZ0B 3AZHC 2JCHA 1P3AA 5BO0B 1A7WA 3REID 3TU4B 5B2JB 3KWQA 3X1TB 4Z5TD 4J8UB 5B1MA 5JRGB 2G5IC 3AV1B 2F2AC 4H9OB 1HQ3A 3IP4C 3A6NC 1P3KD 1P3OA 2XD1A 3MVDB 2CV5D 2AROA 1ZLAC 3AV2B 1KX3C 2RIQA 4NE3A 4YS3C 2PYOB 4CSRA 4XZQB 5FUGA 1R4VA 3AZJA 4JJND 3AZNB 3W99A 5AY8A 3MNND 3W98D 3MGRA 2Y2IA 5GSUD 1P3PA 4WU9A 4J8VD 1M1AD 3REHD 3X1SB 2JE5A 3AZGB 5CPID 1BH8B 3REIC 4X23A 1P3BD 3LZ0A 5B0ZD 4Z5TC 5B32D 3REKD 3KXBD 3WAAD 3O62B 5B24B 5BO0A 5B33D 3TU4A 2FFFB 1P3KC 4J8UA 2G5HC 3B0CT 3UTAD 5JRGA 2CV5C 4HGAC 3AV1A 4H9OA 4YM6D 4ZUXD 3C1CD 3EG5B 3MVDA 5B0YA 4DRAA 5AV5B 2F8NK 1EQZB 4H9PB 1JFIB 4R8PD 4JJNC 3MGQB 2PYOA 1S32B 5DNMD 3MNNC 1P3LB 4KUDA 3AZFB 3W98C 5GSUC 4J8VC 5CPKB 1M1AC 3REHC 2IO5C 3LZ1D 5CPIC 4J8WD 2NQBD 1P3BC 3AZGA 5B0ZC 5B32C 3REKC 3KXBC 3WAAC 5CPJB 1BH8A 5B33C 5DNNB 5BNVB 1M18B
chains in the Genus database with same CATH topology
5JA4B 1AOID 5B24A 3UTAC 4H9QB 5AVBD 3RELB 4YM6C 1BH9B 4ZUXC 3C1CC 4LD9B 3B0DC 3AZKB 5AV8C 3MGSB 4R8PC 3WTPB 3C1BA 2HIOD 1P3GB 5DNMC 1B67A 1EQZA 4H9PA 4NFTA 5AVCB 5AV6B 2F8NH 3MGQA 3H0RC 1S32A 3NQJB 4H9NB 3W97A 3AN2D 1P3LA 4CAYB 3AZFA 2NZDD 3LZ1C 3KSYA 4J8WC 1P3ID 2NQBC 3X1VB 3B0BA 4J8XB 5CHLB 4QLCA 1PZRA 2Y2NA 5KDMB 1KX4D 3AZED 2YFVB 3UTBB 3WKJD 4ZBJC 3AZHB 5CPJA 1AOIC 3X1UD 5AVBC 5BNVA 3KUYD 4DQYB 4NE6A 1M18A 3B6FA 5JA4A 2Y2PA 4H9QA 2VQRA 5FUGB 3RELA 1BH9A 3A6NB 3AZJB 4LD9A 3AZKA 2HIOC 3AZLD 4H9SA 5GXQD 1HQ3D 3MGSA 4EO5B 1ZLAB 3WTPA 1KX3B 5B31D 4WV4B 5BNXB 3AN2C 4YS3B 3AFAB 2NZDC 1Z2CB 5AVCA 5AV6A 3F6TA 1P3MD 3NQJA 4H9NA 1P3IC 3KFUG 4CAYA 3REJD 3LJAD 5F99D 3W99D 3X1VA 3V9RB 1TZYB 4J8XA 1KX4C 3AZEC 3MGRD 1KX5D 1ID3D 3WKJC 4WU9D 3W96D 3EPLA 5KDMA 3X1UC 4KGCD 3KUYC 2YFVA 2BYKA 3UTBA 3WA9A 4Z5TB 3AZHA 5B0YB 1P3AC 4E44A 4X23D 2Y2JA 1KU5A 1P3KB 5C3IC 3AZLC 2CV5B 4HGAB 4KUDB 5B2JD 5GXQC 3X1TD 1HQ3C 3A6NA 4J8UD 3MGPD 4XUJD 5B31C 2W8SA 1H3OB 4WJ3C 1ZLAA 1P3FD 1P3MC 1KX3A 5BNXA 5B2ID 4JJNB 1TAFA 3AFAA 3UT9B 4YS3A 3REJC 3MNNB 4WU8D 3LJAC 3W98B 5B32G 3AV2D 2DQNC 5GSUB 5AV9D 5F99C 3W99C 4J8VB 1M1AB 2PYOD 4Z2MG 3REHB 4XZQD 2ZM5A 3MGRC 3W96C 1KX5C 3AZND 4WU9C 5CPIB 1F1EA 4G91B 1ID3C 2F8ND 3V9RA 1TZYA 4UUZB 1P3BB 2FJ7D 4G92B 4KGCC 3A1KA 2CWEA 3B0CW 5B0ZB 5B32B 3REKB 3KXBB 5E5AB 3AZID 3X1SD 3B6GD 3H0LC 5B33B 4X23C 4AWLC 4KHAA 3REIA 2UWXA 4Z5TA 1P34D 5AV8D 3C1BB 3UTAB 5B2JC 3VH5T 3X1TC 1P3KA 4J8UC 4YM6B 4ZUXB 3MGPC 4XUJC 3O62D 3B0DB 3C1CB 3W97B 2CV5A 2Y2KA 2BG1A 1P3FC 4R8PB 5B2IC 1H3OA 5B40D 4WU8C 4QLCB 3AV2C 4JJNA 5AV9C 2PYOC 3UT9A 1F66D 4XZQC 5AV5D 3MNNA 2Y2LA 1EQZD 3W98A 3LZ1B 4Z66D 5GSUA 3AZNC 4J8WB 4J8VA 1M1AA 2NQBB 3REHA 2FJ7C 1N1JB 3B6FB 5CPIA 5CPKD 3AZIC 3B6GC 3X1SC 4UUZA 1P3BA 5B0ZA 2HUEC 5B32A 3REKA 3KXBA 4ZBJB 5E5AA 1P34C 1AOIB 3WAAA 3NQUB 5B33A 5AVBB 5B1LB 3O62C 1M19D 3UTAA 5DNND 1WWSA 4YM6A 4ZUXA 3C1CA 2HIOB 5B40C 3WTPE 3AYWD 1U35D 4R8PA 4WNNB 1F66C 5DNMA 5AV5C 2NZDB 1EQZC 3LELD 4Z66C 5GT3D 1P3GD 1P3IB 3LZ1A 3WA9B 2BYKB 5GT0D 5CP6D 4J8WA 3AZMD 5CPKC 2NQBA 1N1JA 2Y2QA 3AZEB 3WKJB 2DF4C 1P3AD 3X1VD 2Y2HA 4J8XD 3KWQD 5B31G 5B1MD 1Q9CA 1M19C 1AOIA 3NQUA 5BS7C 5DNNC 5AVBA 5B1LA 3UTBD 1P3OD 5C3IB 1TAFB 2AROD 2JSSA 3AZLB 5GXQB 3AYWC 1U35C 2XD5A 5B31B 2HIOA 3AZJD 1T3UA 3LELC 5GT3C 4H9RB 1P3MB 4WNNA 5AY8D 3AN2A 1P3GC 2NZDA 3LJAB 1P3PD 5GT0C 5CP6C 3AZMC 5F99B 1P3IA 3AFAD 3REIB 4KHAB 1KX5B 1ID3B 3X1VC 4J8XC 2Y2OA 3VH5A 3LZ0D 3KWQC 1KX4A 4KGCB 3AZEA 3WKJA 3A1IA 5B1MC 4DRBA 1TZYD 4M6BA 3TU4D 3KUYA 3UTBC 1P3OC 5JRGD 1BFMA 2AROC 3AV1D 3MVDD 5B0YD 3MGPB 4XUJB 3AZLA 2ZY3A 5GXQA 3AZJC 1P3FB 2F8NG 5B31A 5B2IB 5AY8C 4KUDD 3VH6A 4WU8B 2IO5B 3R45B 4EO5C 1P3PC 2ZY2A 4H9RA 3H0MC 1P3MA 5AV9B 3AFAC 3REJA 3LJAA 5F99A 3WAAB 3UT9D 2F8NB 2RVQD 1B6WA 2J8PA 3AZGD 3LZ0C 2FJ7B 1KX5A 3W96A 1ID3A 2Y2GA 3AZIB 3B6GB 1TZYC 3TU4C 3VH5W 4E45A 4KGCA 2YFWB 2HUEB 5B24D 5JRGC 1P34B 5AV8B 3AV1C 4WZSB 3MVDC 5E5AD 5B0YC 3AL0C 5DNMB 5B2JA 3X1TA 3MGPA 4XUJA 3C1BD 4KUDC 1WWIA 5B40B 3EPHA 3MGQD 1P3FA 1S32D 3W97D 5B2IA 1P3LD 3VH6W 2BYMB 3VH6T 3AZFD 1F66B 4WU8A 3R45A 3AV2A 4Z66B 5AV9A 3UT9C 2RVQC 4XZQA 3AZGC 4QLCD 3AZNA 2F8NA 2FJ7A 5CPJD 4G91C 5B24C 3AZIA 3B6GA 3X1SA 4UPKA 4G92C 3B6FD 1M18D 2YFWA 1P34A 5E5AC 5AV8A 1M19B 5G49B 3RELD 4LD9D 3AZKD 3O62A 3C1BC 3AN2B 5BT1D 5B1LD 3MGSD 3AYWB 3WTPD 3MGQC 1U35B 1S32C 3W97C 2ZY5A 1P3LC 4NE5A 3AZFC 5B40A 5AVCD 5AV6D 3P5JB 3LELB 5GT3B 2BYMA 1F66A 5AV5A 1KX4B 4QLCC 1JFIA 4Z66A 5GT0B 5CP6B 3AZMB 4Z2MH 3X1UB 3KUYB 1W2EA 5CPJC 3FDDA 1ULYA 5CPKA 1P3AB 3WA9D 3KWQB 3B6FC 1M18C 3AZHD 5B1MB 1HTAA 3RELC 1HQ3B 4LD9C 3AZKC 1P3OB 1M19A 2AROB 4H9SC 5G49A 5BS7A 5DNNA 3A6ND 5BT1C 5B1LC 3MGSC 3EPKA 2LY8A 3WTPC 2L5AA 4CSRB 3REJB 5AVCC 1ZLAD 5AV6C 3AYWA 1U35A 1KX3D 4YS3D 3W99B 5AY8B 3MGRB 3LELA 1P3PB 5GT3A 4WU9B 3W96B 2ZY4A 1P3GA 2Y2MA 3EPJA 5GT0A 5CP6A 3AZMA 3X1UA 4AWLB 4X23B 3WA9C 3LZ0B 3AZHC 2JCHA 1P3AA 5BO0B 1A7WA 3REID 3TU4B 5B2JB 3KWQA 3X1TB 4Z5TD 4J8UB 5B1MA 5JRGB 2G5IC 3AV1B 2F2AC 4H9OB 1HQ3A 3IP4C 3A6NC 1P3KD 1P3OA 2XD1A 3MVDB 2CV5D 2AROA 1ZLAC 3AV2B 1KX3C 2RIQA 4NE3A 4YS3C 2PYOB 4CSRA 4XZQB 5FUGA 1R4VA 3AZJA 4JJND 3AZNB 3W99A 5AY8A 3MNND 3W98D 3MGRA 2Y2IA 5GSUD 1P3PA 4WU9A 4J8VD 1M1AD 3REHD 3X1SB 2JE5A 3AZGB 5CPID 1BH8B 3REIC 4X23A 1P3BD 3LZ0A 5B0ZD 4Z5TC 5B32D 3REKD 3KXBD 3WAAD 3O62B 5B24B 5BO0A 5B33D 3TU4A 2FFFB 1P3KC 4J8UA 2G5HC 3B0CT 3UTAD 5JRGA 2CV5C 4HGAC 3AV1A 4H9OA 4YM6D 4ZUXD 3C1CD 3EG5B 3MVDA 5B0YA 4DRAA 5AV5B 2F8NK 1EQZB 4H9PB 1JFIB 4R8PD 4JJNC 3MGQB 2PYOA 1S32B 5DNMD 3MNNC 1P3LB 4KUDA 3AZFB 3W98C 5GSUC 4J8VC 5CPKB 1M1AC 3REHC 2IO5C 3LZ1D 5CPIC 4J8WD 2NQBD 1P3BC 3AZGA 5B0ZC 5B32C 3REKC 3KXBC 3WAAC 5CPJB 1BH8A 5B33C 5DNNB 5BNVB 1M18B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 B;  1AOI D;  5B24 A;  3UTA C;  4H9Q B;  5AVB D;  3REL B;  4YM6 C;  1BH9 B;  4ZUX C;  3C1C C;  4LD9 B;  3B0D C;  3AZK B;  5AV8 C;  3MGS B;  4R8P C;  3WTP B;  3C1B A;  2HIO D;  1P3G B;  5DNM C;  1B67 A;  1EQZ A;  4H9P A;  4NFT A;  5AVC B;  5AV6 B;  2F8N H;  3MGQ A;  1S32 A;  3NQJ B;  4H9N B;  3W97 A;  3AN2 D;  1P3L A;  4CAY B;  3AZF A;  2NZD D;  3LZ1 C;  3KSY A;  4J8W C;  1P3I D;  2NQB C;  3X1V B;  3B0B A;  4J8X B;  5CHL B;  4QLC A;  5KDM B;  1KX4 D;  3AZE D;  2YFV B;  3UTB B;  3WKJ D;  4ZBJ C;  3AZH B;  5CPJ A;  1AOI C;  3X1U D;  5AVB C;  5BNV A;  3KUY D;  3B6F A;  4NE6 A;  1M18 A;  5JA4 A;  4H9Q A;  5FUG B;  3REL A;  1BH9 A;  3A6N B;  3AZJ B;  4LD9 A;  3AZK A;  2HIO C;  3AZL D;  4H9S A;  5GXQ D;  1HQ3 D;  3MGS A;  4EO5 B;  1ZLA B;  3WTP A;  1KX3 B;  5B31 D;  4WV4 B;  5BNX B;  3AN2 C;  4YS3 B;  3AFA B;  2NZD C;  5AVC A;  5AV6 A;  1P3M D;  3NQJ A;  4H9N A;  1P3I C;  4CAY A;  3REJ D;  3LJA D;  5F99 D;  3W99 D;  3X1V A;  3V9R B;  1TZY B;  4J8X A;  1KX4 C;  3AZE C;  3MGR D;  1KX5 D;  1ID3 D;  3WKJ C;  4WU9 D;  3W96 D;  5KDM A;  3X1U C;  4KGC D;  3KUY C;  2YFV A;  2BYK A;  3UTB A;  3WA9 A;  4Z5T B;  3AZH A;  5B0Y B;  1P3A C;  4E44 A;  4X23 D;  1KU5 A;  1P3K B;  5C3I C;  3AZL C;  2CV5 B;  4HGA B;  4KUD B;  5B2J D;  5GXQ C;  3X1T D;  1HQ3 C;  3A6N A;  4J8U D;  3MGP D;  4XUJ D;  5B31 C;  1H3O B;  1ZLA A;  1P3F D;  1P3M C;  1KX3 A;  5BNX A;  5B2I D;  4JJN B;  1TAF A;  3AFA A;  3UT9 B;  4YS3 A;  3REJ C;  3MNN B;  4WU8 D;  3LJA C;  3W98 B;  5B32 G;  3AV2 D;  5GSU B;  5F99 C;  5AV9 D;  2PYO D;  3W99 C;  4J8V B;  1M1A B;  4Z2M G;  3REH B;  4XZQ D;  3MGR C;  3W96 C;  1KX5 C;  3AZN D;  4WU9 C;  5CPI B;  1F1E A;  4G91 B;  1ID3 C;  2F8N D;  3V9R A;  1TZY A;  4UUZ B;  1P3B B;  2FJ7 D;  4G92 B;  4KGC C;  2CWE A;  3B0C W;  5B0Z B;  5B32 B;  3REK B;  3KXB B;  5E5A B;  3AZI D;  3X1S D;  3B6G D;  5B33 B;  4X23 C;  4AWL C;  4KHA A;  3REI A;  4Z5T A;  1P34 D;  5AV8 D;  3C1B B;  3UTA B;  5B2J C;  3VH5 T;  3X1T C;  1P3K A;  4J8U C;  4YM6 B;  4ZUX B;  3MGP C;  4XUJ C;  3O62 D;  3B0D B;  3C1C B;  3W97 B;  2CV5 A;  1P3F C;  4R8P B;  5B2I C;  1H3O A;  5B40 D;  4WU8 C;  4QLC B;  3AV2 C;  4JJN A;  5AV9 C;  2PYO C;  3UT9 A;  1F66 D;  4XZQ C;  5AV5 D;  3MNN A;  1EQZ D;  3W98 A;  3LZ1 B;  4Z66 D;  5GSU A;  3AZN C;  4J8W B;  4J8V A;  1M1A A;  2NQB B;  3REH A;  2FJ7 C;  1N1J B;  3B6F B;  5CPI A;  5CPK D;  3AZI C;  3B6G C;  3X1S C;  4UUZ A;  1P3B A;  5B0Z A;  2HUE C;  5B32 A;  3REK A;  3KXB A;  4ZBJ B;  5E5A A;  1P34 C;  1AOI B;  3WAA A;  3NQU B;  5B33 A;  5AVB B;  5B1L B;  3O62 C;  1M19 D;  3UTA A;  5DNN D;  1WWS A;  4YM6 A;  4ZUX A;  3C1C A;  2HIO B;  5B40 C;  3WTP E;  3AYW D;  1U35 D;  4R8P A;  4WNN B;  1F66 C;  5DNM A;  5AV5 C;  2NZD B;  1EQZ C;  3LEL D;  4Z66 C;  5GT3 D;  1P3G D;  1P3I B;  3LZ1 A;  3WA9 B;  2BYK B;  5GT0 D;  5CP6 D;  4J8W A;  3AZM D;  5CPK C;  2NQB A;  1N1J A;  3AZE B;  3WKJ B;  1P3A D;  3X1V D;  4J8X D;  3KWQ D;  5B31 G;  5B1M D;  1Q9C A;  1M19 C;  1AOI A;  3NQU A;  5BS7 C;  5DNN C;  5AVB A;  5B1L A;  3UTB D;  1P3O D;  5C3I B;  1TAF B;  2JSS A;  2ARO D;  3AZL B;  5GXQ B;  3AYW C;  1U35 C;  5B31 B;  2HIO A;  3AZJ D;  3LEL C;  5GT3 C;  4H9R B;  1P3M B;  4WNN A;  5AY8 D;  3AN2 A;  1P3G C;  2NZD A;  3LJA B;  1P3P D;  5GT0 C;  5CP6 C;  3AZM C;  5F99 B;  1P3I A;  3AFA D;  3REI B;  4KHA B;  1KX5 B;  1ID3 B;  3X1V C;  4J8X C;  3KWQ C;  3VH5 A;  3LZ0 D;  1KX4 A;  4KGC B;  3AZE A;  3WKJ A;  5B1M C;  4DRB A;  1TZY D;  4M6B A;  3TU4 D;  3KUY A;  3UTB C;  1P3O C;  5JRG D;  1BFM A;  2ARO C;  3AV1 D;  3MVD D;  5B0Y D;  3MGP B;  4XUJ B;  3AZL A;  5GXQ A;  3AZJ C;  1P3F B;  2F8N G;  5B31 A;  5B2I B;  5AY8 C;  4KUD D;  3VH6 A;  4WU8 B;  2IO5 B;  3R45 B;  4EO5 C;  1P3P C;  4H9R A;  1P3M A;  5AV9 B;  3AFA C;  3REJ A;  3LJA A;  5F99 A;  3WAA B;  3UT9 D;  2F8N B;  2RVQ D;  1B6W A;  3AZG D;  3LZ0 C;  2FJ7 B;  1KX5 A;  3W96 A;  1ID3 A;  3AZI B;  3B6G B;  1TZY C;  3TU4 C;  3VH5 W;  4E45 A;  4KGC A;  2YFW B;  2HUE B;  5B24 D;  5JRG C;  1P34 B;  5AV8 B;  3AV1 C;  4WZS B;  3MVD C;  5E5A D;  5B0Y C;  5DNM B;  5B2J A;  3X1T A;  3MGP A;  4XUJ A;  3C1B D;  4KUD C;  1WWI A;  5B40 B;  3MGQ D;  1P3F A;  1S32 D;  3W97 D;  5B2I A;  1P3L D;  3VH6 W;  2BYM B;  3VH6 T;  3AZF D;  1F66 B;  4WU8 A;  3R45 A;  3AV2 A;  4Z66 B;  5AV9 A;  3UT9 C;  2RVQ C;  4XZQ A;  3AZG C;  4QLC D;  3AZN A;  2F8N A;  2FJ7 A;  5CPJ D;  4G91 C;  5B24 C;  3AZI A;  3B6G A;  3X1S A;  4G92 C;  3B6F D;  1M18 D;  2YFW A;  1P34 A;  5E5A C;  5AV8 A;  1M19 B;  5G49 B;  3REL D;  4LD9 D;  3AZK D;  3O62 A;  3C1B C;  3AN2 B;  5BT1 D;  5B1L D;  3MGS D;  3AYW B;  3WTP D;  3MGQ C;  1U35 B;  1S32 C;  3W97 C;  1P3L C;  4NE5 A;  3AZF C;  5B40 A;  5AVC D;  5AV6 D;  3LEL B;  5GT3 B;  2BYM A;  1F66 A;  5AV5 A;  1KX4 B;  4QLC C;  1JFI A;  4Z66 A;  5GT0 B;  5CP6 B;  3AZM B;  4Z2M H;  3X1U B;  3KUY B;  5CPJ C;  1ULY A;  5CPK A;  1P3A B;  3WA9 D;  3KWQ B;  3B6F C;  1M18 C;  3AZH D;  5B1M B;  1HTA A;  3REL C;  1HQ3 B;  4LD9 C;  3AZK C;  1P3O B;  1M19 A;  2ARO B;  4H9S C;  5G49 A;  5BS7 A;  5DNN A;  3A6N D;  5BT1 C;  5B1L C;  3MGS C;  2LY8 A;  3WTP C;  2L5A A;  4CSR B;  3REJ B;  5AVC C;  1ZLA D;  5AV6 C;  3AYW A;  1U35 A;  1KX3 D;  4YS3 D;  3W99 B;  5AY8 B;  3MGR B;  3LEL A;  1P3P B;  5GT3 A;  4WU9 B;  3W96 B;  1P3G A;  5GT0 A;  5CP6 A;  3AZM A;  3X1U A;  4AWL B;  4X23 B;  3WA9 C;  3LZ0 B;  3AZH C;  1P3A A;  5BO0 B;  1A7W A;  3REI D;  3TU4 B;  5B2J B;  3KWQ A;  3X1T B;  4Z5T D;  4J8U B;  5B1M A;  5JRG B;  3AV1 B;  4H9O B;  1HQ3 A;  3A6N C;  1P3K D;  1P3O A;  3MVD B;  2CV5 D;  2ARO A;  1ZLA C;  3AV2 B;  1KX3 C;  4NE3 A;  4YS3 C;  2PYO B;  4CSR A;  4XZQ B;  5FUG A;  1R4V A;  3AZJ A;  4JJN D;  3AZN B;  3W99 A;  5AY8 A;  3MNN D;  3W98 D;  3MGR A;  1P3P A;  5GSU D;  4WU9 A;  4J8V D;  1M1A D;  3REH D;  3X1S B;  3AZG B;  5CPI D;  1BH8 B;  3REI C;  4X23 A;  1P3B D;  3LZ0 A;  5B0Z D;  4Z5T C;  5B32 D;  3REK D;  3KXB D;  3WAA D;  3O62 B;  5B24 B;  5BO0 A;  5B33 D;  3TU4 A;  1P3K C;  4J8U A;  3B0C T;  3UTA D;  5JRG A;  2CV5 C;  4HGA C;  3AV1 A;  4H9O A;  4YM6 D;  4ZUX D;  3C1C D;  3MVD A;  5B0Y A;  4DRA A;  5AV5 B;  2F8N K;  1EQZ B;  4H9P B;  1JFI B;  4R8P D;  4JJN C;  3MGQ B;  2PYO A;  1S32 B;  5DNM D;  3MNN C;  1P3L B;  4KUD A;  3AZF B;  3W98 C;  5GSU C;  4J8V C;  5CPK B;  1M1A C;  3REH C;  2IO5 C;  3LZ1 D;  5CPI C;  4J8W D;  2NQB D;  1P3B C;  3AZG A;  5B0Z C;  5B32 C;  3REK C;  3KXB C;  3WAA C;  5CPJ B;  1BH8 A;  5B33 C;  5DNN B;  5BNV B;  1M18 B; 
#chains in the Genus database with same CATH topology
 5JA4 B;  1AOI D;  5B24 A;  3UTA C;  4H9Q B;  5AVB D;  3REL B;  4YM6 C;  1BH9 B;  4ZUX C;  3C1C C;  4LD9 B;  3B0D C;  3AZK B;  5AV8 C;  3MGS B;  4R8P C;  3WTP B;  3C1B A;  2HIO D;  1P3G B;  5DNM C;  1B67 A;  1EQZ A;  4H9P A;  4NFT A;  5AVC B;  5AV6 B;  2F8N H;  3MGQ A;  3H0R C;  1S32 A;  3NQJ B;  4H9N B;  3W97 A;  3AN2 D;  1P3L A;  4CAY B;  3AZF A;  2NZD D;  3LZ1 C;  3KSY A;  4J8W C;  1P3I D;  2NQB C;  3X1V B;  3B0B A;  4J8X B;  5CHL B;  4QLC A;  1PZR A;  2Y2N A;  5KDM B;  1KX4 D;  3AZE D;  2YFV B;  3UTB B;  3WKJ D;  4ZBJ C;  3AZH B;  5CPJ A;  1AOI C;  3X1U D;  5AVB C;  5BNV A;  3KUY D;  4DQY B;  4NE6 A;  1M18 A;  3B6F A;  5JA4 A;  2Y2P A;  4H9Q A;  2VQR A;  5FUG B;  3REL A;  1BH9 A;  3A6N B;  3AZJ B;  4LD9 A;  3AZK A;  2HIO C;  3AZL D;  4H9S A;  5GXQ D;  1HQ3 D;  3MGS A;  4EO5 B;  1ZLA B;  3WTP A;  1KX3 B;  5B31 D;  4WV4 B;  5BNX B;  3AN2 C;  4YS3 B;  3AFA B;  2NZD C;  1Z2C B;  5AVC A;  5AV6 A;  3F6T A;  1P3M D;  3NQJ A;  4H9N A;  1P3I C;  3KFU G;  4CAY A;  3REJ D;  3LJA D;  5F99 D;  3W99 D;  3X1V A;  3V9R B;  1TZY B;  4J8X A;  1KX4 C;  3AZE C;  3MGR D;  1KX5 D;  1ID3 D;  3WKJ C;  4WU9 D;  3W96 D;  3EPL A;  5KDM A;  3X1U C;  4KGC D;  3KUY C;  2YFV A;  2BYK A;  3UTB A;  3WA9 A;  4Z5T B;  3AZH A;  5B0Y B;  1P3A C;  4E44 A;  4X23 D;  2Y2J A;  1KU5 A;  1P3K B;  5C3I C;  3AZL C;  2CV5 B;  4HGA B;  4KUD B;  5B2J D;  5GXQ C;  3X1T D;  1HQ3 C;  3A6N A;  4J8U D;  3MGP D;  4XUJ D;  5B31 C;  2W8S A;  1H3O B;  4WJ3 C;  1ZLA A;  1P3F D;  1P3M C;  1KX3 A;  5BNX A;  5B2I D;  4JJN B;  1TAF A;  3AFA A;  3UT9 B;  4YS3 A;  3REJ C;  3MNN B;  4WU8 D;  3LJA C;  3W98 B;  5B32 G;  3AV2 D;  2DQN C;  5GSU B;  5AV9 D;  5F99 C;  3W99 C;  4J8V B;  1M1A B;  2PYO D;  4Z2M G;  3REH B;  4XZQ D;  2ZM5 A;  3MGR C;  3W96 C;  1KX5 C;  3AZN D;  4WU9 C;  5CPI B;  1F1E A;  4G91 B;  1ID3 C;  2F8N D;  3V9R A;  1TZY A;  4UUZ B;  1P3B B;  2FJ7 D;  4G92 B;  4KGC C;  3A1K A;  2CWE A;  3B0C W;  5B0Z B;  5B32 B;  3REK B;  3KXB B;  5E5A B;  3AZI D;  3X1S D;  3B6G D;  3H0L C;  5B33 B;  4X23 C;  4AWL C;  4KHA A;  3REI A;  2UWX A;  4Z5T A;  1P34 D;  5AV8 D;  3C1B B;  3UTA B;  5B2J C;  3VH5 T;  3X1T C;  1P3K A;  4J8U C;  4YM6 B;  4ZUX B;  3MGP C;  4XUJ C;  3O62 D;  3B0D B;  3C1C B;  3W97 B;  2CV5 A;  2Y2K A;  2BG1 A;  1P3F C;  4R8P B;  5B2I C;  1H3O A;  5B40 D;  4WU8 C;  4QLC B;  3AV2 C;  4JJN A;  5AV9 C;  2PYO C;  3UT9 A;  1F66 D;  4XZQ C;  5AV5 D;  3MNN A;  2Y2L A;  1EQZ D;  3W98 A;  3LZ1 B;  4Z66 D;  5GSU A;  3AZN C;  4J8W B;  4J8V A;  1M1A A;  2NQB B;  3REH A;  2FJ7 C;  1N1J B;  3B6F B;  5CPI A;  5CPK D;  3AZI C;  3B6G C;  3X1S C;  4UUZ A;  1P3B A;  5B0Z A;  2HUE C;  5B32 A;  3REK A;  3KXB A;  4ZBJ B;  5E5A A;  1P34 C;  1AOI B;  3WAA A;  3NQU B;  5B33 A;  5AVB B;  5B1L B;  3O62 C;  1M19 D;  3UTA A;  5DNN D;  1WWS A;  4YM6 A;  4ZUX A;  3C1C A;  2HIO B;  5B40 C;  3WTP E;  3AYW D;  1U35 D;  4R8P A;  4WNN B;  1F66 C;  5DNM A;  5AV5 C;  2NZD B;  1EQZ C;  3LEL D;  4Z66 C;  5GT3 D;  1P3G D;  1P3I B;  3LZ1 A;  3WA9 B;  2BYK B;  5GT0 D;  5CP6 D;  4J8W A;  3AZM D;  5CPK C;  2NQB A;  1N1J A;  2Y2Q A;  3AZE B;  3WKJ B;  2DF4 C;  1P3A D;  3X1V D;  2Y2H A;  4J8X D;  3KWQ D;  5B31 G;  5B1M D;  1Q9C A;  1M19 C;  1AOI A;  3NQU A;  5BS7 C;  5DNN C;  5AVB A;  5B1L A;  3UTB D;  1P3O D;  5C3I B;  1TAF B;  2ARO D;  2JSS A;  3AZL B;  5GXQ B;  3AYW C;  1U35 C;  2XD5 A;  5B31 B;  2HIO A;  3AZJ D;  1T3U A;  3LEL C;  5GT3 C;  4H9R B;  1P3M B;  4WNN A;  5AY8 D;  3AN2 A;  1P3G C;  2NZD A;  3LJA B;  1P3P D;  5GT0 C;  5CP6 C;  3AZM C;  5F99 B;  1P3I A;  3AFA D;  3REI B;  4KHA B;  1KX5 B;  1ID3 B;  3X1V C;  4J8X C;  2Y2O A;  3VH5 A;  3LZ0 D;  3KWQ C;  1KX4 A;  4KGC B;  3AZE A;  3WKJ A;  3A1I A;  5B1M C;  4DRB A;  1TZY D;  4M6B A;  3TU4 D;  3KUY A;  3UTB C;  1P3O C;  5JRG D;  1BFM A;  2ARO C;  3AV1 D;  3MVD D;  5B0Y D;  3MGP B;  4XUJ B;  3AZL A;  2ZY3 A;  5GXQ A;  3AZJ C;  1P3F B;  2F8N G;  5B31 A;  5B2I B;  5AY8 C;  4KUD D;  3VH6 A;  4WU8 B;  2IO5 B;  3R45 B;  4EO5 C;  1P3P C;  2ZY2 A;  4H9R A;  3H0M C;  1P3M A;  5AV9 B;  3AFA C;  3REJ A;  3LJA A;  5F99 A;  3WAA B;  3UT9 D;  2F8N B;  2RVQ D;  1B6W A;  2J8P A;  3AZG D;  3LZ0 C;  2FJ7 B;  1KX5 A;  3W96 A;  1ID3 A;  2Y2G A;  3AZI B;  3B6G B;  1TZY C;  3TU4 C;  3VH5 W;  4E45 A;  4KGC A;  2YFW B;  2HUE B;  5B24 D;  5JRG C;  1P34 B;  5AV8 B;  3AV1 C;  4WZS B;  3MVD C;  5E5A D;  5B0Y C;  3AL0 C;  5DNM B;  5B2J A;  3X1T A;  3MGP A;  4XUJ A;  3C1B D;  4KUD C;  1WWI A;  5B40 B;  3EPH A;  3MGQ D;  1P3F A;  1S32 D;  3W97 D;  5B2I A;  1P3L D;  3VH6 W;  2BYM B;  3VH6 T;  3AZF D;  1F66 B;  4WU8 A;  3R45 A;  3AV2 A;  4Z66 B;  5AV9 A;  3UT9 C;  2RVQ C;  4XZQ A;  3AZG C;  4QLC D;  3AZN A;  2F8N A;  2FJ7 A;  5CPJ D;  4G91 C;  5B24 C;  3AZI A;  3B6G A;  3X1S A;  4UPK A;  4G92 C;  3B6F D;  1M18 D;  2YFW A;  1P34 A;  5E5A C;  5AV8 A;  1M19 B;  5G49 B;  3REL D;  4LD9 D;  3AZK D;  3O62 A;  3C1B C;  3AN2 B;  5BT1 D;  5B1L D;  3MGS D;  3AYW B;  3WTP D;  3MGQ C;  1U35 B;  1S32 C;  3W97 C;  2ZY5 A;  1P3L C;  4NE5 A;  3AZF C;  5B40 A;  5AVC D;  5AV6 D;  3P5J B;  3LEL B;  5GT3 B;  2BYM A;  1F66 A;  5AV5 A;  1KX4 B;  4QLC C;  1JFI A;  4Z66 A;  5GT0 B;  5CP6 B;  3AZM B;  4Z2M H;  3X1U B;  3KUY B;  1W2E A;  5CPJ C;  3FDD A;  1ULY A;  5CPK A;  1P3A B;  3WA9 D;  3KWQ B;  3B6F C;  1M18 C;  3AZH D;  5B1M B;  1HTA A;  3REL C;  1HQ3 B;  4LD9 C;  3AZK C;  1P3O B;  1M19 A;  2ARO B;  4H9S C;  5G49 A;  5BS7 A;  5DNN A;  3A6N D;  5BT1 C;  5B1L C;  3MGS C;  3EPK A;  2LY8 A;  3WTP C;  2L5A A;  4CSR B;  3REJ B;  5AVC C;  1ZLA D;  5AV6 C;  3AYW A;  1U35 A;  1KX3 D;  4YS3 D;  3W99 B;  5AY8 B;  3MGR B;  3LEL A;  1P3P B;  5GT3 A;  4WU9 B;  3W96 B;  2ZY4 A;  1P3G A;  2Y2M A;  3EPJ A;  5GT0 A;  5CP6 A;  3AZM A;  3X1U A;  4AWL B;  4X23 B;  3WA9 C;  3LZ0 B;  3AZH C;  2JCH A;  1P3A A;  5BO0 B;  1A7W A;  3REI D;  3TU4 B;  5B2J B;  3KWQ A;  3X1T B;  4Z5T D;  4J8U B;  5B1M A;  5JRG B;  2G5I C;  3AV1 B;  2F2A C;  4H9O B;  1HQ3 A;  3IP4 C;  3A6N C;  1P3K D;  1P3O A;  2XD1 A;  3MVD B;  2CV5 D;  2ARO A;  1ZLA C;  3AV2 B;  1KX3 C;  2RIQ A;  4NE3 A;  4YS3 C;  2PYO B;  4CSR A;  4XZQ B;  5FUG A;  1R4V A;  3AZJ A;  4JJN D;  3AZN B;  3W99 A;  5AY8 A;  3MNN D;  3W98 D;  3MGR A;  2Y2I A;  5GSU D;  1P3P A;  4WU9 A;  4J8V D;  1M1A D;  3REH D;  3X1S B;  2JE5 A;  3AZG B;  5CPI D;  1BH8 B;  3REI C;  4X23 A;  1P3B D;  3LZ0 A;  5B0Z D;  4Z5T C;  5B32 D;  3REK D;  3KXB D;  3WAA D;  3O62 B;  5B24 B;  5BO0 A;  5B33 D;  3TU4 A;  2FFF B;  1P3K C;  4J8U A;  2G5H C;  3B0C T;  3UTA D;  5JRG A;  2CV5 C;  4HGA C;  3AV1 A;  4H9O A;  4YM6 D;  4ZUX D;  3C1C D;  3EG5 B;  3MVD A;  5B0Y A;  4DRA A;  5AV5 B;  2F8N K;  1EQZ B;  4H9P B;  1JFI B;  4R8P D;  4JJN C;  3MGQ B;  2PYO A;  1S32 B;  5DNM D;  3MNN C;  1P3L B;  4KUD A;  3AZF B;  3W98 C;  5GSU C;  4J8V C;  5CPK B;  1M1A C;  3REH C;  2IO5 C;  3LZ1 D;  5CPI C;  4J8W D;  2NQB D;  1P3B C;  3AZG A;  5B0Z C;  5B32 C;  3REK C;  3KXB C;  3WAA C;  5CPJ B;  1BH8 A;  5B33 C;  5DNN B;  5BNV B;  1M18 B; 
#chains in the Genus database with same CATH homology
 5JA4 B;  1AOI D;  5B24 A;  3UTA C;  4H9Q B;  5AVB D;  3REL B;  4YM6 C;  1BH9 B;  4ZUX C;  3C1C C;  4LD9 B;  3B0D C;  3AZK B;  5AV8 C;  3MGS B;  4R8P C;  3WTP B;  3C1B A;  2HIO D;  1P3G B;  5DNM C;  1B67 A;  1EQZ A;  4H9P A;  4NFT A;  5AVC B;  5AV6 B;  2F8N H;  3MGQ A;  3H0R C;  1S32 A;  3NQJ B;  4H9N B;  3W97 A;  3AN2 D;  1P3L A;  4CAY B;  3AZF A;  2NZD D;  3LZ1 C;  3KSY A;  4J8W C;  1P3I D;  2NQB C;  3X1V B;  3B0B A;  4J8X B;  5CHL B;  4QLC A;  1PZR A;  2Y2N A;  5KDM B;  1KX4 D;  3AZE D;  2YFV B;  3UTB B;  3WKJ D;  4ZBJ C;  3AZH B;  5CPJ A;  1AOI C;  3X1U D;  5AVB C;  5BNV A;  3KUY D;  4DQY B;  4NE6 A;  1M18 A;  3B6F A;  5JA4 A;  2Y2P A;  4H9Q A;  2VQR A;  5FUG B;  3REL A;  1BH9 A;  3A6N B;  3AZJ B;  4LD9 A;  3AZK A;  2HIO C;  3AZL D;  4H9S A;  5GXQ D;  1HQ3 D;  3MGS A;  4EO5 B;  1ZLA B;  3WTP A;  1KX3 B;  5B31 D;  4WV4 B;  5BNX B;  3AN2 C;  4YS3 B;  3AFA B;  2NZD C;  1Z2C B;  5AVC A;  5AV6 A;  3F6T A;  1P3M D;  3NQJ A;  4H9N A;  1P3I C;  3KFU G;  4CAY A;  3REJ D;  3LJA D;  5F99 D;  3W99 D;  3X1V A;  3V9R B;  1TZY B;  4J8X A;  1KX4 C;  3AZE C;  3MGR D;  1KX5 D;  1ID3 D;  3WKJ C;  4WU9 D;  3W96 D;  3EPL A;  5KDM A;  3X1U C;  4KGC D;  3KUY C;  2YFV A;  2BYK A;  3UTB A;  3WA9 A;  4Z5T B;  3AZH A;  5B0Y B;  1P3A C;  4E44 A;  4X23 D;  2Y2J A;  1KU5 A;  1P3K B;  5C3I C;  3AZL C;  2CV5 B;  4HGA B;  4KUD B;  5B2J D;  5GXQ C;  3X1T D;  1HQ3 C;  3A6N A;  4J8U D;  3MGP D;  4XUJ D;  5B31 C;  2W8S A;  1H3O B;  4WJ3 C;  1ZLA A;  1P3F D;  1P3M C;  1KX3 A;  5BNX A;  5B2I D;  4JJN B;  1TAF A;  3AFA A;  3UT9 B;  4YS3 A;  3REJ C;  3MNN B;  4WU8 D;  3LJA C;  3W98 B;  5B32 G;  3AV2 D;  2DQN C;  5GSU B;  5AV9 D;  5F99 C;  3W99 C;  4J8V B;  1M1A B;  2PYO D;  4Z2M G;  3REH B;  4XZQ D;  2ZM5 A;  3MGR C;  3W96 C;  1KX5 C;  3AZN D;  4WU9 C;  5CPI B;  1F1E A;  4G91 B;  1ID3 C;  2F8N D;  3V9R A;  1TZY A;  4UUZ B;  1P3B B;  2FJ7 D;  4G92 B;  4KGC C;  3A1K A;  2CWE A;  3B0C W;  5B0Z B;  5B32 B;  3REK B;  3KXB B;  5E5A B;  3AZI D;  3X1S D;  3B6G D;  3H0L C;  5B33 B;  4X23 C;  4AWL C;  4KHA A;  3REI A;  2UWX A;  4Z5T A;  1P34 D;  5AV8 D;  3C1B B;  3UTA B;  5B2J C;  3VH5 T;  3X1T C;  1P3K A;  4J8U C;  4YM6 B;  4ZUX B;  3MGP C;  4XUJ C;  3O62 D;  3B0D B;  3C1C B;  3W97 B;  2CV5 A;  2Y2K A;  2BG1 A;  1P3F C;  4R8P B;  5B2I C;  1H3O A;  5B40 D;  4WU8 C;  4QLC B;  3AV2 C;  4JJN A;  5AV9 C;  2PYO C;  3UT9 A;  1F66 D;  4XZQ C;  5AV5 D;  3MNN A;  2Y2L A;  1EQZ D;  3W98 A;  3LZ1 B;  4Z66 D;  5GSU A;  3AZN C;  4J8W B;  4J8V A;  1M1A A;  2NQB B;  3REH A;  2FJ7 C;  1N1J B;  3B6F B;  5CPI A;  5CPK D;  3AZI C;  3B6G C;  3X1S C;  4UUZ A;  1P3B A;  5B0Z A;  2HUE C;  5B32 A;  3REK A;  3KXB A;  4ZBJ B;  5E5A A;  1P34 C;  1AOI B;  3WAA A;  3NQU B;  5B33 A;  5AVB B;  5B1L B;  3O62 C;  1M19 D;  3UTA A;  5DNN D;  1WWS A;  4YM6 A;  4ZUX A;  3C1C A;  2HIO B;  5B40 C;  3WTP E;  3AYW D;  1U35 D;  4R8P A;  4WNN B;  1F66 C;  5DNM A;  5AV5 C;  2NZD B;  1EQZ C;  3LEL D;  4Z66 C;  5GT3 D;  1P3G D;  1P3I B;  3LZ1 A;  3WA9 B;  2BYK B;  5GT0 D;  5CP6 D;  4J8W A;  3AZM D;  5CPK C;  2NQB A;  1N1J A;  2Y2Q A;  3AZE B;  3WKJ B;  2DF4 C;  1P3A D;  3X1V D;  2Y2H A;  4J8X D;  3KWQ D;  5B31 G;  5B1M D;  1Q9C A;  1M19 C;  1AOI A;  3NQU A;  5BS7 C;  5DNN C;  5AVB A;  5B1L A;  3UTB D;  1P3O D;  5C3I B;  1TAF B;  2ARO D;  2JSS A;  3AZL B;  5GXQ B;  3AYW C;  1U35 C;  2XD5 A;  5B31 B;  2HIO A;  3AZJ D;  1T3U A;  3LEL C;  5GT3 C;  4H9R B;  1P3M B;  4WNN A;  5AY8 D;  3AN2 A;  1P3G C;  2NZD A;  3LJA B;  1P3P D;  5GT0 C;  5CP6 C;  3AZM C;  5F99 B;  1P3I A;  3AFA D;  3REI B;  4KHA B;  1KX5 B;  1ID3 B;  3X1V C;  4J8X C;  2Y2O A;  3VH5 A;  3LZ0 D;  3KWQ C;  1KX4 A;  4KGC B;  3AZE A;  3WKJ A;  3A1I A;  5B1M C;  4DRB A;  1TZY D;  4M6B A;  3TU4 D;  3KUY A;  3UTB C;  1P3O C;  5JRG D;  1BFM A;  2ARO C;  3AV1 D;  3MVD D;  5B0Y D;  3MGP B;  4XUJ B;  3AZL A;  2ZY3 A;  5GXQ A;  3AZJ C;  1P3F B;  2F8N G;  5B31 A;  5B2I B;  5AY8 C;  4KUD D;  3VH6 A;  4WU8 B;  2IO5 B;  3R45 B;  4EO5 C;  1P3P C;  2ZY2 A;  4H9R A;  3H0M C;  1P3M A;  5AV9 B;  3AFA C;  3REJ A;  3LJA A;  5F99 A;  3WAA B;  3UT9 D;  2F8N B;  2RVQ D;  1B6W A;  2J8P A;  3AZG D;  3LZ0 C;  2FJ7 B;  1KX5 A;  3W96 A;  1ID3 A;  2Y2G A;  3AZI B;  3B6G B;  1TZY C;  3TU4 C;  3VH5 W;  4E45 A;  4KGC A;  2YFW B;  2HUE B;  5B24 D;  5JRG C;  1P34 B;  5AV8 B;  3AV1 C;  4WZS B;  3MVD C;  5E5A D;  5B0Y C;  3AL0 C;  5DNM B;  5B2J A;  3X1T A;  3MGP A;  4XUJ A;  3C1B D;  4KUD C;  1WWI A;  5B40 B;  3EPH A;  3MGQ D;  1P3F A;  1S32 D;  3W97 D;  5B2I A;  1P3L D;  3VH6 W;  2BYM B;  3VH6 T;  3AZF D;  1F66 B;  4WU8 A;  3R45 A;  3AV2 A;  4Z66 B;  5AV9 A;  3UT9 C;  2RVQ C;  4XZQ A;  3AZG C;  4QLC D;  3AZN A;  2F8N A;  2FJ7 A;  5CPJ D;  4G91 C;  5B24 C;  3AZI A;  3B6G A;  3X1S A;  4UPK A;  4G92 C;  3B6F D;  1M18 D;  2YFW A;  1P34 A;  5E5A C;  5AV8 A;  1M19 B;  5G49 B;  3REL D;  4LD9 D;  3AZK D;  3O62 A;  3C1B C;  3AN2 B;  5BT1 D;  5B1L D;  3MGS D;  3AYW B;  3WTP D;  3MGQ C;  1U35 B;  1S32 C;  3W97 C;  2ZY5 A;  1P3L C;  4NE5 A;  3AZF C;  5B40 A;  5AVC D;  5AV6 D;  3P5J B;  3LEL B;  5GT3 B;  2BYM A;  1F66 A;  5AV5 A;  1KX4 B;  4QLC C;  1JFI A;  4Z66 A;  5GT0 B;  5CP6 B;  3AZM B;  4Z2M H;  3X1U B;  3KUY B;  1W2E A;  5CPJ C;  3FDD A;  1ULY A;  5CPK A;  1P3A B;  3WA9 D;  3KWQ B;  3B6F C;  1M18 C;  3AZH D;  5B1M B;  1HTA A;  3REL C;  1HQ3 B;  4LD9 C;  3AZK C;  1P3O B;  1M19 A;  2ARO B;  4H9S C;  5G49 A;  5BS7 A;  5DNN A;  3A6N D;  5BT1 C;  5B1L C;  3MGS C;  3EPK A;  2LY8 A;  3WTP C;  2L5A A;  4CSR B;  3REJ B;  5AVC C;  1ZLA D;  5AV6 C;  3AYW A;  1U35 A;  1KX3 D;  4YS3 D;  3W99 B;  5AY8 B;  3MGR B;  3LEL A;  1P3P B;  5GT3 A;  4WU9 B;  3W96 B;  2ZY4 A;  1P3G A;  2Y2M A;  3EPJ A;  5GT0 A;  5CP6 A;  3AZM A;  3X1U A;  4AWL B;  4X23 B;  3WA9 C;  3LZ0 B;  3AZH C;  2JCH A;  1P3A A;  5BO0 B;  1A7W A;  3REI D;  3TU4 B;  5B2J B;  3KWQ A;  3X1T B;  4Z5T D;  4J8U B;  5B1M A;  5JRG B;  2G5I C;  3AV1 B;  2F2A C;  4H9O B;  1HQ3 A;  3IP4 C;  3A6N C;  1P3K D;  1P3O A;  2XD1 A;  3MVD B;  2CV5 D;  2ARO A;  1ZLA C;  3AV2 B;  1KX3 C;  2RIQ A;  4NE3 A;  4YS3 C;  2PYO B;  4CSR A;  4XZQ B;  5FUG A;  1R4V A;  3AZJ A;  4JJN D;  3AZN B;  3W99 A;  5AY8 A;  3MNN D;  3W98 D;  3MGR A;  2Y2I A;  5GSU D;  1P3P A;  4WU9 A;  4J8V D;  1M1A D;  3REH D;  3X1S B;  2JE5 A;  3AZG B;  5CPI D;  1BH8 B;  3REI C;  4X23 A;  1P3B D;  3LZ0 A;  5B0Z D;  4Z5T C;  5B32 D;  3REK D;  3KXB D;  3WAA D;  3O62 B;  5B24 B;  5BO0 A;  5B33 D;  3TU4 A;  2FFF B;  1P3K C;  4J8U A;  2G5H C;  3B0C T;  3UTA D;  5JRG A;  2CV5 C;  4HGA C;  3AV1 A;  4H9O A;  4YM6 D;  4ZUX D;  3C1C D;  3EG5 B;  3MVD A;  5B0Y A;  4DRA A;  5AV5 B;  2F8N K;  1EQZ B;  4H9P B;  1JFI B;  4R8P D;  4JJN C;  3MGQ B;  2PYO A;  1S32 B;  5DNM D;  3MNN C;  1P3L B;  4KUD A;  3AZF B;  3W98 C;  5GSU C;  4J8V C;  5CPK B;  1M1A C;  3REH C;  2IO5 C;  3LZ1 D;  5CPI C;  4J8W D;  2NQB D;  1P3B C;  3AZG A;  5B0Z C;  5B32 C;  3REK C;  3KXB C;  3WAA C;  5CPJ B;  1BH8 A;  5B33 C;  5DNN B;  5BNV B;  1M18 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...