1ID3D

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2001-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3D00
4X23C 3AZMD 4DRAA 3AFAD 2NQBA 3C1BD 5DNMD 5B2JB 3MGPA 3MGRA 3B6GA 2RVQD 5GSUB 1S32C 5AV8A 5CPIB 1KX4A 3AZHD 5B33D 5B1LC 5BNVA 1M1AB 3MGSD 4KGCA 5FUGB 1TZYA 5AY8B 3AZMA 4XZQC 4EO5C 3AZGA 5DNMA 4Z5TA 5AV9C 3UTBD 5DNNC 3AZHA 1KX3C 5AV6D 3KXBC 5B33A 5AV5C 4J8VB 3LZ1C 3AZLC 3AZFD 3MGSA 3WAAC 3W97B 2IO5B 4E45A 2CV5D 5B24C 1M18C 3LELC 4WU9B 1H3OB 3WA9D 4YS3D 3X1UC 4J8UB 3REJD 3UT9C 2F8NB 4LD9D 5GT0A 5CPJD 4YM6C 4KHAA 2HIOD 5AV6A 3AZEB 5B0ZC 1P34A 5GXQC 1P3MD 2PYOC 3AZFA 1P3OC 3KWQC 3NQUB 5BO0A 3AN2C 4NFTA 4WU8C 3B6FB 5CPKB 1P3BD 3AZNC 5B1MA 4XUJC 2F8NH 1P3FB 5AVBD 4YS3A 3REIA 5E5AB 3W99D 4X23A 5JRGC 2HIOA 1AOIB 3VH5T 3UTAB 1P3MA 1P3PD 1ID3D 4J8XC 3AZIB 4R8PC 1S32A 1U35B 3MVDC 5AV9B 5DNNB 3AYWD 2JSSA 4J8WD 4CAYB 5B1LA 3R45B 4M6BA 1BH9B 5GT3B 3W98D 1ZLAB 1KX5D 3WTPB 5AV5B 4H9NA 4XZQA 3C1CC 5G49A 3REHC 4AWLC 3WAAB 3MNND 1ID3A 3WKJC 4H9PB 1WWSA 3AZJB 5B24B 3REKD 2F8NK 3KUYD 3X1UB 5BNXA 3TU4D 3AYWA 4J8WA 1M19D 5GSUC 3KXBA 4JJND 3LZ1A 5CPIC 1HQ3D 1P3AD 1KX5A 2PYOB 3V9RB 3KWQB 1M18A 3LELA 1M1AC 4XUJD 3UT9A 5KDMA 5F99D 5AY8C 5B2IB 5B32B 3NQJB 3X1SD 5B0ZA 3AV2B 5GXQA 1M19A 3MGQD 4Z66B 5C3IB 2BYMB 4H9QA 4R8PD 3AN2A 4WU8A 2AROD 3VH5A 5B31B 1BH8B 3AZNA 4XUJA 2IO5C 5F99A 2CWEA 4Z2MH 4UUZA 5BS7C 2BYKB 5B0YD 3B6GD 3X1SA 5JRGA 5AV8D 4WU9C 2YFWA 1KX4D 4J8UC 3MGQA 3WKJD 4J8XA 4R8PA 3REHB 4AWLB 3LZ0B 3MVDA 3AZEC 1TZYD 5B2JD 5JA4A 5GSUD 3AZGD 3B6FC 5CPKC 4Z5TD 5B0YA 3X1TC 2NZDB 1P3FC 1P3IB 5E5AC 3WKJA 5CP6D 4H9RA 3LJAC 2NQBB 4NE3A 4QLCC 1AOIC 3MGRB 3UTAC 5B2JA 4Z2MG 5B40B 5GSUA 3AZIC 5CPIA 1U35C 3AZKB 3A6NB 1F66D 5GT0D 4KGCB 3B0DB 4J8VD 1M1AA 5CP6A 5GT3C 1JFIB 3W97D 5FUGA 3AFAB 1P34D 5AY8A 3C1BB 1ZLAC 4CSRB 2FJ7C 3WTPC 1B6WA 2YFVA 3KSYA 1BFMA 4WV4B 3AZHB 3AZJC 4H9SC 1EQZB 5B1MD 4NE5A 1F66A 3REID 3X1VD 1P3KB 1KU5A 3B0CW 4X23D 4J8VA 3W97A 5BS7A 3UTBB 1S32D 1H3OA 4J8UA 5E5AD 5B2IC 4HGAB 5B32C 5AV6B 3X1TB 5B1LD 3AZEA 3AZFB 3AV2C 4H9OB 4ZUXB 5CHLB 5C3IC 4Z66C 3LJAB 4QLCB 3X1VA 3VH6W 4E44A 3NQUA 3AZID 4WZSB 4XZQD 1P3GB 1P3LB 2CV5B 3B6FA 5CPKA 5AV9D 5B31C 3WA9B 5DNND 3REJB 3O62B 4LD9B 1Q9CA 5CPJB 1P3FA 1KX3D 5E5AA 2HIOB 3KXBD 5AV5D 3AZLD 3LZ1D 1AOIA 3WAAD 3UTAA 5AVCC 2FJ7B 3AZIA 5B24D 1P3BB 3LZ0C 5AV9A 3LELD 1M18D 4KUDC 5DNNA 3X1UD 3UT9D 5AVBB 4YM6D 4CAYA 3W99B 2F8NG 3R45A 1KX3A 1BH9A 3RELB 5B0ZD 5GXQD 1ZLAA 5AV5A 3WTPA 3AZLA 1P3PB 1P3OD 2PYOD 2NZDC 3KWQD 3WAAA 3AN2D 4WNNB 1P3IC 3AV1B 4WU8D 4H9PA 2NQBC 3AZJA 5B24A 3AZND 3MGRC 3AYWB 3X1UA 2LY8A 5B40C 4YM6A 5BT1C 3W98B 5JRGD 1KX5B 3AZKC 3W96B 3A6NC 3MNNB 2PYOA 4J8XD 1P3OA 4KGCC 3V9RA 3B0DC 3KWQA 5KDMB 2HUEB 3REKB 3AZMC 3MVDD 3AFAC 3C1BC 3KUYB 3NQJA 3TU4B 1N1JB 4JJNB 3AV2A 1HQ3B 3AZHC 2BYMA 1P3AB 1EQZC 4G91B 1TAFB 3C1CD 3REHD 5B33C 5AVCB 5B31A 1BH8A 1P3KC 5F99B 4KUDB 3B0CT 3X1SB 3UTBC 5CPID 1P3ID 4HGAC 5AV6C 2AROB 3C1CA 3REHA 3LZ0A 1M1AD 4G92B 3AZFC 4ZUXC 1ULYA 5AY8D 1P3GC 3MGPB 1P3LC 2CV5C 3VH6T 3B6GB 5B32G 5AV8B 3WA9C 4YS3C 3REJC 1KX4B 3O62C 4LD9C 2NZDA 5CPJC 1P3IA 2HIOC 5BNVB 1P3MC 1TZYB 5B31G 3AZMB 3AZGB 5B40A 5DNMB 4Z5TB 1EQZD 1P3BC 4WU9D 3AZKA 4ZBJB 3A6NA 4J8UD 2F8ND 5AVBC 5CP6B 3W99C 1P3KD 3WTPE 3RELC 1JFIA 5B33B 3AFAA 3AZED 3MGSB 3C1BA 4CSRA 2YFVB 1P3PC 1ID3C 1B67A 4DRBA 3AV1C 3B6FD 5CPKD 1F66B 1EQZA 3X1TD 4WU9A 5GT0B 3AYWC 4J8WC 1P3FD 2F8NA 4KHAB 4ZUXD 3LJAD 1P3KA 3W98C 4QLCD 1P34B 1KX5C 1P3GD 1AOID 1P3LD 3W96C 1HTAA 3UTAD 5BO0B 3MNNC 3UTBA 3O62D 2HUEC 3REKC 1U35D 3VH6A 5B1MB 3KUYC 4NE6A 4YS3B 3REIB 3TU4C 3X1TA 1M19C 1F1EA 3X1VB 4JJNC 1R4VA 4X23B 5GT3D 4H9OA 1HQ3C 4ZUXA 3LJAA 4QLCA 1P3AC 1ZLAD 1P3MB 2FJ7D 3WTPD 1P3GA 4G91C 1P3LA 2CV5A 1S32B 3WA9A 3REJA 3O62A 3AZJD 5F99C 4LD9A 3B0BA 5CPJA 1U35A 3RELD 3X1SC 5B1LB 3MGQC 5GT3A 4H9NB 4XZQB 4EO5B 3AV1D 5G49B 2FJ7A 2AROC 1ID3B 1P3BA 4G92C 5AVBA 1KX3B 5B2ID 4H9SA 5B32D 5BNXB 5B0YC 3MGPC 3W99A 4J8WB 3B6GC 3RELA 3KXBB 3AZLB 3LZ1B 5AV8C 3AV2D 3W96D 1KX4C 4Z66D 1P3PA 4WNNA 3AV1A 5B31D 3LELB 1M18B 3UT9B 1TZYC 5B2JC 4YM6B 3AZGC 5B2IA 5DNMC 4Z5TC 5B32A 1WWIA 3W98A 5B0ZB 5GXQB 1M19B 2RVQC 3W96A 4ZBJC 1P3OB 4Z66A 4H9QB 5AVCD 3MNNA 3AN2B 4WU8B 5CP6C 3REKA 3LZ0D 3AZNB 4KUDD 4XUJB 3MGSC 3KUYA 3TU4A 1N1JA 4UUZB 4JJNA 3VH5W 5JRGB 2BYKA 1HQ3A 2L5AA 2YFWB 1F66C 1P3AA 3MGQB 5GT0C 1TAFA 2NZDD 4J8XB 4J8VC 5AVCA 4R8PB 3MVDB 2NQBD 3W97C 1P34C 3MGPD 5JA4B 4KUDA 3MGRD 1A7WA 5B40D 5BT1D 5B0YB 3AZKD 3A6ND 5B1MC 3C1CB 3REIC 2AROA 3WKJB 4KGCD 4H9RB 3X1VC
chains in the Genus database with same CATH superfamily
4X23C 3AZMD 4DRAA 3AFAD 2NQBA 3C1BD 5DNMD 2F2AC 5B2JB 3MGPA 3MGRA 3B6GA 2RVQD 5GSUB 1S32C 5AV8A 5CPIB 2ZY4A 1KX4A 3AZHD 5B33D 5B1LC 5BNVA 1M1AB 2Y2QA 3MGSD 4KGCA 5FUGB 1T3UA 1TZYA 5AY8B 3AZMA 4XZQC 4EO5C 3AZGA 5DNMA 4Z5TA 5AV9C 3UTBD 5DNNC 3AZHA 1KX3C 3H0MC 5AV6D 3KXBC 5B33A 5AV5C 4J8VB 3LZ1C 3AZLC 3AZFD 3MGSA 3WAAC 3W97B 2IO5B 4E45A 2CV5D 5B24C 1M18C 3LELC 4WU9B 1H3OB 3WA9D 4YS3D 3X1UC 4J8UB 3REJD 3UT9C 2F8NB 4LD9D 5GT0A 5CPJD 4YM6C 4KHAA 2HIOD 5AV6A 3AZEB 5B0ZC 1P34A 5GXQC 2Y2KA 1P3MD 2PYOC 3AZFA 1P3OC 3KWQC 3NQUB 5BO0A 3AN2C 4NFTA 4WU8C 3B6FB 5CPKB 1P3BD 3AZNC 5B1MA 4XUJC 2F8NH 1P3FB 2FFFB 5AVBD 4YS3A 3REIA 5E5AB 3W99D 3A1IA 4X23A 5JRGC 2HIOA 1AOIB 3VH5T 3P5JB 3UTAB 1P3MA 1P3PD 1ID3D 4J8XC 3AZIB 4R8PC 1S32A 1U35B 3MVDC 5AV9B 5DNNB 3AYWD 2JSSA 4J8WD 4CAYB 5B1LA 3R45B 4M6BA 1BH9B 2VQRA 5GT3B 3W98D 3EG5B 4UPKA 1KX5D 1ZLAB 3WTPB 5AV5B 4H9NA 4XZQA 3C1CC 5G49A 3REHC 4AWLC 3WAAB 3MNND 1ID3A 3WKJC 4H9PB 2Y2PA 1WWSA 1PZRA 3AZJB 5B24B 3REKD 2F8NK 3KUYD 3X1UB 5BNXA 3EPLA 3TU4D 3AYWA 4J8WA 1M19D 5GSUC 3KXBA 4JJND 3LZ1A 5CPIC 1HQ3D 1P3AD 1KX5A 2PYOB 3V9RB 3KWQB 1M18A 3LELA 1M1AC 4XUJD 3UT9A 5KDMA 5F99D 5AY8C 5B2IB 5B32B 3NQJB 3X1SD 5B0ZA 3AV2B 5GXQA 1M19A 3MGQD 4Z66B 5C3IB 2BYMB 4H9QA 4R8PD 3AN2A 4WU8A 2AROD 3VH5A 5B31B 1BH8B 3AZNA 4XUJA 2IO5C 5F99A 2CWEA 4Z2MH 4UUZA 5B0YD 2BYKB 5BS7C 3H0RC 3B6GD 3X1SA 5JRGA 3H0LC 5AV8D 4WU9C 2YFWA 1KX4D 4J8UC 3MGQA 2RIQA 3WKJD 3F6TA 4J8XA 4R8PA 3REHB 4AWLB 3LZ0B 3MVDA 3AZEC 1TZYD 5B2JD 5JA4A 5GSUD 3AZGD 3B6FC 5CPKC 4Z5TD 5B0YA 2W8SA 2DQNC 3X1TC 2NZDB 1P3FC 1P3IB 5E5AC 3WKJA 5CP6D 4H9RA 3LJAC 2NQBB 4NE3A 4QLCC 2ZY5A 1AOIC 3EPKA 3MGRB 3UTAC 5B2JA 4Z2MG 5B40B 5GSUA 3AZIC 5CPIA 1U35C 3AZKB 3A6NB 1F66D 5GT0D 4WJ3C 4KGCB 3B0DB 4J8VD 1M1AA 5CP6A 5GT3C 1JFIB 3W97D 5FUGA 3AFAB 1P34D 5AY8A 3C1BB 1ZLAC 4CSRB 2FJ7C 3WTPC 1B6WA 2YFVA 3KSYA 1BFMA 4WV4B 3AZHB 3AZJC 4H9SC 1EQZB 5B1MD 4NE5A 1F66A 2Y2IA 3REID 3X1VD 1P3KB 1KU5A 3B0CW 4X23D 4J8VA 3EPHA 3KFUG 3W97A 5BS7A 3UTBB 1S32D 1H3OA 4J8UA 5E5AD 5B2IC 5B32C 5AV6B 4HGAB 3X1TB 5B1LD 3AZEA 3AZFB 3AV2C 4H9OB 4ZUXB 5CHLB 5C3IC 4Z66C 3LJAB 4QLCB 3X1VA 3VH6W 4E44A 3NQUA 4DQYB 4WZSB 4XZQD 3AZID 1P3GB 2CV5B 1P3LB 2G5IC 5CPKA 5AV9D 3B6FA 5B31C 3WA9B 5DNND 3REJB 3O62B 4LD9B 1Q9CA 5CPJB 1P3FA 1KX3D 5E5AA 2HIOB 3KXBD 5AV5D 3AZLD 3LZ1D 1AOIA 3WAAD 3UTAA 5AVCC 2FJ7B 3AZIA 5B24D 1P3BB 3LZ0C 5AV9A 3LELD 1M18D 4KUDC 5DNNA 3X1UD 3UT9D 5AVBB 4YM6D 4CAYA 3W99B 2F8NG 3R45A 1KX3A 1BH9A 3RELB 5B0ZD 5GXQD 1ZLAA 5AV5A 3WTPA 3AZLA 1P3PB 1P3OD 2PYOD 2NZDC 3KWQD 3WAAA 3AN2D 4WNNB 1P3IC 3AV1B 4WU8D 4H9PA 2XD5A 2NQBC 3AZJA 5B24A 3AZND 3MGRC 3AYWB 3X1UA 2LY8A 5B40C 4YM6A 5BT1C 3W98B 5JRGD 1KX5B 3FDDA 3AZKC 3W96B 3A6NC 3MNNB 2PYOA 4J8XD 1P3OA 4KGCC 3V9RA 3B0DC 3KWQA 5KDMB 2HUEB 3REKB 3AZMC 3MVDD 3AFAC 3C1BC 3KUYB 2UWXA 3NQJA 3TU4B 1N1JB 4JJNB 3AV2A 1HQ3B 3AZHC 2BYMA 1P3AB 1EQZC 2BG1A 4G91B 1TAFB 2Y2GA 3C1CD 3REHD 5B33C 5AVCB 5B31A 1BH8A 2JE5A 1P3KC 5F99B 4KUDB 3B0CT 3X1SB 3UTBC 2Y2MA 3IP4C 5CPID 1P3ID 2DF4C 4HGAC 5AV6C 2AROB 3C1CA 3REHA 3LZ0A 1M1AD 4G92B 3AZFC 4ZUXC 1ULYA 5AY8D 2JCHA 1P3GC 3MGPB 1P3LC 2CV5C 3VH6T 3B6GB 5B32G 5AV8B 3WA9C 4YS3C 3REJC 1KX4B 3O62C 4LD9C 2NZDA 5CPJC 1P3IA 2HIOC 5BNVB 1P3MC 2Y2NA 1TZYB 2J8PA 5B31G 3AZMB 2XD1A 3AZGB 5B40A 5DNMB 4Z5TB 1EQZD 1P3BC 4WU9D 3AZKA 4ZBJB 3A6NA 4J8UD 2F8ND 5AVBC 5CP6B 3W99C 1P3KD 3WTPE 3RELC 1JFIA 5B33B 3AFAA 3AZED 3MGSB 3C1BA 4CSRA 2YFVB 1P3PC 1ID3C 1B67A 2ZM5A 4DRBA 3AV1C 3B6FD 5CPKD 1F66B 1EQZA 2ZY3A 3X1TD 4WU9A 5GT0B 3AYWC 4J8WC 1P3FD 2F8NA 4KHAB 2Y2JA 4ZUXD 2Y2LA 3LJAD 1P3KA 4QLCD 1P34B 3W98C 1KX5C 1P3GD 1AOID 1P3LD 3W96C 1HTAA 3UTAD 5BO0B 3MNNC 3UTBA 3A1KA 3O62D 1Z2CB 2HUEC 2ZY2A 3REKC 1U35D 3VH6A 5B1MB 3KUYC 4NE6A 4YS3B 3REIB 3TU4C 3X1TA 1M19C 1F1EA 3X1VB 4JJNC 1R4VA 4X23B 5GT3D 4H9OA 1HQ3C 4ZUXA 3LJAA 4QLCA 1P3AC 1ZLAD 1P3MB 2FJ7D 3WTPD 1P3GA 4G91C 1P3LA 2CV5A 1S32B 3WA9A 3REJA 3O62A 3AZJD 5F99C 4LD9A 3B0BA 5CPJA 1U35A 3RELD 3X1SC 2Y2OA 5B1LB 2G5HC 3MGQC 5GT3A 4H9NB 4XZQB 4EO5B 3AV1D 5G49B 2FJ7A 2AROC 1ID3B 3AL0C 1P3BA 4G92C 5AVBA 1KX3B 5B2ID 4H9SA 5B32D 5BNXB 5B0YC 3MGPC 3W99A 3EPJA 4J8WB 3B6GC 3RELA 3KXBB 3AZLB 3LZ1B 5AV8C 3AV2D 3W96D 1KX4C 4Z66D 1P3PA 4WNNA 3AV1A 5B31D 3LELB 1M18B 3UT9B 1TZYC 5B2JC 4YM6B 3AZGC 5B2IA 5DNMC 4Z5TC 5B32A 1WWIA 3W98A 5B0ZB 5GXQB 1M19B 2RVQC 3W96A 4ZBJC 1P3OB 4Z66A 4H9QB 5AVCD 3MNNA 3AN2B 4WU8B 5CP6C 3REKA 3LZ0D 3AZNB 4KUDD 4XUJB 3MGSC 3KUYA 3TU4A 1N1JA 4UUZB 4JJNA 3VH5W 5JRGB 2BYKA 1HQ3A 2L5AA 2YFWB 1F66C 1P3AA 2Y2HA 3MGQB 5GT0C 1TAFA 2NZDD 4J8XB 1W2EA 4J8VC 5AVCA 4R8PB 3MVDB 2NQBD 3W97C 1P34C 3MGPD 5JA4B 4KUDA 3MGRD 1A7WA 5B40D 5BT1D 5B0YB 3AZKD 3A6ND 5B1MC 3C1CB 3REIC 2AROA 3WKJB 4KGCD 4H9RB 3X1VC
chains in the Genus database with same CATH topology
4X23C 3AZMD 4DRAA 3AFAD 2NQBA 3C1BD 5DNMD 2F2AC 5B2JB 3MGPA 3MGRA 3B6GA 2RVQD 5GSUB 1S32C 5AV8A 5CPIB 2ZY4A 1KX4A 3AZHD 5B33D 5B1LC 5BNVA 1M1AB 2Y2QA 3MGSD 4KGCA 5FUGB 1T3UA 1TZYA 5AY8B 3AZMA 4XZQC 4EO5C 3AZGA 5DNMA 4Z5TA 5AV9C 3UTBD 5DNNC 3AZHA 1KX3C 3H0MC 5AV6D 3KXBC 5B33A 5AV5C 4J8VB 3LZ1C 3AZLC 3AZFD 3MGSA 3WAAC 3W97B 2IO5B 4E45A 2CV5D 5B24C 1M18C 3LELC 4WU9B 1H3OB 3WA9D 4YS3D 3X1UC 4J8UB 3REJD 3UT9C 2F8NB 4LD9D 5GT0A 5CPJD 4YM6C 4KHAA 2HIOD 5AV6A 3AZEB 5B0ZC 1P34A 5GXQC 2Y2KA 1P3MD 2PYOC 3AZFA 1P3OC 3KWQC 3NQUB 5BO0A 3AN2C 4NFTA 4WU8C 3B6FB 5CPKB 1P3BD 3AZNC 5B1MA 4XUJC 2F8NH 1P3FB 2FFFB 5AVBD 4YS3A 3REIA 5E5AB 3W99D 3A1IA 4X23A 5JRGC 2HIOA 1AOIB 3VH5T 3P5JB 3UTAB 1P3MA 1P3PD 1ID3D 4J8XC 3AZIB 4R8PC 1S32A 1U35B 3MVDC 5AV9B 5DNNB 3AYWD 2JSSA 4J8WD 4CAYB 5B1LA 3R45B 4M6BA 1BH9B 2VQRA 5GT3B 3W98D 3EG5B 4UPKA 1KX5D 1ZLAB 3WTPB 5AV5B 4H9NA 4XZQA 3C1CC 5G49A 3REHC 4AWLC 3WAAB 3MNND 1ID3A 3WKJC 4H9PB 2Y2PA 1WWSA 1PZRA 3AZJB 5B24B 3REKD 2F8NK 3KUYD 3X1UB 5BNXA 3EPLA 3TU4D 3AYWA 4J8WA 1M19D 5GSUC 3KXBA 4JJND 3LZ1A 5CPIC 1HQ3D 1P3AD 1KX5A 2PYOB 3V9RB 3KWQB 1M18A 3LELA 1M1AC 4XUJD 3UT9A 5KDMA 5F99D 5AY8C 5B2IB 5B32B 3NQJB 3X1SD 5B0ZA 3AV2B 5GXQA 1M19A 3MGQD 4Z66B 5C3IB 2BYMB 4H9QA 4R8PD 3AN2A 4WU8A 2AROD 3VH5A 5B31B 1BH8B 3AZNA 4XUJA 2IO5C 5F99A 2CWEA 4Z2MH 4UUZA 5B0YD 2BYKB 5BS7C 3H0RC 3B6GD 3X1SA 5JRGA 3H0LC 5AV8D 4WU9C 2YFWA 1KX4D 4J8UC 3MGQA 2RIQA 3WKJD 3F6TA 4J8XA 4R8PA 3REHB 4AWLB 3LZ0B 3MVDA 3AZEC 1TZYD 5B2JD 5JA4A 5GSUD 3AZGD 3B6FC 5CPKC 4Z5TD 5B0YA 2W8SA 2DQNC 3X1TC 2NZDB 1P3FC 1P3IB 5E5AC 3WKJA 5CP6D 4H9RA 3LJAC 2NQBB 4NE3A 4QLCC 2ZY5A 1AOIC 3EPKA 3MGRB 3UTAC 5B2JA 4Z2MG 5B40B 5GSUA 3AZIC 5CPIA 1U35C 3AZKB 3A6NB 1F66D 5GT0D 4WJ3C 4KGCB 3B0DB 4J8VD 1M1AA 5CP6A 5GT3C 1JFIB 3W97D 5FUGA 3AFAB 1P34D 5AY8A 3C1BB 1ZLAC 4CSRB 2FJ7C 3WTPC 1B6WA 2YFVA 3KSYA 1BFMA 4WV4B 3AZHB 3AZJC 4H9SC 1EQZB 5B1MD 4NE5A 1F66A 2Y2IA 3REID 3X1VD 1P3KB 1KU5A 3B0CW 4X23D 4J8VA 3EPHA 3KFUG 3W97A 5BS7A 3UTBB 1S32D 1H3OA 4J8UA 5E5AD 5B2IC 5B32C 5AV6B 4HGAB 3X1TB 5B1LD 3AZEA 3AZFB 3AV2C 4H9OB 4ZUXB 5CHLB 5C3IC 4Z66C 3LJAB 4QLCB 3X1VA 3VH6W 4E44A 3NQUA 4DQYB 4WZSB 4XZQD 3AZID 1P3GB 2CV5B 1P3LB 2G5IC 5CPKA 5AV9D 3B6FA 5B31C 3WA9B 5DNND 3REJB 3O62B 4LD9B 1Q9CA 5CPJB 1P3FA 1KX3D 5E5AA 2HIOB 3KXBD 5AV5D 3AZLD 3LZ1D 1AOIA 3WAAD 3UTAA 5AVCC 2FJ7B 3AZIA 5B24D 1P3BB 3LZ0C 5AV9A 3LELD 1M18D 4KUDC 5DNNA 3X1UD 3UT9D 5AVBB 4YM6D 4CAYA 3W99B 2F8NG 3R45A 1KX3A 1BH9A 3RELB 5B0ZD 5GXQD 1ZLAA 5AV5A 3WTPA 3AZLA 1P3PB 1P3OD 2PYOD 2NZDC 3KWQD 3WAAA 3AN2D 4WNNB 1P3IC 3AV1B 4WU8D 4H9PA 2XD5A 2NQBC 3AZJA 5B24A 3AZND 3MGRC 3AYWB 3X1UA 2LY8A 5B40C 4YM6A 5BT1C 3W98B 5JRGD 1KX5B 3FDDA 3AZKC 3W96B 3A6NC 3MNNB 2PYOA 4J8XD 1P3OA 4KGCC 3V9RA 3B0DC 3KWQA 5KDMB 2HUEB 3REKB 3AZMC 3MVDD 3AFAC 3C1BC 3KUYB 2UWXA 3NQJA 3TU4B 1N1JB 4JJNB 3AV2A 1HQ3B 3AZHC 2BYMA 1P3AB 1EQZC 2BG1A 4G91B 1TAFB 2Y2GA 3C1CD 3REHD 5B33C 5AVCB 5B31A 1BH8A 2JE5A 1P3KC 5F99B 4KUDB 3B0CT 3X1SB 3UTBC 2Y2MA 3IP4C 5CPID 1P3ID 2DF4C 4HGAC 5AV6C 2AROB 3C1CA 3REHA 3LZ0A 1M1AD 4G92B 3AZFC 4ZUXC 1ULYA 5AY8D 2JCHA 1P3GC 3MGPB 1P3LC 2CV5C 3VH6T 3B6GB 5B32G 5AV8B 3WA9C 4YS3C 3REJC 1KX4B 3O62C 4LD9C 2NZDA 5CPJC 1P3IA 2HIOC 5BNVB 1P3MC 2Y2NA 1TZYB 2J8PA 5B31G 3AZMB 2XD1A 3AZGB 5B40A 5DNMB 4Z5TB 1EQZD 1P3BC 4WU9D 3AZKA 4ZBJB 3A6NA 4J8UD 2F8ND 5AVBC 5CP6B 3W99C 1P3KD 3WTPE 3RELC 1JFIA 5B33B 3AFAA 3AZED 3MGSB 3C1BA 4CSRA 2YFVB 1P3PC 1ID3C 1B67A 2ZM5A 4DRBA 3AV1C 3B6FD 5CPKD 1F66B 1EQZA 2ZY3A 3X1TD 4WU9A 5GT0B 3AYWC 4J8WC 1P3FD 2F8NA 4KHAB 2Y2JA 4ZUXD 2Y2LA 3LJAD 1P3KA 4QLCD 1P34B 3W98C 1KX5C 1P3GD 1AOID 1P3LD 3W96C 1HTAA 3UTAD 5BO0B 3MNNC 3UTBA 3A1KA 3O62D 1Z2CB 2HUEC 2ZY2A 3REKC 1U35D 3VH6A 5B1MB 3KUYC 4NE6A 4YS3B 3REIB 3TU4C 3X1TA 1M19C 1F1EA 3X1VB 4JJNC 1R4VA 4X23B 5GT3D 4H9OA 1HQ3C 4ZUXA 3LJAA 4QLCA 1P3AC 1ZLAD 1P3MB 2FJ7D 3WTPD 1P3GA 4G91C 1P3LA 2CV5A 1S32B 3WA9A 3REJA 3O62A 3AZJD 5F99C 4LD9A 3B0BA 5CPJA 1U35A 3RELD 3X1SC 2Y2OA 5B1LB 2G5HC 3MGQC 5GT3A 4H9NB 4XZQB 4EO5B 3AV1D 5G49B 2FJ7A 2AROC 1ID3B 3AL0C 1P3BA 4G92C 5AVBA 1KX3B 5B2ID 4H9SA 5B32D 5BNXB 5B0YC 3MGPC 3W99A 3EPJA 4J8WB 3B6GC 3RELA 3KXBB 3AZLB 3LZ1B 5AV8C 3AV2D 3W96D 1KX4C 4Z66D 1P3PA 4WNNA 3AV1A 5B31D 3LELB 1M18B 3UT9B 1TZYC 5B2JC 4YM6B 3AZGC 5B2IA 5DNMC 4Z5TC 5B32A 1WWIA 3W98A 5B0ZB 5GXQB 1M19B 2RVQC 3W96A 4ZBJC 1P3OB 4Z66A 4H9QB 5AVCD 3MNNA 3AN2B 4WU8B 5CP6C 3REKA 3LZ0D 3AZNB 4KUDD 4XUJB 3MGSC 3KUYA 3TU4A 1N1JA 4UUZB 4JJNA 3VH5W 5JRGB 2BYKA 1HQ3A 2L5AA 2YFWB 1F66C 1P3AA 2Y2HA 3MGQB 5GT0C 1TAFA 2NZDD 4J8XB 1W2EA 4J8VC 5AVCA 4R8PB 3MVDB 2NQBD 3W97C 1P34C 3MGPD 5JA4B 4KUDA 3MGRD 1A7WA 5B40D 5BT1D 5B0YB 3AZKD 3A6ND 5B1MC 3C1CB 3REIC 2AROA 3WKJB 4KGCD 4H9RB 3X1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 C;  3AZM D;  4DRA A;  3AFA D;  2NQB A;  3C1B D;  5DNM D;  5B2J B;  3MGP A;  3MGR A;  3B6G A;  2RVQ D;  5GSU B;  1S32 C;  5AV8 A;  5CPI B;  1KX4 A;  3AZH D;  5B33 D;  5B1L C;  5BNV A;  1M1A B;  3MGS D;  4KGC A;  5FUG B;  1TZY A;  5AY8 B;  3AZM A;  4XZQ C;  4EO5 C;  3AZG A;  5DNM A;  4Z5T A;  5AV9 C;  3UTB D;  5DNN C;  3AZH A;  1KX3 C;  5AV6 D;  3KXB C;  5B33 A;  5AV5 C;  4J8V B;  3LZ1 C;  3AZL C;  3AZF D;  3MGS A;  3WAA C;  3W97 B;  2IO5 B;  4E45 A;  2CV5 D;  5B24 C;  1M18 C;  3LEL C;  4WU9 B;  1H3O B;  3WA9 D;  4YS3 D;  3X1U C;  4J8U B;  3REJ D;  3UT9 C;  2F8N B;  4LD9 D;  5GT0 A;  5CPJ D;  4YM6 C;  4KHA A;  2HIO D;  5AV6 A;  3AZE B;  5B0Z C;  1P34 A;  5GXQ C;  1P3M D;  2PYO C;  3AZF A;  1P3O C;  3KWQ C;  3NQU B;  5BO0 A;  3AN2 C;  4NFT A;  4WU8 C;  3B6F B;  5CPK B;  1P3B D;  3AZN C;  5B1M A;  4XUJ C;  2F8N H;  1P3F B;  5AVB D;  4YS3 A;  3REI A;  5E5A B;  3W99 D;  4X23 A;  5JRG C;  2HIO A;  1AOI B;  3VH5 T;  3UTA B;  1P3M A;  1P3P D;  1ID3 D;  4J8X C;  3AZI B;  4R8P C;  1S32 A;  1U35 B;  3MVD C;  5AV9 B;  5DNN B;  3AYW D;  2JSS A;  4J8W D;  4CAY B;  5B1L A;  3R45 B;  4M6B A;  1BH9 B;  5GT3 B;  3W98 D;  1ZLA B;  1KX5 D;  3WTP B;  5AV5 B;  4H9N A;  4XZQ A;  3C1C C;  5G49 A;  3REH C;  4AWL C;  3WAA B;  3MNN D;  1ID3 A;  3WKJ C;  4H9P B;  1WWS A;  3AZJ B;  5B24 B;  3REK D;  2F8N K;  3KUY D;  3X1U B;  5BNX A;  3TU4 D;  3AYW A;  4J8W A;  1M19 D;  5GSU C;  3KXB A;  4JJN D;  3LZ1 A;  5CPI C;  1HQ3 D;  1P3A D;  1KX5 A;  2PYO B;  3V9R B;  3KWQ B;  1M18 A;  3LEL A;  1M1A C;  4XUJ D;  3UT9 A;  5KDM A;  5F99 D;  5AY8 C;  5B2I B;  5B32 B;  3NQJ B;  3X1S D;  5B0Z A;  3AV2 B;  5GXQ A;  1M19 A;  3MGQ D;  4Z66 B;  5C3I B;  2BYM B;  4H9Q A;  4R8P D;  3AN2 A;  4WU8 A;  2ARO D;  3VH5 A;  5B31 B;  1BH8 B;  3AZN A;  4XUJ A;  2IO5 C;  5F99 A;  2CWE A;  4Z2M H;  4UUZ A;  5BS7 C;  2BYK B;  5B0Y D;  3B6G D;  3X1S A;  5JRG A;  5AV8 D;  4WU9 C;  2YFW A;  1KX4 D;  4J8U C;  3MGQ A;  3WKJ D;  4J8X A;  4R8P A;  3REH B;  4AWL B;  3LZ0 B;  3MVD A;  3AZE C;  1TZY D;  5B2J D;  5JA4 A;  5GSU D;  3AZG D;  3B6F C;  5CPK C;  4Z5T D;  5B0Y A;  3X1T C;  2NZD B;  1P3F C;  1P3I B;  5E5A C;  3WKJ A;  5CP6 D;  4H9R A;  3LJA C;  2NQB B;  4NE3 A;  4QLC C;  1AOI C;  3MGR B;  3UTA C;  5B2J A;  4Z2M G;  5B40 B;  5GSU A;  3AZI C;  5CPI A;  1U35 C;  3AZK B;  3A6N B;  1F66 D;  5GT0 D;  4KGC B;  3B0D B;  4J8V D;  1M1A A;  5CP6 A;  5GT3 C;  1JFI B;  3W97 D;  5FUG A;  3AFA B;  1P34 D;  5AY8 A;  3C1B B;  1ZLA C;  4CSR B;  2FJ7 C;  3WTP C;  1B6W A;  2YFV A;  3KSY A;  1BFM A;  4WV4 B;  3AZH B;  3AZJ C;  4H9S C;  1EQZ B;  5B1M D;  4NE5 A;  1F66 A;  3REI D;  3X1V D;  1P3K B;  1KU5 A;  3B0C W;  4X23 D;  4J8V A;  3W97 A;  5BS7 A;  3UTB B;  1S32 D;  1H3O A;  4J8U A;  5E5A D;  5B2I C;  4HGA B;  5B32 C;  5AV6 B;  3X1T B;  5B1L D;  3AZE A;  3AZF B;  3AV2 C;  4H9O B;  4ZUX B;  5CHL B;  5C3I C;  4Z66 C;  3LJA B;  4QLC B;  3X1V A;  3VH6 W;  4E44 A;  3NQU A;  3AZI D;  4WZS B;  4XZQ D;  1P3G B;  1P3L B;  2CV5 B;  3B6F A;  5CPK A;  5AV9 D;  5B31 C;  3WA9 B;  5DNN D;  3REJ B;  3O62 B;  4LD9 B;  1Q9C A;  5CPJ B;  1P3F A;  1KX3 D;  5E5A A;  2HIO B;  3KXB D;  5AV5 D;  3AZL D;  3LZ1 D;  1AOI A;  3WAA D;  3UTA A;  5AVC C;  2FJ7 B;  3AZI A;  5B24 D;  1P3B B;  3LZ0 C;  5AV9 A;  3LEL D;  1M18 D;  4KUD C;  5DNN A;  3X1U D;  3UT9 D;  5AVB B;  4YM6 D;  4CAY A;  3W99 B;  2F8N G;  3R45 A;  1KX3 A;  1BH9 A;  3REL B;  5B0Z D;  5GXQ D;  1ZLA A;  5AV5 A;  3WTP A;  3AZL A;  1P3P B;  1P3O D;  2PYO D;  2NZD C;  3KWQ D;  3WAA A;  3AN2 D;  4WNN B;  1P3I C;  3AV1 B;  4WU8 D;  4H9P A;  2NQB C;  3AZJ A;  5B24 A;  3AZN D;  3MGR C;  3AYW B;  3X1U A;  2LY8 A;  5B40 C;  4YM6 A;  5BT1 C;  3W98 B;  5JRG D;  1KX5 B;  3AZK C;  3W96 B;  3A6N C;  3MNN B;  2PYO A;  4J8X D;  1P3O A;  4KGC C;  3V9R A;  3B0D C;  3KWQ A;  5KDM B;  2HUE B;  3REK B;  3AZM C;  3MVD D;  3AFA C;  3C1B C;  3KUY B;  3NQJ A;  3TU4 B;  1N1J B;  4JJN B;  3AV2 A;  1HQ3 B;  3AZH C;  2BYM A;  1P3A B;  1EQZ C;  4G91 B;  1TAF B;  3C1C D;  3REH D;  5B33 C;  5AVC B;  5B31 A;  1BH8 A;  1P3K C;  5F99 B;  4KUD B;  3B0C T;  3X1S B;  3UTB C;  5CPI D;  1P3I D;  4HGA C;  5AV6 C;  2ARO B;  3C1C A;  3REH A;  3LZ0 A;  1M1A D;  4G92 B;  3AZF C;  4ZUX C;  1ULY A;  5AY8 D;  1P3G C;  3MGP B;  1P3L C;  2CV5 C;  3VH6 T;  3B6G B;  5B32 G;  5AV8 B;  3WA9 C;  4YS3 C;  3REJ C;  1KX4 B;  3O62 C;  4LD9 C;  2NZD A;  5CPJ C;  1P3I A;  2HIO C;  5BNV B;  1P3M C;  1TZY B;  5B31 G;  3AZM B;  3AZG B;  5B40 A;  5DNM B;  4Z5T B;  1EQZ D;  1P3B C;  4WU9 D;  3AZK A;  4ZBJ B;  3A6N A;  4J8U D;  2F8N D;  5AVB C;  5CP6 B;  3W99 C;  1P3K D;  3WTP E;  3REL C;  1JFI A;  5B33 B;  3AFA A;  3AZE D;  3MGS B;  3C1B A;  4CSR A;  2YFV B;  1P3P C;  1ID3 C;  1B67 A;  4DRB A;  3AV1 C;  3B6F D;  5CPK D;  1F66 B;  1EQZ A;  3X1T D;  4WU9 A;  5GT0 B;  3AYW C;  4J8W C;  1P3F D;  2F8N A;  4KHA B;  4ZUX D;  3LJA D;  1P3K A;  3W98 C;  4QLC D;  1P34 B;  1KX5 C;  1P3G D;  1AOI D;  1P3L D;  3W96 C;  1HTA A;  3UTA D;  5BO0 B;  3MNN C;  3UTB A;  3O62 D;  2HUE C;  3REK C;  1U35 D;  3VH6 A;  5B1M B;  3KUY C;  4NE6 A;  4YS3 B;  3REI B;  3TU4 C;  3X1T A;  1M19 C;  1F1E A;  3X1V B;  4JJN C;  1R4V A;  4X23 B;  5GT3 D;  4H9O A;  1HQ3 C;  4ZUX A;  3LJA A;  4QLC A;  1P3A C;  1ZLA D;  1P3M B;  2FJ7 D;  3WTP D;  1P3G A;  4G91 C;  1P3L A;  2CV5 A;  1S32 B;  3WA9 A;  3REJ A;  3O62 A;  3AZJ D;  5F99 C;  4LD9 A;  3B0B A;  5CPJ A;  1U35 A;  3REL D;  3X1S C;  5B1L B;  3MGQ C;  5GT3 A;  4H9N B;  4XZQ B;  4EO5 B;  3AV1 D;  5G49 B;  2FJ7 A;  2ARO C;  1ID3 B;  1P3B A;  4G92 C;  5AVB A;  1KX3 B;  5B2I D;  4H9S A;  5B32 D;  5BNX B;  5B0Y C;  3MGP C;  3W99 A;  4J8W B;  3B6G C;  3REL A;  3KXB B;  3AZL B;  3LZ1 B;  5AV8 C;  3AV2 D;  3W96 D;  1KX4 C;  4Z66 D;  1P3P A;  4WNN A;  3AV1 A;  5B31 D;  3LEL B;  1M18 B;  3UT9 B;  1TZY C;  5B2J C;  4YM6 B;  3AZG C;  5B2I A;  5DNM C;  4Z5T C;  5B32 A;  1WWI A;  3W98 A;  5B0Z B;  5GXQ B;  1M19 B;  2RVQ C;  3W96 A;  4ZBJ C;  1P3O B;  4Z66 A;  4H9Q B;  5AVC D;  3MNN A;  3AN2 B;  4WU8 B;  5CP6 C;  3REK A;  3LZ0 D;  3AZN B;  4KUD D;  4XUJ B;  3MGS C;  3KUY A;  3TU4 A;  1N1J A;  4UUZ B;  4JJN A;  3VH5 W;  5JRG B;  2BYK A;  1HQ3 A;  2L5A A;  2YFW B;  1F66 C;  1P3A A;  3MGQ B;  5GT0 C;  1TAF A;  2NZD D;  4J8X B;  4J8V C;  5AVC A;  4R8P B;  3MVD B;  2NQB D;  3W97 C;  1P34 C;  3MGP D;  5JA4 B;  4KUD A;  3MGR D;  1A7W A;  5B40 D;  5BT1 D;  5B0Y B;  3AZK D;  3A6N D;  5B1M C;  3C1C B;  3REI C;  2ARO A;  3WKJ B;  4KGC D;  4H9R B;  3X1V C; 
#chains in the Genus database with same CATH topology
 4X23 C;  3AZM D;  4DRA A;  3AFA D;  2NQB A;  3C1B D;  5DNM D;  2F2A C;  5B2J B;  3MGP A;  3MGR A;  3B6G A;  2RVQ D;  5GSU B;  1S32 C;  5AV8 A;  5CPI B;  2ZY4 A;  1KX4 A;  3AZH D;  5B33 D;  5B1L C;  5BNV A;  1M1A B;  2Y2Q A;  3MGS D;  4KGC A;  5FUG B;  1T3U A;  1TZY A;  5AY8 B;  3AZM A;  4XZQ C;  4EO5 C;  3AZG A;  5DNM A;  4Z5T A;  5AV9 C;  3UTB D;  5DNN C;  3AZH A;  1KX3 C;  3H0M C;  5AV6 D;  3KXB C;  5B33 A;  5AV5 C;  4J8V B;  3LZ1 C;  3AZL C;  3AZF D;  3MGS A;  3WAA C;  3W97 B;  2IO5 B;  4E45 A;  2CV5 D;  5B24 C;  1M18 C;  3LEL C;  4WU9 B;  1H3O B;  3WA9 D;  4YS3 D;  3X1U C;  4J8U B;  3REJ D;  3UT9 C;  2F8N B;  4LD9 D;  5GT0 A;  5CPJ D;  4YM6 C;  4KHA A;  2HIO D;  5AV6 A;  3AZE B;  5B0Z C;  1P34 A;  5GXQ C;  2Y2K A;  1P3M D;  2PYO C;  3AZF A;  1P3O C;  3KWQ C;  3NQU B;  5BO0 A;  3AN2 C;  4NFT A;  4WU8 C;  3B6F B;  5CPK B;  1P3B D;  3AZN C;  5B1M A;  4XUJ C;  2F8N H;  1P3F B;  2FFF B;  5AVB D;  4YS3 A;  3REI A;  5E5A B;  3W99 D;  3A1I A;  4X23 A;  5JRG C;  2HIO A;  1AOI B;  3VH5 T;  3P5J B;  3UTA B;  1P3M A;  1P3P D;  1ID3 D;  4J8X C;  3AZI B;  4R8P C;  1S32 A;  1U35 B;  3MVD C;  5AV9 B;  5DNN B;  3AYW D;  2JSS A;  4J8W D;  4CAY B;  5B1L A;  3R45 B;  4M6B A;  1BH9 B;  2VQR A;  5GT3 B;  3W98 D;  3EG5 B;  4UPK A;  1KX5 D;  1ZLA B;  3WTP B;  5AV5 B;  4H9N A;  4XZQ A;  3C1C C;  5G49 A;  3REH C;  4AWL C;  3WAA B;  3MNN D;  1ID3 A;  3WKJ C;  4H9P B;  2Y2P A;  1WWS A;  1PZR A;  3AZJ B;  5B24 B;  3REK D;  2F8N K;  3KUY D;  3X1U B;  5BNX A;  3EPL A;  3TU4 D;  3AYW A;  4J8W A;  1M19 D;  5GSU C;  3KXB A;  4JJN D;  3LZ1 A;  5CPI C;  1HQ3 D;  1P3A D;  1KX5 A;  2PYO B;  3V9R B;  3KWQ B;  1M18 A;  3LEL A;  1M1A C;  4XUJ D;  3UT9 A;  5KDM A;  5F99 D;  5AY8 C;  5B2I B;  5B32 B;  3NQJ B;  3X1S D;  5B0Z A;  3AV2 B;  5GXQ A;  1M19 A;  3MGQ D;  4Z66 B;  5C3I B;  2BYM B;  4H9Q A;  4R8P D;  3AN2 A;  4WU8 A;  2ARO D;  3VH5 A;  5B31 B;  1BH8 B;  3AZN A;  4XUJ A;  2IO5 C;  5F99 A;  2CWE A;  4Z2M H;  4UUZ A;  5B0Y D;  2BYK B;  5BS7 C;  3H0R C;  3B6G D;  3X1S A;  5JRG A;  3H0L C;  5AV8 D;  4WU9 C;  2YFW A;  1KX4 D;  4J8U C;  3MGQ A;  2RIQ A;  3WKJ D;  3F6T A;  4J8X A;  4R8P A;  3REH B;  4AWL B;  3LZ0 B;  3MVD A;  3AZE C;  1TZY D;  5B2J D;  5JA4 A;  5GSU D;  3AZG D;  3B6F C;  5CPK C;  4Z5T D;  5B0Y A;  2W8S A;  2DQN C;  3X1T C;  2NZD B;  1P3F C;  1P3I B;  5E5A C;  3WKJ A;  5CP6 D;  4H9R A;  3LJA C;  2NQB B;  4NE3 A;  4QLC C;  2ZY5 A;  1AOI C;  3EPK A;  3MGR B;  3UTA C;  5B2J A;  4Z2M G;  5B40 B;  5GSU A;  3AZI C;  5CPI A;  1U35 C;  3AZK B;  3A6N B;  1F66 D;  5GT0 D;  4WJ3 C;  4KGC B;  3B0D B;  4J8V D;  1M1A A;  5CP6 A;  5GT3 C;  1JFI B;  3W97 D;  5FUG A;  3AFA B;  1P34 D;  5AY8 A;  3C1B B;  1ZLA C;  4CSR B;  2FJ7 C;  3WTP C;  1B6W A;  2YFV A;  3KSY A;  1BFM A;  4WV4 B;  3AZH B;  3AZJ C;  4H9S C;  1EQZ B;  5B1M D;  4NE5 A;  1F66 A;  2Y2I A;  3REI D;  3X1V D;  1P3K B;  1KU5 A;  3B0C W;  4X23 D;  4J8V A;  3EPH A;  3KFU G;  3W97 A;  5BS7 A;  3UTB B;  1S32 D;  1H3O A;  4J8U A;  5E5A D;  5B2I C;  5B32 C;  5AV6 B;  4HGA B;  3X1T B;  5B1L D;  3AZE A;  3AZF B;  3AV2 C;  4H9O B;  4ZUX B;  5CHL B;  5C3I C;  4Z66 C;  3LJA B;  4QLC B;  3X1V A;  3VH6 W;  4E44 A;  3NQU A;  4DQY B;  4WZS B;  4XZQ D;  3AZI D;  1P3G B;  2CV5 B;  1P3L B;  2G5I C;  5CPK A;  5AV9 D;  3B6F A;  5B31 C;  3WA9 B;  5DNN D;  3REJ B;  3O62 B;  4LD9 B;  1Q9C A;  5CPJ B;  1P3F A;  1KX3 D;  5E5A A;  2HIO B;  3KXB D;  5AV5 D;  3AZL D;  3LZ1 D;  1AOI A;  3WAA D;  3UTA A;  5AVC C;  2FJ7 B;  3AZI A;  5B24 D;  1P3B B;  3LZ0 C;  5AV9 A;  3LEL D;  1M18 D;  4KUD C;  5DNN A;  3X1U D;  3UT9 D;  5AVB B;  4YM6 D;  4CAY A;  3W99 B;  2F8N G;  3R45 A;  1KX3 A;  1BH9 A;  3REL B;  5B0Z D;  5GXQ D;  1ZLA A;  5AV5 A;  3WTP A;  3AZL A;  1P3P B;  1P3O D;  2PYO D;  2NZD C;  3KWQ D;  3WAA A;  3AN2 D;  4WNN B;  1P3I C;  3AV1 B;  4WU8 D;  4H9P A;  2XD5 A;  2NQB C;  3AZJ A;  5B24 A;  3AZN D;  3MGR C;  3AYW B;  3X1U A;  2LY8 A;  5B40 C;  4YM6 A;  5BT1 C;  3W98 B;  5JRG D;  1KX5 B;  3FDD A;  3AZK C;  3W96 B;  3A6N C;  3MNN B;  2PYO A;  4J8X D;  1P3O A;  4KGC C;  3V9R A;  3B0D C;  3KWQ A;  5KDM B;  2HUE B;  3REK B;  3AZM C;  3MVD D;  3AFA C;  3C1B C;  3KUY B;  2UWX A;  3NQJ A;  3TU4 B;  1N1J B;  4JJN B;  3AV2 A;  1HQ3 B;  3AZH C;  2BYM A;  1P3A B;  1EQZ C;  2BG1 A;  4G91 B;  1TAF B;  2Y2G A;  3C1C D;  3REH D;  5B33 C;  5AVC B;  5B31 A;  1BH8 A;  2JE5 A;  1P3K C;  5F99 B;  4KUD B;  3B0C T;  3X1S B;  3UTB C;  2Y2M A;  3IP4 C;  5CPI D;  1P3I D;  2DF4 C;  4HGA C;  5AV6 C;  2ARO B;  3C1C A;  3REH A;  3LZ0 A;  1M1A D;  4G92 B;  3AZF C;  4ZUX C;  1ULY A;  5AY8 D;  2JCH A;  1P3G C;  3MGP B;  1P3L C;  2CV5 C;  3VH6 T;  3B6G B;  5B32 G;  5AV8 B;  3WA9 C;  4YS3 C;  3REJ C;  1KX4 B;  3O62 C;  4LD9 C;  2NZD A;  5CPJ C;  1P3I A;  2HIO C;  5BNV B;  1P3M C;  2Y2N A;  1TZY B;  2J8P A;  5B31 G;  3AZM B;  2XD1 A;  3AZG B;  5B40 A;  5DNM B;  4Z5T B;  1EQZ D;  1P3B C;  4WU9 D;  3AZK A;  4ZBJ B;  3A6N A;  4J8U D;  2F8N D;  5AVB C;  5CP6 B;  3W99 C;  1P3K D;  3WTP E;  3REL C;  1JFI A;  5B33 B;  3AFA A;  3AZE D;  3MGS B;  3C1B A;  4CSR A;  2YFV B;  1P3P C;  1ID3 C;  1B67 A;  2ZM5 A;  4DRB A;  3AV1 C;  3B6F D;  5CPK D;  1F66 B;  1EQZ A;  2ZY3 A;  3X1T D;  4WU9 A;  5GT0 B;  3AYW C;  4J8W C;  1P3F D;  2F8N A;  4KHA B;  2Y2J A;  4ZUX D;  2Y2L A;  3LJA D;  1P3K A;  4QLC D;  1P34 B;  3W98 C;  1KX5 C;  1P3G D;  1AOI D;  1P3L D;  3W96 C;  1HTA A;  3UTA D;  5BO0 B;  3MNN C;  3UTB A;  3A1K A;  3O62 D;  1Z2C B;  2HUE C;  2ZY2 A;  3REK C;  1U35 D;  3VH6 A;  5B1M B;  3KUY C;  4NE6 A;  4YS3 B;  3REI B;  3TU4 C;  3X1T A;  1M19 C;  1F1E A;  3X1V B;  4JJN C;  1R4V A;  4X23 B;  5GT3 D;  4H9O A;  1HQ3 C;  4ZUX A;  3LJA A;  4QLC A;  1P3A C;  1ZLA D;  1P3M B;  2FJ7 D;  3WTP D;  1P3G A;  4G91 C;  1P3L A;  2CV5 A;  1S32 B;  3WA9 A;  3REJ A;  3O62 A;  3AZJ D;  5F99 C;  4LD9 A;  3B0B A;  5CPJ A;  1U35 A;  3REL D;  3X1S C;  2Y2O A;  5B1L B;  2G5H C;  3MGQ C;  5GT3 A;  4H9N B;  4XZQ B;  4EO5 B;  3AV1 D;  5G49 B;  2FJ7 A;  2ARO C;  1ID3 B;  3AL0 C;  1P3B A;  4G92 C;  5AVB A;  1KX3 B;  5B2I D;  4H9S A;  5B32 D;  5BNX B;  5B0Y C;  3MGP C;  3W99 A;  3EPJ A;  4J8W B;  3B6G C;  3REL A;  3KXB B;  3AZL B;  3LZ1 B;  5AV8 C;  3AV2 D;  3W96 D;  1KX4 C;  4Z66 D;  1P3P A;  4WNN A;  3AV1 A;  5B31 D;  3LEL B;  1M18 B;  3UT9 B;  1TZY C;  5B2J C;  4YM6 B;  3AZG C;  5B2I A;  5DNM C;  4Z5T C;  5B32 A;  1WWI A;  3W98 A;  5B0Z B;  5GXQ B;  1M19 B;  2RVQ C;  3W96 A;  4ZBJ C;  1P3O B;  4Z66 A;  4H9Q B;  5AVC D;  3MNN A;  3AN2 B;  4WU8 B;  5CP6 C;  3REK A;  3LZ0 D;  3AZN B;  4KUD D;  4XUJ B;  3MGS C;  3KUY A;  3TU4 A;  1N1J A;  4UUZ B;  4JJN A;  3VH5 W;  5JRG B;  2BYK A;  1HQ3 A;  2L5A A;  2YFW B;  1F66 C;  1P3A A;  2Y2H A;  3MGQ B;  5GT0 C;  1TAF A;  2NZD D;  4J8X B;  1W2E A;  4J8V C;  5AVC A;  4R8P B;  3MVD B;  2NQB D;  3W97 C;  1P34 C;  3MGP D;  5JA4 B;  4KUD A;  3MGR D;  1A7W A;  5B40 D;  5BT1 D;  5B0Y B;  3AZK D;  3A6N D;  5B1M C;  3C1C B;  3REI C;  2ARO A;  3WKJ B;  4KGC D;  4H9R B;  3X1V C; 
#chains in the Genus database with same CATH homology
 4X23 C;  3AZM D;  4DRA A;  3AFA D;  2NQB A;  3C1B D;  5DNM D;  2F2A C;  5B2J B;  3MGP A;  3MGR A;  3B6G A;  2RVQ D;  5GSU B;  1S32 C;  5AV8 A;  5CPI B;  2ZY4 A;  1KX4 A;  3AZH D;  5B33 D;  5B1L C;  5BNV A;  1M1A B;  2Y2Q A;  3MGS D;  4KGC A;  5FUG B;  1T3U A;  1TZY A;  5AY8 B;  3AZM A;  4XZQ C;  4EO5 C;  3AZG A;  5DNM A;  4Z5T A;  5AV9 C;  3UTB D;  5DNN C;  3AZH A;  1KX3 C;  3H0M C;  5AV6 D;  3KXB C;  5B33 A;  5AV5 C;  4J8V B;  3LZ1 C;  3AZL C;  3AZF D;  3MGS A;  3WAA C;  3W97 B;  2IO5 B;  4E45 A;  2CV5 D;  5B24 C;  1M18 C;  3LEL C;  4WU9 B;  1H3O B;  3WA9 D;  4YS3 D;  3X1U C;  4J8U B;  3REJ D;  3UT9 C;  2F8N B;  4LD9 D;  5GT0 A;  5CPJ D;  4YM6 C;  4KHA A;  2HIO D;  5AV6 A;  3AZE B;  5B0Z C;  1P34 A;  5GXQ C;  2Y2K A;  1P3M D;  2PYO C;  3AZF A;  1P3O C;  3KWQ C;  3NQU B;  5BO0 A;  3AN2 C;  4NFT A;  4WU8 C;  3B6F B;  5CPK B;  1P3B D;  3AZN C;  5B1M A;  4XUJ C;  2F8N H;  1P3F B;  2FFF B;  5AVB D;  4YS3 A;  3REI A;  5E5A B;  3W99 D;  3A1I A;  4X23 A;  5JRG C;  2HIO A;  1AOI B;  3VH5 T;  3P5J B;  3UTA B;  1P3M A;  1P3P D;  1ID3 D;  4J8X C;  3AZI B;  4R8P C;  1S32 A;  1U35 B;  3MVD C;  5AV9 B;  5DNN B;  3AYW D;  2JSS A;  4J8W D;  4CAY B;  5B1L A;  3R45 B;  4M6B A;  1BH9 B;  2VQR A;  5GT3 B;  3W98 D;  3EG5 B;  4UPK A;  1KX5 D;  1ZLA B;  3WTP B;  5AV5 B;  4H9N A;  4XZQ A;  3C1C C;  5G49 A;  3REH C;  4AWL C;  3WAA B;  3MNN D;  1ID3 A;  3WKJ C;  4H9P B;  2Y2P A;  1WWS A;  1PZR A;  3AZJ B;  5B24 B;  3REK D;  2F8N K;  3KUY D;  3X1U B;  5BNX A;  3EPL A;  3TU4 D;  3AYW A;  4J8W A;  1M19 D;  5GSU C;  3KXB A;  4JJN D;  3LZ1 A;  5CPI C;  1HQ3 D;  1P3A D;  1KX5 A;  2PYO B;  3V9R B;  3KWQ B;  1M18 A;  3LEL A;  1M1A C;  4XUJ D;  3UT9 A;  5KDM A;  5F99 D;  5AY8 C;  5B2I B;  5B32 B;  3NQJ B;  3X1S D;  5B0Z A;  3AV2 B;  5GXQ A;  1M19 A;  3MGQ D;  4Z66 B;  5C3I B;  2BYM B;  4H9Q A;  4R8P D;  3AN2 A;  4WU8 A;  2ARO D;  3VH5 A;  5B31 B;  1BH8 B;  3AZN A;  4XUJ A;  2IO5 C;  5F99 A;  2CWE A;  4Z2M H;  4UUZ A;  5B0Y D;  2BYK B;  5BS7 C;  3H0R C;  3B6G D;  3X1S A;  5JRG A;  3H0L C;  5AV8 D;  4WU9 C;  2YFW A;  1KX4 D;  4J8U C;  3MGQ A;  2RIQ A;  3WKJ D;  3F6T A;  4J8X A;  4R8P A;  3REH B;  4AWL B;  3LZ0 B;  3MVD A;  3AZE C;  1TZY D;  5B2J D;  5JA4 A;  5GSU D;  3AZG D;  3B6F C;  5CPK C;  4Z5T D;  5B0Y A;  2W8S A;  2DQN C;  3X1T C;  2NZD B;  1P3F C;  1P3I B;  5E5A C;  3WKJ A;  5CP6 D;  4H9R A;  3LJA C;  2NQB B;  4NE3 A;  4QLC C;  2ZY5 A;  1AOI C;  3EPK A;  3MGR B;  3UTA C;  5B2J A;  4Z2M G;  5B40 B;  5GSU A;  3AZI C;  5CPI A;  1U35 C;  3AZK B;  3A6N B;  1F66 D;  5GT0 D;  4WJ3 C;  4KGC B;  3B0D B;  4J8V D;  1M1A A;  5CP6 A;  5GT3 C;  1JFI B;  3W97 D;  5FUG A;  3AFA B;  1P34 D;  5AY8 A;  3C1B B;  1ZLA C;  4CSR B;  2FJ7 C;  3WTP C;  1B6W A;  2YFV A;  3KSY A;  1BFM A;  4WV4 B;  3AZH B;  3AZJ C;  4H9S C;  1EQZ B;  5B1M D;  4NE5 A;  1F66 A;  2Y2I A;  3REI D;  3X1V D;  1P3K B;  1KU5 A;  3B0C W;  4X23 D;  4J8V A;  3EPH A;  3KFU G;  3W97 A;  5BS7 A;  3UTB B;  1S32 D;  1H3O A;  4J8U A;  5E5A D;  5B2I C;  5B32 C;  5AV6 B;  4HGA B;  3X1T B;  5B1L D;  3AZE A;  3AZF B;  3AV2 C;  4H9O B;  4ZUX B;  5CHL B;  5C3I C;  4Z66 C;  3LJA B;  4QLC B;  3X1V A;  3VH6 W;  4E44 A;  3NQU A;  4DQY B;  4WZS B;  4XZQ D;  3AZI D;  1P3G B;  2CV5 B;  1P3L B;  2G5I C;  5CPK A;  5AV9 D;  3B6F A;  5B31 C;  3WA9 B;  5DNN D;  3REJ B;  3O62 B;  4LD9 B;  1Q9C A;  5CPJ B;  1P3F A;  1KX3 D;  5E5A A;  2HIO B;  3KXB D;  5AV5 D;  3AZL D;  3LZ1 D;  1AOI A;  3WAA D;  3UTA A;  5AVC C;  2FJ7 B;  3AZI A;  5B24 D;  1P3B B;  3LZ0 C;  5AV9 A;  3LEL D;  1M18 D;  4KUD C;  5DNN A;  3X1U D;  3UT9 D;  5AVB B;  4YM6 D;  4CAY A;  3W99 B;  2F8N G;  3R45 A;  1KX3 A;  1BH9 A;  3REL B;  5B0Z D;  5GXQ D;  1ZLA A;  5AV5 A;  3WTP A;  3AZL A;  1P3P B;  1P3O D;  2PYO D;  2NZD C;  3KWQ D;  3WAA A;  3AN2 D;  4WNN B;  1P3I C;  3AV1 B;  4WU8 D;  4H9P A;  2XD5 A;  2NQB C;  3AZJ A;  5B24 A;  3AZN D;  3MGR C;  3AYW B;  3X1U A;  2LY8 A;  5B40 C;  4YM6 A;  5BT1 C;  3W98 B;  5JRG D;  1KX5 B;  3FDD A;  3AZK C;  3W96 B;  3A6N C;  3MNN B;  2PYO A;  4J8X D;  1P3O A;  4KGC C;  3V9R A;  3B0D C;  3KWQ A;  5KDM B;  2HUE B;  3REK B;  3AZM C;  3MVD D;  3AFA C;  3C1B C;  3KUY B;  2UWX A;  3NQJ A;  3TU4 B;  1N1J B;  4JJN B;  3AV2 A;  1HQ3 B;  3AZH C;  2BYM A;  1P3A B;  1EQZ C;  2BG1 A;  4G91 B;  1TAF B;  2Y2G A;  3C1C D;  3REH D;  5B33 C;  5AVC B;  5B31 A;  1BH8 A;  2JE5 A;  1P3K C;  5F99 B;  4KUD B;  3B0C T;  3X1S B;  3UTB C;  2Y2M A;  3IP4 C;  5CPI D;  1P3I D;  2DF4 C;  4HGA C;  5AV6 C;  2ARO B;  3C1C A;  3REH A;  3LZ0 A;  1M1A D;  4G92 B;  3AZF C;  4ZUX C;  1ULY A;  5AY8 D;  2JCH A;  1P3G C;  3MGP B;  1P3L C;  2CV5 C;  3VH6 T;  3B6G B;  5B32 G;  5AV8 B;  3WA9 C;  4YS3 C;  3REJ C;  1KX4 B;  3O62 C;  4LD9 C;  2NZD A;  5CPJ C;  1P3I A;  2HIO C;  5BNV B;  1P3M C;  2Y2N A;  1TZY B;  2J8P A;  5B31 G;  3AZM B;  2XD1 A;  3AZG B;  5B40 A;  5DNM B;  4Z5T B;  1EQZ D;  1P3B C;  4WU9 D;  3AZK A;  4ZBJ B;  3A6N A;  4J8U D;  2F8N D;  5AVB C;  5CP6 B;  3W99 C;  1P3K D;  3WTP E;  3REL C;  1JFI A;  5B33 B;  3AFA A;  3AZE D;  3MGS B;  3C1B A;  4CSR A;  2YFV B;  1P3P C;  1ID3 C;  1B67 A;  2ZM5 A;  4DRB A;  3AV1 C;  3B6F D;  5CPK D;  1F66 B;  1EQZ A;  2ZY3 A;  3X1T D;  4WU9 A;  5GT0 B;  3AYW C;  4J8W C;  1P3F D;  2F8N A;  4KHA B;  2Y2J A;  4ZUX D;  2Y2L A;  3LJA D;  1P3K A;  4QLC D;  1P34 B;  3W98 C;  1KX5 C;  1P3G D;  1AOI D;  1P3L D;  3W96 C;  1HTA A;  3UTA D;  5BO0 B;  3MNN C;  3UTB A;  3A1K A;  3O62 D;  1Z2C B;  2HUE C;  2ZY2 A;  3REK C;  1U35 D;  3VH6 A;  5B1M B;  3KUY C;  4NE6 A;  4YS3 B;  3REI B;  3TU4 C;  3X1T A;  1M19 C;  1F1E A;  3X1V B;  4JJN C;  1R4V A;  4X23 B;  5GT3 D;  4H9O A;  1HQ3 C;  4ZUX A;  3LJA A;  4QLC A;  1P3A C;  1ZLA D;  1P3M B;  2FJ7 D;  3WTP D;  1P3G A;  4G91 C;  1P3L A;  2CV5 A;  1S32 B;  3WA9 A;  3REJ A;  3O62 A;  3AZJ D;  5F99 C;  4LD9 A;  3B0B A;  5CPJ A;  1U35 A;  3REL D;  3X1S C;  2Y2O A;  5B1L B;  2G5H C;  3MGQ C;  5GT3 A;  4H9N B;  4XZQ B;  4EO5 B;  3AV1 D;  5G49 B;  2FJ7 A;  2ARO C;  1ID3 B;  3AL0 C;  1P3B A;  4G92 C;  5AVB A;  1KX3 B;  5B2I D;  4H9S A;  5B32 D;  5BNX B;  5B0Y C;  3MGP C;  3W99 A;  3EPJ A;  4J8W B;  3B6G C;  3REL A;  3KXB B;  3AZL B;  3LZ1 B;  5AV8 C;  3AV2 D;  3W96 D;  1KX4 C;  4Z66 D;  1P3P A;  4WNN A;  3AV1 A;  5B31 D;  3LEL B;  1M18 B;  3UT9 B;  1TZY C;  5B2J C;  4YM6 B;  3AZG C;  5B2I A;  5DNM C;  4Z5T C;  5B32 A;  1WWI A;  3W98 A;  5B0Z B;  5GXQ B;  1M19 B;  2RVQ C;  3W96 A;  4ZBJ C;  1P3O B;  4Z66 A;  4H9Q B;  5AVC D;  3MNN A;  3AN2 B;  4WU8 B;  5CP6 C;  3REK A;  3LZ0 D;  3AZN B;  4KUD D;  4XUJ B;  3MGS C;  3KUY A;  3TU4 A;  1N1J A;  4UUZ B;  4JJN A;  3VH5 W;  5JRG B;  2BYK A;  1HQ3 A;  2L5A A;  2YFW B;  1F66 C;  1P3A A;  2Y2H A;  3MGQ B;  5GT0 C;  1TAF A;  2NZD D;  4J8X B;  1W2E A;  4J8V C;  5AVC A;  4R8P B;  3MVD B;  2NQB D;  3W97 C;  1P34 C;  3MGP D;  5JA4 B;  4KUD A;  3MGR D;  1A7W A;  5B40 D;  5BT1 D;  5B0Y B;  3AZK D;  3A6N D;  5B1M C;  3C1C B;  3REI C;  2ARO A;  3WKJ B;  4KGC D;  4H9R B;  3X1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...