1ID3D

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2001-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3D00
2FJ7B 5AVBB 3X1SC 3AZKA 5G49B 1P3IB 3AZIA 3C1BB 3AZJD 4H9PA 1P3PA 3KWQD 1P3BC 3KUYA 3X1TA 5KDMB 3A6NC 4NE5A 3KSYA 5BO0A 4WNNB 3AZLB 5CPKC 4LD9D 1P3AB 5E5AA 1ZLAA 3REHD 1S32C 4Z66D 4J8XA 4XUJB 4WU8B 3LZ0A 5BNXA 1TZYC 4CSRB 4KUDB 5B1MC 5CP6B 2CWEA 5AV9B 1P3OD 4YM6D 5DNMA 1P3KC 1KX3C 5B24C 5AV6C 2F8NG 3MNND 4Z66B 3AYWB 3V9RA 3AZFD 1P3MA 4CAYA 3B6FD 3AV2A 3AZGA 3NQUA 5B2JB 4YM6B 4KGCA 4X23D 1Q9CA 3X1VD 2NQBD 3B6GC 5B0YA 4QLCB 5AY8A 4J8VA 1EQZC 3NQJB 5FUGA 3LELD 3REJC 3AZFB 4YS3A 5B32D 3AZMB 1P3GC 4H9NB 5B40D 5GT0A 1P3LC 3VH6W 3X1VB 5CPID 2NQBB 4WU9D 4Z5TB 3REHA 3AZED 2YFWA 3MGQC 3LELB 1KX4A 2PYOD 1R4VA 1M19C 3C1CD 3UT9D 5B32B 3WA9D 1JFIB 2AROC 5B40B 1P3PC 3LZ1D 5CPIB 4WU9B 5B31D 2RVQD 4H9QB 5DNND 3WTPD 3KUYC 2PYOB 3C1CB 3UT9B 1WWIA 5AV8C 3WA9B 1BH8A 3LZ1B 2HIOA 4AWLB 5GSUA 3AV1A 5B31B 3AN2C 1HQ3A 5B33D 3WTPB 3REKD 1ZLAC 3TU4D 4J8UA 3LZ0C 4ZBJC 5GT3A 3X1SA 4R8PB 3KXBC 5CPJB 3B0CT 3W99A 2YFVA 2F8NH 3AZJC 1ID3B 3AZGC 3KWQC 1F66B 5AVCB 3AZHB 5BS7A 3MVDD 3WAAD 2F8NK 5B2ID 5B0YC 3MGRD 1M1AD 2LY8A 2F8NB 1S32A 3W96B 1P34D 4YS3C 2BYMB 4EO5C 3LJAD 4LD9C 1P3FA 1N1JB 5B33A 3MGRB 5B1MA 3REHC 3RELA 3UTBA 3W98D 1M1AB 5B24A 1KX4C 1H3OA 3X1UD 3UTAD 1P3OC 2NZDD 3REIB 4H9OA 3W98B 5JA4B 3MNNC 1KX5D 1U35A 3B6GA 3AZFC 3X1UB 3B6FC 3UTAB 2NZDB 4ZUXD 3REJA 2FJ7D 5JRGD 4X23C 2HIOC 5GSUC 3AV1C 1P3ID 1P3GA 5B1LB 3AZNB 1KX5B 1P3LA 1HQ3C 3VH6A 1A7WA 3O62D 5GXQB 3MGPD 1BH9A 1WWSA 4ZUXB 5GT3C 5JRGB 2CV5A 1M19A 2AROA 4H9RA 4UUZB 3AZEC 5C3IC 5AV5D 3AZIB 3MGSD 3AZKB 4H9PB 3W99C 3AZLD 3O62B 2PYOC 3MGPB 1P3AD 3WA9C 3W97A 1M18B 1F1EA 4XUJD 4WU8D 5AV8A 5AV5B 5BS7C 3MGSB 4JJND 5DNNC 4KUDD 5BO0B 5CP6D 5AV9D 3AN2A 2FJ7A 3B0DC 5AVBA 3AYWD 5G49A 3C1BA 4J8XB 3R45A 1P3FC 5BNXB 4JJNB 5B33C 3KXBA 3REKC 3RELC 3UTBC 3TU4C 5B2JD 5DNMB 4QLCD 5KDMA 3AZJA 3V9RB 3KWQA 3AZMD 3AV2B 1U35C 4KGCB 4Z5TD 5AY8B 3WAAC 3MVDC 4J8WD 5B2IC 3AFAD 2HUEC 4LD9A 5GT0B 4HGAC 4Z66A 1P34C 2YFWB 4NE6A 3LJAC 4G91B 2CV5C 4J8WB 3AFAB 1P3OA 4YM6A 2IO5C 3MNNA 5B0ZD 1KU5A 3UTAC 4XZQD 3W97C 1BFMA 3AZFA 3B6FA 5F99D 4H9NA 4R8PD 4X23A 3X1VA 1BH8B 2NQBA 5CPJD 5B0ZB 1HTAA 4XZQB 3LELA 2FJ7C 5AVBC 4DRBA 1P3IC 4J8UB 5B32A 5F99B 4E45A 3C1BC 1JFIA 5B40A 1P3BD 1TAFB 5CPIA 1ID3D 3WKJD 3X1SB 2BYKA 4WU9A 1F66D 3AZEA 5AVCD 3A6ND 3AZHD 2PYOA 3C1CA 3UT9A 3WA9A 2YFVB 1P3BB 3MGSC 3LZ1A 2F8ND 3WKJB 3W96D 5B31A 3AZLC 3A6NB 1P3AC 5DNNA 1TZYD 3WTPA 4XUJC 4WU8C 1KX3D 1P3KD 5CPKB 4KHAA 4NFTA 5AV6D 5CHLB 4KUDC 1S32B 5CP6C 5AV9C 3REID 1TZYB 3REKA 3TU4A 5BNVB 3B0CW 4Z66C 3AYWC 4WV4B 1KX3B 1P3KB 5B24B 5AV6B 1EQZD 5B2JC 4YM6C 4QLCC 1AOID 5B1LD 3AZND 4H9SC 5GXQD 1EQZB 3MGQD 2BYMA 3AZMC 3X1VC 3MVDA 3REJB 1N1JA 3WAAA 2NQBC 5B2IA 3MGRA 1AOIB 4Z5TC 3AZKD 3AZID 1P3GB 1M1AA 1P3LB 3LELC 1P3PD 3VH5W 1P34A 5B32C 3MGQB 4DRAA 1M18D 5B40C 3LJAA 5CPIC 3X1TD 3KUYD 4WU9C 4WZSB 3W98A 1M19B 5JA4A 2AROB 4G92B 1P3PB 3X1UA 3C1CC 3UT9C 3UTAA 5B32G 2NZDA 5E5AD 3LZ1C 3KUYB 4AWLC 3X1TB 5B31C 2RVQC 4J8XD 1KX5A 3LZ0D 5AV8B 4M6BA 4XZQC 3WTPC 5GXQA 5DNMD 3AN2B 4ZUXA 5JRGA 5E5AB 4R8PC 1ZLAB 5CPJC 1P3IA 4UUZA 5B31G 3LZ0B 4ZBJB 1P3MD 3R45B 3KXBB 3O62A 3AZGD 3AV2D 3MGPA 1M18A 4KGCD 5B0YD 4J8VD 5AY8D 1ID3C 3WKJC 1F66C 5AVCC 5AV5A 3AZHC 3MGSA 4Z2MG 3AZJB 1P3MB 4CAYB 2L5AA 4WNNA 4YS3D 3AZLA 5BT1D 3KWQB 3AZGB 1P3AA 3NQUB 5GT0D 3W96C 5B0YB 4J8VB 4XUJA 4WU8A 5FUGB 3VH6T 4JJNA 1KX4D 4CSRA 4KUDA 3MGRC 4YS3B 5CP6A 5AV9A 4EO5B 1M1AC 4LD9B 4E44A 3AYWA 3REHB 3REIC 1KX4B 3W98C 5B2JA 1P3OB 4QLCA 2HIOD 5GSUD 3X1UC 3AV1D 3NQJA 3MNNB 4H9SA 2NZDC 1HQ3D 4J8UD 1AOIC 3AZMA 5B1LC 3AZNC 1KX5C 3B6FB 5GT3D 3X1SD 4X23B 2JSSA 2HIOB 4Z5TA 5GSUB 3AV1B 5GXQC 1HQ3B 4ZUXC 5JRGC 3VH5A 3W99D 4J8WA 3AZKC 3AFAA 3AZIC 4G92C 5GT3B 3O62C 4H9QA 2BYKB 3MGPC 3AZEB 5C3IB 1M18C 4NE3A 3W99B 3X1TC 5CPKD 5AV5C 4Z2MH 1S32D 5B0ZA 4XZQA 1P3FD 5DNNB 5E5AC 5B1MD 3RELD 3UTBD 5F99A 4J8XC 1TAFA 5B24D 4R8PA 4JJNC 3B0DB 4KHAB 5CPJA 5DNMC 1P3FB 5B33B 3REKB 5B1MB 3RELB 3UTBB 3TU4B 1U35D 1P3BA 3B6GD 1P3MC 3WKJA 1ID3A 1H3OB 1F66A 3AV2C 1B6WA 5AVCA 3A6NA 3AZHA 3REJD 4KGCC 4H9OB 4J8VC 5AY8C 1P3GD 1P3LD 1U35B 5CPKA 3B6GB 2F8NA 3W96A 5BT1C 5GT0C 1TZYA 3MVDB 3WAAB 2CV5D 5BNVA 1M19D 5B2IB 3VH5T 2AROD 2HUEB 1KX3A 1P3KA 3B0BA 1ULYA 4G91C 5AV6A 4J8WC 4HGAB 1P34B 3AFAC 1BH9B 3REIA 3W97D 3LJAB 1B67A 3WTPE 2CV5B 5AV8D 4H9RB 2IO5B 1EQZA 3AN2D 3W97B 1ZLAD 5AVBD 1AOIA 5B1LA 3AZNA 5B0ZC 3C1BD 3KXBD 4J8UC 5F99C 3MGQA
chains in the Genus database with same CATH superfamily
2FJ7B 5AVBB 3X1SC 3AZKA 5G49B 1P3IB 3AZIA 3C1BB 3AZJD 4H9PA 1P3PA 2G5IC 3KWQD 1P3BC 3KUYA 3X1TA 5KDMB 3A6NC 4NE5A 3KSYA 5BO0A 4WNNB 3AZLB 5CPKC 4LD9D 1P3AB 5E5AA 1ZLAA 3REHD 1S32C 4Z66D 4J8XA 4XUJB 4WU8B 3LZ0A 5BNXA 1TZYC 4CSRB 4KUDB 5B1MC 5CP6B 2CWEA 5AV9B 1P3OD 4YM6D 5DNMA 1P3KC 1KX3C 5B24C 5AV6C 2F8NG 3MNND 4Z66B 3AYWB 3A1IA 3V9RA 2XD1A 3AZFD 1P3MA 4CAYA 3B6FD 3AV2A 3AZGA 3NQUA 2G5HC 5B2JB 4YM6B 4X23D 1Q9CA 3X1VD 2NQBD 3B6GC 4KGCA 5B0YA 4QLCB 5AY8A 4J8VA 1EQZC 3NQJB 5FUGA 3LELD 3REJC 3AZFB 4YS3A 5B32D 3F6TA 3AZMB 1P3GC 4H9NB 5B40D 5GT0A 1P3LC 3VH6W 2Y2HA 3X1VB 5CPID 2NQBB 4WU9D 4Z5TB 3REHA 3AZED 2YFWA 3MGQC 3LELB 1KX4A 2PYOD 1R4VA 1M19C 3C1CD 3UT9D 5B32B 3WA9D 1JFIB 2AROC 5B40B 1P3PC 3LZ1D 1PZRA 5CPIB 1T3UA 4WU9B 5B31D 2RVQD 4H9QB 5DNND 3WTPD 3KUYC 2PYOB 3C1CB 3UT9B 1WWIA 5AV8C 3WA9B 2Y2KA 1BH8A 3LZ1B 2HIOA 4AWLB 5GSUA 3AV1A 5B31B 3AN2C 1HQ3A 5B33D 3WTPB 3REKD 1ZLAC 3TU4D 4J8UA 2ZY4A 3LZ0C 4ZBJC 5GT3A 3X1SA 4R8PB 3KXBC 5CPJB 3B0CT 3W99A 2YFVA 2F8NH 3AZJC 1ID3B 3AZGC 2VQRA 3KWQC 1F66B 5AVCB 3EPJA 3AZHB 2Y2OA 5BS7A 3MVDD 3WAAD 2F8NK 5B2ID 5B0YC 3MGRD 1M1AD 2LY8A 2F8NB 1S32A 3W96B 1P34D 4YS3C 2BYMB 4EO5C 3LJAD 2Y2NA 1P3FA 4LD9C 1N1JB 5B33A 3MGRB 5B1MA 3REHC 3RELA 3UTBA 3W98D 1M1AB 5B24A 1KX4C 1H3OA 3X1UD 3UTAD 1P3OC 2NZDD 3REIB 4H9OA 3W98B 5JA4B 3MNNC 1KX5D 3P5JB 1U35A 3B6GA 2DF4C 3AZFC 2ZM5A 2Y2MA 3X1UB 3B6FC 3UTAB 2ZY2A 2NZDB 4ZUXD 3REJA 2FJ7D 5JRGD 4X23C 2HIOC 5GSUC 3AV1C 1P3ID 1P3GA 5B1LB 3AZNB 1KX5B 1P3LA 1HQ3C 3VH6A 1A7WA 3O62D 5GXQB 3MGPD 1BH9A 1WWSA 4ZUXB 5GT3C 5JRGB 2CV5A 1M19A 2AROA 4H9RA 4UUZB 3AZEC 5C3IC 5AV5D 3AZIB 2JCHA 3MGSD 3H0RC 4H9PB 3W99C 3EG5B 3O62B 3AZLD 2PYOC 3MGPB 1P3AD 3WA9C 3W97A 1M18B 1F1EA 4XUJD 4WU8D 5AV8A 5AV5B 5BS7C 3MGSB 4JJND 5DNNC 4KUDD 5BO0B 5CP6D 5AV9D 3AN2A 2FJ7A 3B0DC 5AVBA 3AYWD 5G49A 3C1BA 4J8XB 3R45A 1P3FC 5BNXB 4JJNB 5B33C 3KXBA 3REKC 3RELC 3UTBC 3TU4C 5B2JD 5DNMB 4QLCD 3H0LC 5KDMA 3AZJA 3V9RB 3KWQA 3AZMD 3AV2B 1U35C 4KGCB 4Z5TD 5AY8B 3WAAC 3MVDC 4J8WD 5B2IC 3AL0C 3AFAD 2HUEC 4LD9A 5GT0B 4HGAC 4Z66A 1P34C 2YFWB 4NE6A 3LJAC 4G91B 2CV5C 4J8WB 3AFAB 1P3OA 4YM6A 2IO5C 3MNNA 5B0ZD 1KU5A 3UTAC 4XZQD 3W97C 1BFMA 3AZFA 2Y2QA 3B6FA 5F99D 4H9NA 4R8PD 4X23A 3X1VA 1BH8B 2NQBA 5CPJD 5B0ZB 1HTAA 4XZQB 3A1KA 3LELA 2FJ7C 5AVBC 4DRBA 2ZY5A 4J8UB 1P3IC 5B32A 5F99B 4E45A 3C1BC 1JFIA 5B40A 1P3BD 1TAFB 5CPIA 1ID3D 3WKJD 3X1SB 2BYKA 4WU9A 1F66D 3FDDA 3AZEA 5AVCD 3A6ND 3AZHD 2PYOA 3C1CA 3UT9A 2W8SA 2YFVB 3WA9A 1P3BB 3MGSC 3LZ1A 2F8ND 3WKJB 3W96D 5B31A 3AZLC 3A6NB 1P3AC 5DNNA 1TZYD 3WTPA 4XUJC 4WU8C 1KX3D 1P3KD 5CPKB 4KHAA 4NFTA 5AV6D 5CHLB 4KUDC 1S32B 5CP6C 5AV9C 3REID 1TZYB 3REKA 3TU4A 5BNVB 3B0CW 2UWXA 4Z66C 3AYWC 4WV4B 1KX3B 1P3KB 5B24B 5AV6B 1EQZD 5B2JC 4YM6C 2Y2GA 4QLCC 1AOID 5B1LD 3AZND 4H9SC 5GXQD 1EQZB 3MGQD 2BYMA 3AZMC 3X1VC 3MVDA 3REJB 1N1JA 3WAAA 2NQBC 5B2IA 3MGRA 1AOIB 4Z5TC 3AZKD 3AZID 1P3GB 1M1AA 1P3LB 3LELC 1P3PD 3VH5W 2F2AC 2FFFB 1P34A 5B32C 2Y2IA 4DRAA 3MGQB 5B40C 1M18D 3LJAA 5CPIC 3X1TD 3KUYD 4WU9C 4WZSB 3W98A 1M19B 5JA4A 2DQNC 2AROB 4G92B 1P3PB 3X1UA 3C1CC 3UT9C 3UTAA 5B32G 2NZDA 5E5AD 3LZ1C 3KUYB 4AWLC 3X1TB 5B31C 2RVQC 4J8XD 1KX5A 3LZ0D 5AV8B 4M6BA 4XZQC 3WTPC 5GXQA 2JE5A 5DNMD 3AN2B 4ZUXA 5JRGA 5E5AB 4R8PC 2ZY3A 4DQYB 1ZLAB 5CPJC 1P3IA 4UUZA 5B31G 3LZ0B 4ZBJB 1P3MD 3R45B 3KXBB 3O62A 3AZGD 3AV2D 3MGPA 1M18A 4KGCD 5B0YD 4J8VD 5AY8D 1ID3C 3WKJC 1F66C 5AVCC 5AV5A 3AZHC 3MGSA 4Z2MG 3AZJB 1P3MB 4CAYB 2L5AA 4WNNA 2J8PA 4YS3D 3AZLA 5BT1D 3KWQB 3AZGB 1P3AA 3NQUB 5GT0D 3W96C 5B0YB 4J8VB 4XUJA 4WU8A 5FUGB 3VH6T 4JJNA 1KX4D 4CSRA 4KUDA 3MGRC 4YS3B 5CP6A 5AV9A 2XD5A 4EO5B 1M1AC 4LD9B 4E44A 3H0MC 3AYWA 3REHB 3REIC 1KX4B 3W98C 5B2JA 1P3OB 2BG1A 4QLCA 2HIOD 5GSUD 3X1UC 3AV1D 3NQJA 3MNNB 4H9SA 2NZDC 1HQ3D 4J8UD 1AOIC 3AZMA 5B1LC 3AZNC 1KX5C 3B6FB 5GT3D 3X1SD 4X23B 2JSSA 2HIOB 4Z5TA 5GSUB 3AV1B 5GXQC 1HQ3B 4ZUXC 5JRGC 3VH5A 3W99D 4J8WA 3AZKC 3AFAA 3AZKB 3AZIC 4G92C 5GT3B 3O62C 4H9QA 2BYKB 3MGPC 1Z2CB 3AZEB 5C3IB 1M18C 4NE3A 3W99B 3X1TC 3IP4C 5CPKD 5AV5C 4Z2MH 1S32D 3EPHA 5B0ZA 4XZQA 1P3FD 2RIQA 5DNNB 5E5AC 5B1MD 3RELD 3UTBD 5F99A 4J8XC 1TAFA 5B24D 4R8PA 4JJNC 3B0DB 4KHAB 5CPJA 3EPKA 5DNMC 1P3FB 5B33B 3REKB 5B1MB 3RELB 3UTBB 3TU4B 1U35D 1P3BA 3B6GD 2Y2PA 4UPKA 1P3MC 3WKJA 1ID3A 1H3OB 1F66A 3AV2C 1B6WA 5AVCA 3A6NA 3AZHA 3REJD 4KGCC 4H9OB 4J8VC 5AY8C 1P3GD 1P3LD 2Y2LA 1U35B 5CPKA 3B6GB 2F8NA 3W96A 5BT1C 5GT0C 1TZYA 3MVDB 3WAAB 2CV5D 5BNVA 1M19D 5B2IB 3VH5T 2AROD 2HUEB 1KX3A 1P3KA 3B0BA 1ULYA 4G91C 5AV6A 4J8WC 4HGAB 1W2EA 1P34B 3AFAC 1BH9B 3REIA 3W97D 3LJAB 1B67A 3WTPE 2CV5B 3KFUG 5AV8D 4H9RB 2Y2JA 2IO5B 1EQZA 3AN2D 4WJ3C 3W97B 1ZLAD 5AVBD 3EPLA 1AOIA 5B1LA 3AZNA 5B0ZC 3C1BD 3KXBD 4J8UC 5F99C 3MGQA
chains in the Genus database with same CATH topology
2FJ7B 5AVBB 3X1SC 3AZKA 5G49B 1P3IB 3AZIA 3C1BB 3AZJD 4H9PA 1P3PA 2G5IC 3KWQD 1P3BC 3KUYA 3X1TA 5KDMB 3A6NC 4NE5A 3KSYA 5BO0A 4WNNB 3AZLB 5CPKC 4LD9D 1P3AB 5E5AA 1ZLAA 3REHD 1S32C 4Z66D 4J8XA 4XUJB 4WU8B 3LZ0A 5BNXA 1TZYC 4CSRB 4KUDB 5B1MC 5CP6B 2CWEA 5AV9B 1P3OD 4YM6D 5DNMA 1P3KC 1KX3C 5B24C 5AV6C 2F8NG 3MNND 4Z66B 3AYWB 3A1IA 3V9RA 2XD1A 3AZFD 1P3MA 4CAYA 3B6FD 3AV2A 3AZGA 3NQUA 2G5HC 5B2JB 4YM6B 4X23D 1Q9CA 3X1VD 2NQBD 3B6GC 4KGCA 5B0YA 4QLCB 5AY8A 4J8VA 1EQZC 3NQJB 5FUGA 3LELD 3REJC 3AZFB 4YS3A 5B32D 3F6TA 3AZMB 1P3GC 4H9NB 5B40D 5GT0A 1P3LC 3VH6W 2Y2HA 3X1VB 5CPID 2NQBB 4WU9D 4Z5TB 3REHA 3AZED 2YFWA 3MGQC 3LELB 1KX4A 2PYOD 1R4VA 1M19C 3C1CD 3UT9D 5B32B 3WA9D 1JFIB 2AROC 5B40B 1P3PC 3LZ1D 1PZRA 5CPIB 1T3UA 4WU9B 5B31D 2RVQD 4H9QB 5DNND 3WTPD 3KUYC 2PYOB 3C1CB 3UT9B 1WWIA 5AV8C 3WA9B 2Y2KA 1BH8A 3LZ1B 2HIOA 4AWLB 5GSUA 3AV1A 5B31B 3AN2C 1HQ3A 5B33D 3WTPB 3REKD 1ZLAC 3TU4D 4J8UA 2ZY4A 3LZ0C 4ZBJC 5GT3A 3X1SA 4R8PB 3KXBC 5CPJB 3B0CT 3W99A 2YFVA 2F8NH 3AZJC 1ID3B 3AZGC 2VQRA 3KWQC 1F66B 5AVCB 3EPJA 3AZHB 2Y2OA 5BS7A 3MVDD 3WAAD 2F8NK 5B2ID 5B0YC 3MGRD 1M1AD 2LY8A 2F8NB 1S32A 3W96B 1P34D 4YS3C 2BYMB 4EO5C 3LJAD 2Y2NA 1P3FA 4LD9C 1N1JB 5B33A 3MGRB 5B1MA 3REHC 3RELA 3UTBA 3W98D 1M1AB 5B24A 1KX4C 1H3OA 3X1UD 3UTAD 1P3OC 2NZDD 3REIB 4H9OA 3W98B 5JA4B 3MNNC 1KX5D 3P5JB 1U35A 3B6GA 2DF4C 3AZFC 2ZM5A 2Y2MA 3X1UB 3B6FC 3UTAB 2ZY2A 2NZDB 4ZUXD 3REJA 2FJ7D 5JRGD 4X23C 2HIOC 5GSUC 3AV1C 1P3ID 1P3GA 5B1LB 3AZNB 1KX5B 1P3LA 1HQ3C 3VH6A 1A7WA 3O62D 5GXQB 3MGPD 1BH9A 1WWSA 4ZUXB 5GT3C 5JRGB 2CV5A 1M19A 2AROA 4H9RA 4UUZB 3AZEC 5C3IC 5AV5D 3AZIB 2JCHA 3MGSD 3H0RC 4H9PB 3W99C 3EG5B 3O62B 3AZLD 2PYOC 3MGPB 1P3AD 3WA9C 3W97A 1M18B 1F1EA 4XUJD 4WU8D 5AV8A 5AV5B 5BS7C 3MGSB 4JJND 5DNNC 4KUDD 5BO0B 5CP6D 5AV9D 3AN2A 2FJ7A 3B0DC 5AVBA 3AYWD 5G49A 3C1BA 4J8XB 3R45A 1P3FC 5BNXB 4JJNB 5B33C 3KXBA 3REKC 3RELC 3UTBC 3TU4C 5B2JD 5DNMB 4QLCD 3H0LC 5KDMA 3AZJA 3V9RB 3KWQA 3AZMD 3AV2B 1U35C 4KGCB 4Z5TD 5AY8B 3WAAC 3MVDC 4J8WD 5B2IC 3AL0C 3AFAD 2HUEC 4LD9A 5GT0B 4HGAC 4Z66A 1P34C 2YFWB 4NE6A 3LJAC 4G91B 2CV5C 4J8WB 3AFAB 1P3OA 4YM6A 2IO5C 3MNNA 5B0ZD 1KU5A 3UTAC 4XZQD 3W97C 1BFMA 3AZFA 2Y2QA 3B6FA 5F99D 4H9NA 4R8PD 4X23A 3X1VA 1BH8B 2NQBA 5CPJD 5B0ZB 1HTAA 4XZQB 3A1KA 3LELA 2FJ7C 5AVBC 4DRBA 2ZY5A 4J8UB 1P3IC 5B32A 5F99B 4E45A 3C1BC 1JFIA 5B40A 1P3BD 1TAFB 5CPIA 1ID3D 3WKJD 3X1SB 2BYKA 4WU9A 1F66D 3FDDA 3AZEA 5AVCD 3A6ND 3AZHD 2PYOA 3C1CA 3UT9A 2W8SA 2YFVB 3WA9A 1P3BB 3MGSC 3LZ1A 2F8ND 3WKJB 3W96D 5B31A 3AZLC 3A6NB 1P3AC 5DNNA 1TZYD 3WTPA 4XUJC 4WU8C 1KX3D 1P3KD 5CPKB 4KHAA 4NFTA 5AV6D 5CHLB 4KUDC 1S32B 5CP6C 5AV9C 3REID 1TZYB 3REKA 3TU4A 5BNVB 3B0CW 2UWXA 4Z66C 3AYWC 4WV4B 1KX3B 1P3KB 5B24B 5AV6B 1EQZD 5B2JC 4YM6C 2Y2GA 4QLCC 1AOID 5B1LD 3AZND 4H9SC 5GXQD 1EQZB 3MGQD 2BYMA 3AZMC 3X1VC 3MVDA 3REJB 1N1JA 3WAAA 2NQBC 5B2IA 3MGRA 1AOIB 4Z5TC 3AZKD 3AZID 1P3GB 1M1AA 1P3LB 3LELC 1P3PD 3VH5W 2F2AC 2FFFB 1P34A 5B32C 2Y2IA 4DRAA 3MGQB 5B40C 1M18D 3LJAA 5CPIC 3X1TD 3KUYD 4WU9C 4WZSB 3W98A 1M19B 5JA4A 2DQNC 2AROB 4G92B 1P3PB 3X1UA 3C1CC 3UT9C 3UTAA 5B32G 2NZDA 5E5AD 3LZ1C 3KUYB 4AWLC 3X1TB 5B31C 2RVQC 4J8XD 1KX5A 3LZ0D 5AV8B 4M6BA 4XZQC 3WTPC 5GXQA 2JE5A 5DNMD 3AN2B 4ZUXA 5JRGA 5E5AB 4R8PC 2ZY3A 4DQYB 1ZLAB 5CPJC 1P3IA 4UUZA 5B31G 3LZ0B 4ZBJB 1P3MD 3R45B 3KXBB 3O62A 3AZGD 3AV2D 3MGPA 1M18A 4KGCD 5B0YD 4J8VD 5AY8D 1ID3C 3WKJC 1F66C 5AVCC 5AV5A 3AZHC 3MGSA 4Z2MG 3AZJB 1P3MB 4CAYB 2L5AA 4WNNA 2J8PA 4YS3D 3AZLA 5BT1D 3KWQB 3AZGB 1P3AA 3NQUB 5GT0D 3W96C 5B0YB 4J8VB 4XUJA 4WU8A 5FUGB 3VH6T 4JJNA 1KX4D 4CSRA 4KUDA 3MGRC 4YS3B 5CP6A 5AV9A 2XD5A 4EO5B 1M1AC 4LD9B 4E44A 3H0MC 3AYWA 3REHB 3REIC 1KX4B 3W98C 5B2JA 1P3OB 2BG1A 4QLCA 2HIOD 5GSUD 3X1UC 3AV1D 3NQJA 3MNNB 4H9SA 2NZDC 1HQ3D 4J8UD 1AOIC 3AZMA 5B1LC 3AZNC 1KX5C 3B6FB 5GT3D 3X1SD 4X23B 2JSSA 2HIOB 4Z5TA 5GSUB 3AV1B 5GXQC 1HQ3B 4ZUXC 5JRGC 3VH5A 3W99D 4J8WA 3AZKC 3AFAA 3AZKB 3AZIC 4G92C 5GT3B 3O62C 4H9QA 2BYKB 3MGPC 1Z2CB 3AZEB 5C3IB 1M18C 4NE3A 3W99B 3X1TC 3IP4C 5CPKD 5AV5C 4Z2MH 1S32D 3EPHA 5B0ZA 4XZQA 1P3FD 2RIQA 5DNNB 5E5AC 5B1MD 3RELD 3UTBD 5F99A 4J8XC 1TAFA 5B24D 4R8PA 4JJNC 3B0DB 4KHAB 5CPJA 3EPKA 5DNMC 1P3FB 5B33B 3REKB 5B1MB 3RELB 3UTBB 3TU4B 1U35D 1P3BA 3B6GD 2Y2PA 4UPKA 1P3MC 3WKJA 1ID3A 1H3OB 1F66A 3AV2C 1B6WA 5AVCA 3A6NA 3AZHA 3REJD 4KGCC 4H9OB 4J8VC 5AY8C 1P3GD 1P3LD 2Y2LA 1U35B 5CPKA 3B6GB 2F8NA 3W96A 5BT1C 5GT0C 1TZYA 3MVDB 3WAAB 2CV5D 5BNVA 1M19D 5B2IB 3VH5T 2AROD 2HUEB 1KX3A 1P3KA 3B0BA 1ULYA 4G91C 5AV6A 4J8WC 4HGAB 1W2EA 1P34B 3AFAC 1BH9B 3REIA 3W97D 3LJAB 1B67A 3WTPE 2CV5B 3KFUG 5AV8D 4H9RB 2Y2JA 2IO5B 1EQZA 3AN2D 4WJ3C 3W97B 1ZLAD 5AVBD 3EPLA 1AOIA 5B1LA 3AZNA 5B0ZC 3C1BD 3KXBD 4J8UC 5F99C 3MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 B;  5AVB B;  3X1S C;  3AZK A;  5G49 B;  1P3I B;  3AZI A;  3C1B B;  3AZJ D;  4H9P A;  1P3P A;  3KWQ D;  1P3B C;  3KUY A;  3X1T A;  5KDM B;  3A6N C;  4NE5 A;  3KSY A;  5BO0 A;  4WNN B;  3AZL B;  5CPK C;  4LD9 D;  1P3A B;  5E5A A;  1ZLA A;  3REH D;  1S32 C;  4Z66 D;  4J8X A;  4XUJ B;  4WU8 B;  3LZ0 A;  5BNX A;  1TZY C;  4CSR B;  4KUD B;  5B1M C;  5CP6 B;  2CWE A;  5AV9 B;  1P3O D;  4YM6 D;  5DNM A;  1P3K C;  1KX3 C;  5B24 C;  5AV6 C;  2F8N G;  3MNN D;  4Z66 B;  3AYW B;  3V9R A;  3AZF D;  1P3M A;  4CAY A;  3B6F D;  3AV2 A;  3AZG A;  3NQU A;  5B2J B;  4YM6 B;  4KGC A;  4X23 D;  1Q9C A;  3X1V D;  2NQB D;  3B6G C;  5B0Y A;  4QLC B;  5AY8 A;  4J8V A;  1EQZ C;  3NQJ B;  5FUG A;  3LEL D;  3REJ C;  3AZF B;  4YS3 A;  5B32 D;  3AZM B;  1P3G C;  4H9N B;  5B40 D;  5GT0 A;  1P3L C;  3VH6 W;  3X1V B;  5CPI D;  2NQB B;  4WU9 D;  4Z5T B;  3REH A;  3AZE D;  2YFW A;  3MGQ C;  3LEL B;  1KX4 A;  2PYO D;  1R4V A;  1M19 C;  3C1C D;  3UT9 D;  5B32 B;  3WA9 D;  1JFI B;  2ARO C;  5B40 B;  1P3P C;  3LZ1 D;  5CPI B;  4WU9 B;  5B31 D;  2RVQ D;  4H9Q B;  5DNN D;  3WTP D;  3KUY C;  2PYO B;  3C1C B;  3UT9 B;  1WWI A;  5AV8 C;  3WA9 B;  1BH8 A;  3LZ1 B;  2HIO A;  4AWL B;  5GSU A;  3AV1 A;  5B31 B;  3AN2 C;  1HQ3 A;  5B33 D;  3WTP B;  3REK D;  1ZLA C;  3TU4 D;  4J8U A;  3LZ0 C;  4ZBJ C;  5GT3 A;  3X1S A;  4R8P B;  3KXB C;  5CPJ B;  3B0C T;  3W99 A;  2YFV A;  2F8N H;  3AZJ C;  1ID3 B;  3AZG C;  3KWQ C;  1F66 B;  5AVC B;  3AZH B;  5BS7 A;  3MVD D;  3WAA D;  2F8N K;  5B2I D;  5B0Y C;  3MGR D;  1M1A D;  2LY8 A;  2F8N B;  1S32 A;  3W96 B;  1P34 D;  4YS3 C;  2BYM B;  4EO5 C;  3LJA D;  4LD9 C;  1P3F A;  1N1J B;  5B33 A;  3MGR B;  5B1M A;  3REH C;  3REL A;  3UTB A;  3W98 D;  1M1A B;  5B24 A;  1KX4 C;  1H3O A;  3X1U D;  3UTA D;  1P3O C;  2NZD D;  3REI B;  4H9O A;  3W98 B;  5JA4 B;  3MNN C;  1KX5 D;  1U35 A;  3B6G A;  3AZF C;  3X1U B;  3B6F C;  3UTA B;  2NZD B;  4ZUX D;  3REJ A;  2FJ7 D;  5JRG D;  4X23 C;  2HIO C;  5GSU C;  3AV1 C;  1P3I D;  1P3G A;  5B1L B;  3AZN B;  1KX5 B;  1P3L A;  1HQ3 C;  3VH6 A;  1A7W A;  3O62 D;  5GXQ B;  3MGP D;  1BH9 A;  1WWS A;  4ZUX B;  5GT3 C;  5JRG B;  2CV5 A;  1M19 A;  2ARO A;  4H9R A;  4UUZ B;  3AZE C;  5C3I C;  5AV5 D;  3AZI B;  3MGS D;  3AZK B;  4H9P B;  3W99 C;  3AZL D;  3O62 B;  2PYO C;  3MGP B;  1P3A D;  3WA9 C;  3W97 A;  1M18 B;  1F1E A;  4XUJ D;  4WU8 D;  5AV8 A;  5AV5 B;  5BS7 C;  3MGS B;  4JJN D;  5DNN C;  4KUD D;  5BO0 B;  5CP6 D;  5AV9 D;  3AN2 A;  2FJ7 A;  3B0D C;  5AVB A;  3AYW D;  5G49 A;  3C1B A;  4J8X B;  3R45 A;  1P3F C;  5BNX B;  4JJN B;  5B33 C;  3KXB A;  3REK C;  3REL C;  3UTB C;  3TU4 C;  5B2J D;  5DNM B;  4QLC D;  5KDM A;  3AZJ A;  3V9R B;  3KWQ A;  3AZM D;  3AV2 B;  1U35 C;  4KGC B;  4Z5T D;  5AY8 B;  3WAA C;  3MVD C;  4J8W D;  5B2I C;  3AFA D;  2HUE C;  4LD9 A;  5GT0 B;  4HGA C;  4Z66 A;  1P34 C;  2YFW B;  4NE6 A;  3LJA C;  4G91 B;  2CV5 C;  4J8W B;  3AFA B;  1P3O A;  4YM6 A;  2IO5 C;  3MNN A;  5B0Z D;  1KU5 A;  3UTA C;  4XZQ D;  3W97 C;  1BFM A;  3AZF A;  3B6F A;  5F99 D;  4H9N A;  4R8P D;  4X23 A;  3X1V A;  1BH8 B;  2NQB A;  5CPJ D;  5B0Z B;  1HTA A;  4XZQ B;  3LEL A;  2FJ7 C;  5AVB C;  4DRB A;  1P3I C;  4J8U B;  5B32 A;  5F99 B;  4E45 A;  3C1B C;  1JFI A;  5B40 A;  1P3B D;  1TAF B;  5CPI A;  1ID3 D;  3WKJ D;  3X1S B;  2BYK A;  4WU9 A;  1F66 D;  3AZE A;  5AVC D;  3A6N D;  3AZH D;  2PYO A;  3C1C A;  3UT9 A;  3WA9 A;  2YFV B;  1P3B B;  3MGS C;  3LZ1 A;  2F8N D;  3WKJ B;  3W96 D;  5B31 A;  3AZL C;  3A6N B;  1P3A C;  5DNN A;  1TZY D;  3WTP A;  4XUJ C;  4WU8 C;  1KX3 D;  1P3K D;  5CPK B;  4KHA A;  4NFT A;  5AV6 D;  5CHL B;  4KUD C;  1S32 B;  5CP6 C;  5AV9 C;  3REI D;  1TZY B;  3REK A;  3TU4 A;  5BNV B;  3B0C W;  4Z66 C;  3AYW C;  4WV4 B;  1KX3 B;  1P3K B;  5B24 B;  5AV6 B;  1EQZ D;  5B2J C;  4YM6 C;  4QLC C;  1AOI D;  5B1L D;  3AZN D;  4H9S C;  5GXQ D;  1EQZ B;  3MGQ D;  2BYM A;  3AZM C;  3X1V C;  3MVD A;  3REJ B;  1N1J A;  3WAA A;  2NQB C;  5B2I A;  3MGR A;  1AOI B;  4Z5T C;  3AZK D;  3AZI D;  1P3G B;  1M1A A;  1P3L B;  3LEL C;  1P3P D;  3VH5 W;  1P34 A;  5B32 C;  3MGQ B;  4DRA A;  1M18 D;  5B40 C;  3LJA A;  5CPI C;  3X1T D;  3KUY D;  4WU9 C;  4WZS B;  3W98 A;  1M19 B;  5JA4 A;  2ARO B;  4G92 B;  1P3P B;  3X1U A;  3C1C C;  3UT9 C;  3UTA A;  5B32 G;  2NZD A;  5E5A D;  3LZ1 C;  3KUY B;  4AWL C;  3X1T B;  5B31 C;  2RVQ C;  4J8X D;  1KX5 A;  3LZ0 D;  5AV8 B;  4M6B A;  4XZQ C;  3WTP C;  5GXQ A;  5DNM D;  3AN2 B;  4ZUX A;  5JRG A;  5E5A B;  4R8P C;  1ZLA B;  5CPJ C;  1P3I A;  4UUZ A;  5B31 G;  3LZ0 B;  4ZBJ B;  1P3M D;  3R45 B;  3KXB B;  3O62 A;  3AZG D;  3AV2 D;  3MGP A;  1M18 A;  4KGC D;  5B0Y D;  4J8V D;  5AY8 D;  1ID3 C;  3WKJ C;  1F66 C;  5AVC C;  5AV5 A;  3AZH C;  3MGS A;  4Z2M G;  3AZJ B;  1P3M B;  4CAY B;  2L5A A;  4WNN A;  4YS3 D;  3AZL A;  5BT1 D;  3KWQ B;  3AZG B;  1P3A A;  3NQU B;  5GT0 D;  3W96 C;  5B0Y B;  4J8V B;  4XUJ A;  4WU8 A;  5FUG B;  3VH6 T;  4JJN A;  1KX4 D;  4CSR A;  4KUD A;  3MGR C;  4YS3 B;  5CP6 A;  5AV9 A;  4EO5 B;  1M1A C;  4LD9 B;  4E44 A;  3AYW A;  3REH B;  3REI C;  1KX4 B;  3W98 C;  5B2J A;  1P3O B;  4QLC A;  2HIO D;  5GSU D;  3X1U C;  3AV1 D;  3NQJ A;  3MNN B;  4H9S A;  2NZD C;  1HQ3 D;  4J8U D;  1AOI C;  3AZM A;  5B1L C;  3AZN C;  1KX5 C;  3B6F B;  5GT3 D;  3X1S D;  4X23 B;  2JSS A;  2HIO B;  4Z5T A;  5GSU B;  3AV1 B;  5GXQ C;  1HQ3 B;  4ZUX C;  5JRG C;  3VH5 A;  3W99 D;  4J8W A;  3AZK C;  3AFA A;  3AZI C;  4G92 C;  5GT3 B;  3O62 C;  4H9Q A;  2BYK B;  3MGP C;  3AZE B;  5C3I B;  1M18 C;  4NE3 A;  3W99 B;  3X1T C;  5CPK D;  5AV5 C;  4Z2M H;  1S32 D;  5B0Z A;  4XZQ A;  1P3F D;  5DNN B;  5E5A C;  5B1M D;  3REL D;  3UTB D;  5F99 A;  4J8X C;  1TAF A;  5B24 D;  4R8P A;  4JJN C;  3B0D B;  4KHA B;  5CPJ A;  5DNM C;  1P3F B;  5B33 B;  3REK B;  5B1M B;  3REL B;  3UTB B;  3TU4 B;  1U35 D;  1P3B A;  3B6G D;  1P3M C;  3WKJ A;  1ID3 A;  1H3O B;  1F66 A;  3AV2 C;  1B6W A;  5AVC A;  3A6N A;  3AZH A;  3REJ D;  4KGC C;  4H9O B;  4J8V C;  5AY8 C;  1P3G D;  1P3L D;  1U35 B;  5CPK A;  3B6G B;  2F8N A;  3W96 A;  5BT1 C;  5GT0 C;  1TZY A;  3MVD B;  3WAA B;  2CV5 D;  5BNV A;  1M19 D;  5B2I B;  3VH5 T;  2ARO D;  2HUE B;  1KX3 A;  1P3K A;  3B0B A;  1ULY A;  4G91 C;  5AV6 A;  4J8W C;  4HGA B;  1P34 B;  3AFA C;  1BH9 B;  3REI A;  3W97 D;  3LJA B;  1B67 A;  3WTP E;  2CV5 B;  5AV8 D;  4H9R B;  2IO5 B;  1EQZ A;  3AN2 D;  3W97 B;  1ZLA D;  5AVB D;  1AOI A;  5B1L A;  3AZN A;  5B0Z C;  3C1B D;  3KXB D;  4J8U C;  5F99 C;  3MGQ A; 
#chains in the Genus database with same CATH topology
 2FJ7 B;  5AVB B;  3X1S C;  3AZK A;  5G49 B;  1P3I B;  3AZI A;  3C1B B;  3AZJ D;  4H9P A;  1P3P A;  2G5I C;  3KWQ D;  1P3B C;  3KUY A;  3X1T A;  5KDM B;  3A6N C;  4NE5 A;  3KSY A;  5BO0 A;  4WNN B;  3AZL B;  5CPK C;  4LD9 D;  1P3A B;  5E5A A;  1ZLA A;  3REH D;  1S32 C;  4Z66 D;  4J8X A;  4XUJ B;  4WU8 B;  3LZ0 A;  5BNX A;  1TZY C;  4CSR B;  4KUD B;  5B1M C;  5CP6 B;  2CWE A;  5AV9 B;  1P3O D;  4YM6 D;  5DNM A;  1P3K C;  1KX3 C;  5B24 C;  5AV6 C;  2F8N G;  3MNN D;  4Z66 B;  3AYW B;  3A1I A;  3V9R A;  2XD1 A;  3AZF D;  1P3M A;  4CAY A;  3B6F D;  3AV2 A;  3AZG A;  3NQU A;  2G5H C;  5B2J B;  4YM6 B;  4X23 D;  1Q9C A;  3X1V D;  2NQB D;  3B6G C;  4KGC A;  5B0Y A;  4QLC B;  5AY8 A;  4J8V A;  1EQZ C;  3NQJ B;  5FUG A;  3LEL D;  3REJ C;  3AZF B;  4YS3 A;  5B32 D;  3F6T A;  3AZM B;  1P3G C;  4H9N B;  5B40 D;  5GT0 A;  1P3L C;  3VH6 W;  2Y2H A;  3X1V B;  5CPI D;  2NQB B;  4WU9 D;  4Z5T B;  3REH A;  3AZE D;  2YFW A;  3MGQ C;  3LEL B;  1KX4 A;  2PYO D;  1R4V A;  1M19 C;  3C1C D;  3UT9 D;  5B32 B;  3WA9 D;  1JFI B;  2ARO C;  5B40 B;  1P3P C;  3LZ1 D;  1PZR A;  5CPI B;  1T3U A;  4WU9 B;  5B31 D;  2RVQ D;  4H9Q B;  5DNN D;  3WTP D;  3KUY C;  2PYO B;  3C1C B;  3UT9 B;  1WWI A;  5AV8 C;  3WA9 B;  2Y2K A;  1BH8 A;  3LZ1 B;  2HIO A;  4AWL B;  5GSU A;  3AV1 A;  5B31 B;  3AN2 C;  1HQ3 A;  5B33 D;  3WTP B;  3REK D;  1ZLA C;  3TU4 D;  4J8U A;  2ZY4 A;  3LZ0 C;  4ZBJ C;  5GT3 A;  3X1S A;  4R8P B;  3KXB C;  5CPJ B;  3B0C T;  3W99 A;  2YFV A;  2F8N H;  3AZJ C;  1ID3 B;  3AZG C;  2VQR A;  3KWQ C;  1F66 B;  5AVC B;  3EPJ A;  3AZH B;  2Y2O A;  5BS7 A;  3MVD D;  3WAA D;  2F8N K;  5B2I D;  5B0Y C;  3MGR D;  1M1A D;  2LY8 A;  2F8N B;  1S32 A;  3W96 B;  1P34 D;  4YS3 C;  2BYM B;  4EO5 C;  3LJA D;  2Y2N A;  1P3F A;  4LD9 C;  1N1J B;  5B33 A;  3MGR B;  5B1M A;  3REH C;  3REL A;  3UTB A;  3W98 D;  1M1A B;  5B24 A;  1KX4 C;  1H3O A;  3X1U D;  3UTA D;  1P3O C;  2NZD D;  3REI B;  4H9O A;  3W98 B;  5JA4 B;  3MNN C;  1KX5 D;  3P5J B;  1U35 A;  3B6G A;  2DF4 C;  3AZF C;  2ZM5 A;  2Y2M A;  3X1U B;  3B6F C;  3UTA B;  2ZY2 A;  2NZD B;  4ZUX D;  3REJ A;  2FJ7 D;  5JRG D;  4X23 C;  2HIO C;  5GSU C;  3AV1 C;  1P3I D;  1P3G A;  5B1L B;  3AZN B;  1KX5 B;  1P3L A;  1HQ3 C;  3VH6 A;  1A7W A;  3O62 D;  5GXQ B;  3MGP D;  1BH9 A;  1WWS A;  4ZUX B;  5GT3 C;  5JRG B;  2CV5 A;  1M19 A;  2ARO A;  4H9R A;  4UUZ B;  3AZE C;  5C3I C;  5AV5 D;  3AZI B;  2JCH A;  3MGS D;  3H0R C;  4H9P B;  3W99 C;  3EG5 B;  3O62 B;  3AZL D;  2PYO C;  3MGP B;  1P3A D;  3WA9 C;  3W97 A;  1M18 B;  1F1E A;  4XUJ D;  4WU8 D;  5AV8 A;  5AV5 B;  5BS7 C;  3MGS B;  4JJN D;  5DNN C;  4KUD D;  5BO0 B;  5CP6 D;  5AV9 D;  3AN2 A;  2FJ7 A;  3B0D C;  5AVB A;  3AYW D;  5G49 A;  3C1B A;  4J8X B;  3R45 A;  1P3F C;  5BNX B;  4JJN B;  5B33 C;  3KXB A;  3REK C;  3REL C;  3UTB C;  3TU4 C;  5B2J D;  5DNM B;  4QLC D;  3H0L C;  5KDM A;  3AZJ A;  3V9R B;  3KWQ A;  3AZM D;  3AV2 B;  1U35 C;  4KGC B;  4Z5T D;  5AY8 B;  3WAA C;  3MVD C;  4J8W D;  5B2I C;  3AL0 C;  3AFA D;  2HUE C;  4LD9 A;  5GT0 B;  4HGA C;  4Z66 A;  1P34 C;  2YFW B;  4NE6 A;  3LJA C;  4G91 B;  2CV5 C;  4J8W B;  3AFA B;  1P3O A;  4YM6 A;  2IO5 C;  3MNN A;  5B0Z D;  1KU5 A;  3UTA C;  4XZQ D;  3W97 C;  1BFM A;  3AZF A;  2Y2Q A;  3B6F A;  5F99 D;  4H9N A;  4R8P D;  4X23 A;  3X1V A;  1BH8 B;  2NQB A;  5CPJ D;  5B0Z B;  1HTA A;  4XZQ B;  3A1K A;  3LEL A;  2FJ7 C;  5AVB C;  4DRB A;  2ZY5 A;  4J8U B;  1P3I C;  5B32 A;  5F99 B;  4E45 A;  3C1B C;  1JFI A;  5B40 A;  1P3B D;  1TAF B;  5CPI A;  1ID3 D;  3WKJ D;  3X1S B;  2BYK A;  4WU9 A;  1F66 D;  3FDD A;  3AZE A;  5AVC D;  3A6N D;  3AZH D;  2PYO A;  3C1C A;  3UT9 A;  2W8S A;  2YFV B;  3WA9 A;  1P3B B;  3MGS C;  3LZ1 A;  2F8N D;  3WKJ B;  3W96 D;  5B31 A;  3AZL C;  3A6N B;  1P3A C;  5DNN A;  1TZY D;  3WTP A;  4XUJ C;  4WU8 C;  1KX3 D;  1P3K D;  5CPK B;  4KHA A;  4NFT A;  5AV6 D;  5CHL B;  4KUD C;  1S32 B;  5CP6 C;  5AV9 C;  3REI D;  1TZY B;  3REK A;  3TU4 A;  5BNV B;  3B0C W;  2UWX A;  4Z66 C;  3AYW C;  4WV4 B;  1KX3 B;  1P3K B;  5B24 B;  5AV6 B;  1EQZ D;  5B2J C;  4YM6 C;  2Y2G A;  4QLC C;  1AOI D;  5B1L D;  3AZN D;  4H9S C;  5GXQ D;  1EQZ B;  3MGQ D;  2BYM A;  3AZM C;  3X1V C;  3MVD A;  3REJ B;  1N1J A;  3WAA A;  2NQB C;  5B2I A;  3MGR A;  1AOI B;  4Z5T C;  3AZK D;  3AZI D;  1P3G B;  1M1A A;  1P3L B;  3LEL C;  1P3P D;  3VH5 W;  2F2A C;  2FFF B;  1P34 A;  5B32 C;  2Y2I A;  4DRA A;  3MGQ B;  5B40 C;  1M18 D;  3LJA A;  5CPI C;  3X1T D;  3KUY D;  4WU9 C;  4WZS B;  3W98 A;  1M19 B;  5JA4 A;  2DQN C;  2ARO B;  4G92 B;  1P3P B;  3X1U A;  3C1C C;  3UT9 C;  3UTA A;  5B32 G;  2NZD A;  5E5A D;  3LZ1 C;  3KUY B;  4AWL C;  3X1T B;  5B31 C;  2RVQ C;  4J8X D;  1KX5 A;  3LZ0 D;  5AV8 B;  4M6B A;  4XZQ C;  3WTP C;  5GXQ A;  2JE5 A;  5DNM D;  3AN2 B;  4ZUX A;  5JRG A;  5E5A B;  4R8P C;  2ZY3 A;  4DQY B;  1ZLA B;  5CPJ C;  1P3I A;  4UUZ A;  5B31 G;  3LZ0 B;  4ZBJ B;  1P3M D;  3R45 B;  3KXB B;  3O62 A;  3AZG D;  3AV2 D;  3MGP A;  1M18 A;  4KGC D;  5B0Y D;  4J8V D;  5AY8 D;  1ID3 C;  3WKJ C;  1F66 C;  5AVC C;  5AV5 A;  3AZH C;  3MGS A;  4Z2M G;  3AZJ B;  1P3M B;  4CAY B;  2L5A A;  4WNN A;  2J8P A;  4YS3 D;  3AZL A;  5BT1 D;  3KWQ B;  3AZG B;  1P3A A;  3NQU B;  5GT0 D;  3W96 C;  5B0Y B;  4J8V B;  4XUJ A;  4WU8 A;  5FUG B;  3VH6 T;  4JJN A;  1KX4 D;  4CSR A;  4KUD A;  3MGR C;  4YS3 B;  5CP6 A;  5AV9 A;  2XD5 A;  4EO5 B;  1M1A C;  4LD9 B;  4E44 A;  3H0M C;  3AYW A;  3REH B;  3REI C;  1KX4 B;  3W98 C;  5B2J A;  1P3O B;  2BG1 A;  4QLC A;  2HIO D;  5GSU D;  3X1U C;  3AV1 D;  3NQJ A;  3MNN B;  4H9S A;  2NZD C;  1HQ3 D;  4J8U D;  1AOI C;  3AZM A;  5B1L C;  3AZN C;  1KX5 C;  3B6F B;  5GT3 D;  3X1S D;  4X23 B;  2JSS A;  2HIO B;  4Z5T A;  5GSU B;  3AV1 B;  5GXQ C;  1HQ3 B;  4ZUX C;  5JRG C;  3VH5 A;  3W99 D;  4J8W A;  3AZK C;  3AFA A;  3AZK B;  3AZI C;  4G92 C;  5GT3 B;  3O62 C;  4H9Q A;  2BYK B;  3MGP C;  1Z2C B;  3AZE B;  5C3I B;  1M18 C;  4NE3 A;  3W99 B;  3X1T C;  3IP4 C;  5CPK D;  5AV5 C;  4Z2M H;  1S32 D;  3EPH A;  5B0Z A;  4XZQ A;  1P3F D;  2RIQ A;  5DNN B;  5E5A C;  5B1M D;  3REL D;  3UTB D;  5F99 A;  4J8X C;  1TAF A;  5B24 D;  4R8P A;  4JJN C;  3B0D B;  4KHA B;  5CPJ A;  3EPK A;  5DNM C;  1P3F B;  5B33 B;  3REK B;  5B1M B;  3REL B;  3UTB B;  3TU4 B;  1U35 D;  1P3B A;  3B6G D;  2Y2P A;  4UPK A;  1P3M C;  3WKJ A;  1ID3 A;  1H3O B;  1F66 A;  3AV2 C;  1B6W A;  5AVC A;  3A6N A;  3AZH A;  3REJ D;  4KGC C;  4H9O B;  4J8V C;  5AY8 C;  1P3G D;  1P3L D;  2Y2L A;  1U35 B;  5CPK A;  3B6G B;  2F8N A;  3W96 A;  5BT1 C;  5GT0 C;  1TZY A;  3MVD B;  3WAA B;  2CV5 D;  5BNV A;  1M19 D;  5B2I B;  3VH5 T;  2ARO D;  2HUE B;  1KX3 A;  1P3K A;  3B0B A;  1ULY A;  4G91 C;  5AV6 A;  4J8W C;  4HGA B;  1W2E A;  1P34 B;  3AFA C;  1BH9 B;  3REI A;  3W97 D;  3LJA B;  1B67 A;  3WTP E;  2CV5 B;  3KFU G;  5AV8 D;  4H9R B;  2Y2J A;  2IO5 B;  1EQZ A;  3AN2 D;  4WJ3 C;  3W97 B;  1ZLA D;  5AVB D;  3EPL A;  1AOI A;  5B1L A;  3AZN A;  5B0Z C;  3C1B D;  3KXB D;  4J8U C;  5F99 C;  3MGQ A; 
#chains in the Genus database with same CATH homology
 2FJ7 B;  5AVB B;  3X1S C;  3AZK A;  5G49 B;  1P3I B;  3AZI A;  3C1B B;  3AZJ D;  4H9P A;  1P3P A;  2G5I C;  3KWQ D;  1P3B C;  3KUY A;  3X1T A;  5KDM B;  3A6N C;  4NE5 A;  3KSY A;  5BO0 A;  4WNN B;  3AZL B;  5CPK C;  4LD9 D;  1P3A B;  5E5A A;  1ZLA A;  3REH D;  1S32 C;  4Z66 D;  4J8X A;  4XUJ B;  4WU8 B;  3LZ0 A;  5BNX A;  1TZY C;  4CSR B;  4KUD B;  5B1M C;  5CP6 B;  2CWE A;  5AV9 B;  1P3O D;  4YM6 D;  5DNM A;  1P3K C;  1KX3 C;  5B24 C;  5AV6 C;  2F8N G;  3MNN D;  4Z66 B;  3AYW B;  3A1I A;  3V9R A;  2XD1 A;  3AZF D;  1P3M A;  4CAY A;  3B6F D;  3AV2 A;  3AZG A;  3NQU A;  2G5H C;  5B2J B;  4YM6 B;  4X23 D;  1Q9C A;  3X1V D;  2NQB D;  3B6G C;  4KGC A;  5B0Y A;  4QLC B;  5AY8 A;  4J8V A;  1EQZ C;  3NQJ B;  5FUG A;  3LEL D;  3REJ C;  3AZF B;  4YS3 A;  5B32 D;  3F6T A;  3AZM B;  1P3G C;  4H9N B;  5B40 D;  5GT0 A;  1P3L C;  3VH6 W;  2Y2H A;  3X1V B;  5CPI D;  2NQB B;  4WU9 D;  4Z5T B;  3REH A;  3AZE D;  2YFW A;  3MGQ C;  3LEL B;  1KX4 A;  2PYO D;  1R4V A;  1M19 C;  3C1C D;  3UT9 D;  5B32 B;  3WA9 D;  1JFI B;  2ARO C;  5B40 B;  1P3P C;  3LZ1 D;  1PZR A;  5CPI B;  1T3U A;  4WU9 B;  5B31 D;  2RVQ D;  4H9Q B;  5DNN D;  3WTP D;  3KUY C;  2PYO B;  3C1C B;  3UT9 B;  1WWI A;  5AV8 C;  3WA9 B;  2Y2K A;  1BH8 A;  3LZ1 B;  2HIO A;  4AWL B;  5GSU A;  3AV1 A;  5B31 B;  3AN2 C;  1HQ3 A;  5B33 D;  3WTP B;  3REK D;  1ZLA C;  3TU4 D;  4J8U A;  2ZY4 A;  3LZ0 C;  4ZBJ C;  5GT3 A;  3X1S A;  4R8P B;  3KXB C;  5CPJ B;  3B0C T;  3W99 A;  2YFV A;  2F8N H;  3AZJ C;  1ID3 B;  3AZG C;  2VQR A;  3KWQ C;  1F66 B;  5AVC B;  3EPJ A;  3AZH B;  2Y2O A;  5BS7 A;  3MVD D;  3WAA D;  2F8N K;  5B2I D;  5B0Y C;  3MGR D;  1M1A D;  2LY8 A;  2F8N B;  1S32 A;  3W96 B;  1P34 D;  4YS3 C;  2BYM B;  4EO5 C;  3LJA D;  2Y2N A;  1P3F A;  4LD9 C;  1N1J B;  5B33 A;  3MGR B;  5B1M A;  3REH C;  3REL A;  3UTB A;  3W98 D;  1M1A B;  5B24 A;  1KX4 C;  1H3O A;  3X1U D;  3UTA D;  1P3O C;  2NZD D;  3REI B;  4H9O A;  3W98 B;  5JA4 B;  3MNN C;  1KX5 D;  3P5J B;  1U35 A;  3B6G A;  2DF4 C;  3AZF C;  2ZM5 A;  2Y2M A;  3X1U B;  3B6F C;  3UTA B;  2ZY2 A;  2NZD B;  4ZUX D;  3REJ A;  2FJ7 D;  5JRG D;  4X23 C;  2HIO C;  5GSU C;  3AV1 C;  1P3I D;  1P3G A;  5B1L B;  3AZN B;  1KX5 B;  1P3L A;  1HQ3 C;  3VH6 A;  1A7W A;  3O62 D;  5GXQ B;  3MGP D;  1BH9 A;  1WWS A;  4ZUX B;  5GT3 C;  5JRG B;  2CV5 A;  1M19 A;  2ARO A;  4H9R A;  4UUZ B;  3AZE C;  5C3I C;  5AV5 D;  3AZI B;  2JCH A;  3MGS D;  3H0R C;  4H9P B;  3W99 C;  3EG5 B;  3O62 B;  3AZL D;  2PYO C;  3MGP B;  1P3A D;  3WA9 C;  3W97 A;  1M18 B;  1F1E A;  4XUJ D;  4WU8 D;  5AV8 A;  5AV5 B;  5BS7 C;  3MGS B;  4JJN D;  5DNN C;  4KUD D;  5BO0 B;  5CP6 D;  5AV9 D;  3AN2 A;  2FJ7 A;  3B0D C;  5AVB A;  3AYW D;  5G49 A;  3C1B A;  4J8X B;  3R45 A;  1P3F C;  5BNX B;  4JJN B;  5B33 C;  3KXB A;  3REK C;  3REL C;  3UTB C;  3TU4 C;  5B2J D;  5DNM B;  4QLC D;  3H0L C;  5KDM A;  3AZJ A;  3V9R B;  3KWQ A;  3AZM D;  3AV2 B;  1U35 C;  4KGC B;  4Z5T D;  5AY8 B;  3WAA C;  3MVD C;  4J8W D;  5B2I C;  3AL0 C;  3AFA D;  2HUE C;  4LD9 A;  5GT0 B;  4HGA C;  4Z66 A;  1P34 C;  2YFW B;  4NE6 A;  3LJA C;  4G91 B;  2CV5 C;  4J8W B;  3AFA B;  1P3O A;  4YM6 A;  2IO5 C;  3MNN A;  5B0Z D;  1KU5 A;  3UTA C;  4XZQ D;  3W97 C;  1BFM A;  3AZF A;  2Y2Q A;  3B6F A;  5F99 D;  4H9N A;  4R8P D;  4X23 A;  3X1V A;  1BH8 B;  2NQB A;  5CPJ D;  5B0Z B;  1HTA A;  4XZQ B;  3A1K A;  3LEL A;  2FJ7 C;  5AVB C;  4DRB A;  2ZY5 A;  4J8U B;  1P3I C;  5B32 A;  5F99 B;  4E45 A;  3C1B C;  1JFI A;  5B40 A;  1P3B D;  1TAF B;  5CPI A;  1ID3 D;  3WKJ D;  3X1S B;  2BYK A;  4WU9 A;  1F66 D;  3FDD A;  3AZE A;  5AVC D;  3A6N D;  3AZH D;  2PYO A;  3C1C A;  3UT9 A;  2W8S A;  2YFV B;  3WA9 A;  1P3B B;  3MGS C;  3LZ1 A;  2F8N D;  3WKJ B;  3W96 D;  5B31 A;  3AZL C;  3A6N B;  1P3A C;  5DNN A;  1TZY D;  3WTP A;  4XUJ C;  4WU8 C;  1KX3 D;  1P3K D;  5CPK B;  4KHA A;  4NFT A;  5AV6 D;  5CHL B;  4KUD C;  1S32 B;  5CP6 C;  5AV9 C;  3REI D;  1TZY B;  3REK A;  3TU4 A;  5BNV B;  3B0C W;  2UWX A;  4Z66 C;  3AYW C;  4WV4 B;  1KX3 B;  1P3K B;  5B24 B;  5AV6 B;  1EQZ D;  5B2J C;  4YM6 C;  2Y2G A;  4QLC C;  1AOI D;  5B1L D;  3AZN D;  4H9S C;  5GXQ D;  1EQZ B;  3MGQ D;  2BYM A;  3AZM C;  3X1V C;  3MVD A;  3REJ B;  1N1J A;  3WAA A;  2NQB C;  5B2I A;  3MGR A;  1AOI B;  4Z5T C;  3AZK D;  3AZI D;  1P3G B;  1M1A A;  1P3L B;  3LEL C;  1P3P D;  3VH5 W;  2F2A C;  2FFF B;  1P34 A;  5B32 C;  2Y2I A;  4DRA A;  3MGQ B;  5B40 C;  1M18 D;  3LJA A;  5CPI C;  3X1T D;  3KUY D;  4WU9 C;  4WZS B;  3W98 A;  1M19 B;  5JA4 A;  2DQN C;  2ARO B;  4G92 B;  1P3P B;  3X1U A;  3C1C C;  3UT9 C;  3UTA A;  5B32 G;  2NZD A;  5E5A D;  3LZ1 C;  3KUY B;  4AWL C;  3X1T B;  5B31 C;  2RVQ C;  4J8X D;  1KX5 A;  3LZ0 D;  5AV8 B;  4M6B A;  4XZQ C;  3WTP C;  5GXQ A;  2JE5 A;  5DNM D;  3AN2 B;  4ZUX A;  5JRG A;  5E5A B;  4R8P C;  2ZY3 A;  4DQY B;  1ZLA B;  5CPJ C;  1P3I A;  4UUZ A;  5B31 G;  3LZ0 B;  4ZBJ B;  1P3M D;  3R45 B;  3KXB B;  3O62 A;  3AZG D;  3AV2 D;  3MGP A;  1M18 A;  4KGC D;  5B0Y D;  4J8V D;  5AY8 D;  1ID3 C;  3WKJ C;  1F66 C;  5AVC C;  5AV5 A;  3AZH C;  3MGS A;  4Z2M G;  3AZJ B;  1P3M B;  4CAY B;  2L5A A;  4WNN A;  2J8P A;  4YS3 D;  3AZL A;  5BT1 D;  3KWQ B;  3AZG B;  1P3A A;  3NQU B;  5GT0 D;  3W96 C;  5B0Y B;  4J8V B;  4XUJ A;  4WU8 A;  5FUG B;  3VH6 T;  4JJN A;  1KX4 D;  4CSR A;  4KUD A;  3MGR C;  4YS3 B;  5CP6 A;  5AV9 A;  2XD5 A;  4EO5 B;  1M1A C;  4LD9 B;  4E44 A;  3H0M C;  3AYW A;  3REH B;  3REI C;  1KX4 B;  3W98 C;  5B2J A;  1P3O B;  2BG1 A;  4QLC A;  2HIO D;  5GSU D;  3X1U C;  3AV1 D;  3NQJ A;  3MNN B;  4H9S A;  2NZD C;  1HQ3 D;  4J8U D;  1AOI C;  3AZM A;  5B1L C;  3AZN C;  1KX5 C;  3B6F B;  5GT3 D;  3X1S D;  4X23 B;  2JSS A;  2HIO B;  4Z5T A;  5GSU B;  3AV1 B;  5GXQ C;  1HQ3 B;  4ZUX C;  5JRG C;  3VH5 A;  3W99 D;  4J8W A;  3AZK C;  3AFA A;  3AZK B;  3AZI C;  4G92 C;  5GT3 B;  3O62 C;  4H9Q A;  2BYK B;  3MGP C;  1Z2C B;  3AZE B;  5C3I B;  1M18 C;  4NE3 A;  3W99 B;  3X1T C;  3IP4 C;  5CPK D;  5AV5 C;  4Z2M H;  1S32 D;  3EPH A;  5B0Z A;  4XZQ A;  1P3F D;  2RIQ A;  5DNN B;  5E5A C;  5B1M D;  3REL D;  3UTB D;  5F99 A;  4J8X C;  1TAF A;  5B24 D;  4R8P A;  4JJN C;  3B0D B;  4KHA B;  5CPJ A;  3EPK A;  5DNM C;  1P3F B;  5B33 B;  3REK B;  5B1M B;  3REL B;  3UTB B;  3TU4 B;  1U35 D;  1P3B A;  3B6G D;  2Y2P A;  4UPK A;  1P3M C;  3WKJ A;  1ID3 A;  1H3O B;  1F66 A;  3AV2 C;  1B6W A;  5AVC A;  3A6N A;  3AZH A;  3REJ D;  4KGC C;  4H9O B;  4J8V C;  5AY8 C;  1P3G D;  1P3L D;  2Y2L A;  1U35 B;  5CPK A;  3B6G B;  2F8N A;  3W96 A;  5BT1 C;  5GT0 C;  1TZY A;  3MVD B;  3WAA B;  2CV5 D;  5BNV A;  1M19 D;  5B2I B;  3VH5 T;  2ARO D;  2HUE B;  1KX3 A;  1P3K A;  3B0B A;  1ULY A;  4G91 C;  5AV6 A;  4J8W C;  4HGA B;  1W2E A;  1P34 B;  3AFA C;  1BH9 B;  3REI A;  3W97 D;  3LJA B;  1B67 A;  3WTP E;  2CV5 B;  3KFU G;  5AV8 D;  4H9R B;  2Y2J A;  2IO5 B;  1EQZ A;  3AN2 D;  4WJ3 C;  3W97 B;  1ZLA D;  5AVB D;  3EPL A;  1AOI A;  5B1L A;  3AZN A;  5B0Z C;  3C1B D;  3KXB D;  4J8U C;  5F99 C;  3MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...