1ID3D

Crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
b'RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALINDROMIC 146BP DNA FRAGMENT
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
pubmed doi rcsb
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2001-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1id3D00
3NQUA 4CAYA 5F99C 3WAAD 1S32B 3O62C 4J8UC 4X23C 4XZQC 5B32B 3UT9A 4NFTA 3W99B 3R45B 3MGRC 1P3PB 2PYOC 5BNVB 4X23D 5AV8C 1P3LB 5B0YD 1P3BA 1P3MD 2NQBC 1HTAA 3TU4D 2CV5C 3X1VB 5AV8D 4X23B 1P3MC 3X1TB 1HQ3B 4YM6B 4Z5TD 5DNND 3MGQB 4JJNC 4NE6A 5AV9B 1KX5A 3X1UD 5AV5B 3WA9B 3WTPD 5B32G 1P34C 3LJAA 5B2JD 1HQ3D 1F66C 3LELA 1ZLAA 5B33B 3X1SC 3MGPB 3B0CW 4YM6A 2LY8A 3MGQA 3AZKD 1ZLAC 1BH9A 2JSSA 5AV9A 1KX5B 5CPJC 3WKJD 5AV5A 3B6FD 5GT0B 4J8VB 2YFWB 5B0YB 4Z66C 2NZDB 1P3KD 1P3AD 1P3IB 4JJNA 1KX4A 2CV5B 1P3KB 3VH6A 5AV9D 4XUJC 4LD9C 3RELB 3REKC 1TZYA 5B1MC 5C3IC 5AVCC 1P3OC 5B40C 1AOIB 3B6GB 3MGRA 3VH5A 4WU9C 1P3GA 3AZMD 1TZYB 5B0ZA 5AVCB 1P3OB 2AROA 3AV2A 1P3BB 4KUDD 2CWEA 5CPID 3MGRB 1F1EA 3AZHB 4X23A 1WWSA 5CPIA 3UTAC 3AV1A 1ID3A 4H9NA 1WWIA 3KUYC 5B0ZD 3VH5T 5FUGB 3LJAD 5B0ZC 3B6GD 1P3GD 3AZLC 5B32D 3MNNC 5CPJB 3LELB 3MGSD 3AV1B 4J8XB 3AZHC 5CPIC 1BH9B 3AZND 5B40A 3AN2D 3AZMC 3AZIA 3AV1D 5AVBB 3AV2C 5GSUD 2NZDA 1JFIB 4JJND 4XUJA 3W98B 5DNMB 4H9SA 5GSUB 4WV4B 3MVDB 3UT9D 1P3GC 3RELA 4WU9B 1BFMA 2HIOC 4QLCB 3MGSA 3O62D 3B6GA 3KXBB 4QLCC 3WAAC 1TZYC 5F99D 1Q9CA 3AZJD 2FJ7C 3X1UB 3AFAD 4CSRB 2F8NK 4QLCD 3B6FC 5DNNB 5CP6A 4R8PD 4J8WB 3W98C 4XZQD 3B0DC 3MNNB 1P34A 5AY8C 4J8UD 3KWQB 5B1LA 4Z5TA 2HUEB 3KUYB 5AY8A 5B33D 3LZ1D 1M19B 1KX5C 4ZUXD 4J8WD 3MGPD 5B33C 4KGCB 1P3MA 4H9NB 1P34D 5JRGD 3LELC 1P3BC 2NQBA 1F66A 4EO5C 3W96C 5BS7C 2PYOA 5E5AC 2IO5B 5JRGB 3C1CD 1P3AB 2PYOD 4H9OB 3A6NB 3AZKB 5GT3B 3LZ0C 4J8XA 3REHD 3AZEB 1KU5A 3A6ND 3REJC 3WKJC 2PYOB 3AYWB 3LZ0D 5AV8A 3REHC 3UTAD 3REID 4Z2MG 3LZ0B 4XZQA 4ZBJC 3REIB 1HQ3C 5GT3A 5DNNC 5B2IC 4Z66B 3UTBA 3AZLA 3C1BC 3AZFB 1H3OB 5BNXB 3AYWA 3KSYA 3W97D 2BYMA 3REKB 1KX3D 1ID3C 1KX4D 5DNNA 5CP6B 3REIA 3W99D 4J8WA 3AZGA 5B31B 1BH8B 1S32C 3TU4A 3A6NC 1ID3D 4XUJD 4M6BA 4Z5TB 5B24A 3AZFA 4AWLB 4WNNB 2IO5C 5AY8B 1S32D 3REHA 4H9QB 1N1JA 4EO5B 4WU8B 5GXQA 1P3MB 1P3LD 4J8XC 5B2JA 5BO0A 4WU8C 5KDMB 1M19C 5JRGA 3W97A 4WU8D 5E5AA 2BYKB 4G91C 5GSUC 3AZEA 5B31D 2YFVB 3X1VC 2L5AA 3AZNC 3V9RB 5KDMA 5AV8B 5B24D 1P3LC 3AZNA 3WKJB 3AFAA 3C1BB 3AZGD 4Z2MH 4XZQB 3X1SA 5B32C 3MNND 4R8PB 5E5AD 2F8NB 1P3FC 1A7WA 4H9RB 4HGAB 3UTBB 5B32A 4KHAA 1H3OA 5BNXA 4UUZB 3VH6T 3WA9D 3RELD 3UTBD 5BNVA 5C3IB 4CAYB 1P3LA 3AZMB 2F8ND 5B2JC 2CV5A 3AZEC 3LZ1C 1KX5D 3B0CT 5B24B 1P3PA 4KHAB 2NZDC 1U35D 4H9PB 5AV6A 4J8VC 5B2IB 3B0DB 3AZMA 5GXQB 4WU8A 4HGAC 4J8UA 5AVCD 3X1TA 5CPKD 1P3OD 3UTAB 5CP6D 3AYWD 3WAAB 3REKD 3AYWC 3WA9A 2AROB 3REJD 5GT0A 3W96D 3W99C 3WTPA 2YFWA 4H9PA 3NQUB 2F8NG 4NE5A 5B2IA 1P3KC 4YS3D 1TAFB 4Z66D 3AZFD 3MGPA 1P3IC 4JJNB 4J8WC 1U35A 1P3KA 5AVBD 2AROD 3X1TC 3X1UC 3R45A 5GT0C 5AV6C 4J8VA 1M18D 5AV5D 5B0YA 1P3BD 5B1MB 4J8XD 3WTPB 5B2ID 5B31G 3C1BA 3X1SB 1KX4B 1TAFA 1HQ3A 5GT3C 3AZJA 1P3GB 2HUEC 4UUZA 5CHLB 5AVCA 1P3OA 3KWQC 1AOIA 5B1MA 3B0BA 1ZLAB 5DNMA 5B33A 4DRBA 1ID3B 3AZJB 4KGCC 3KXBC 1KX4C 3NQJA 4G92B 4E45A 1EQZC 5FUGA 4YM6D 3MGQD 2HIOB 5AV6B 5B40D 3AV2D 3AN2A 5G49B 4WU9D 3KXBA 4J8UB 5CPJA 1EQZD 4YM6C 3MGQC 4CSRA 1AOID 1M1AA 3WAAA 3AFAC 5B40B 3B6GC 3KWQA 1P3FD 3LJAC 5B1LB 3AZIB 3AN2C 3AZLD 3MGSC 2HIOA 3KXBD 4G92C 1M19A 5JA4A 1JFIA 1TZYD 3AZJC 3W98A 4KGCA 1U35B 5GSUA 2NZDD 1M1AB 3KUYD 4J8VD 1M18A 4E44A 5B0ZB 4QLCA 3AZED 4AWLC 5AVBA 5JRGC 5CPKC 2HIOD 3AV2B 1AOIC 3W96B 5JA4B 3A6NA 4H9OA 3AZHA 1U35C 3UT9C 3MVDA 3C1CC 3AZKA 5CPIB 3WTPE 3RELC 3AZHD 3LELD 3MNNA 3MGSB 3WTPC 4YS3C 3WA9C 3AZFC 1KX3B 3WKJA 5B0YC 3TU4C 2NQBD 3KUYA 4ZUXC 3UTBC 2FJ7D 3X1UA 3REIC 3W98D 4R8PC 3NQJB 4ZUXA 2FJ7B 5AY8D 2NQBB 2RVQC 1P3PC 4YS3A 3AN2B 1KX3A 5G49A 4XUJB 3REJA 1B67A 3O62B 3AZKC 1ZLAD 3MVDC 3C1CA 5CPJD 4ZBJB 4WU9A 3TU4B 1F66D 4KUDB 5AVBC 3X1TD 3MVDD 5CPKA 4YS3B 1R4VA 2AROC 5AV6D 3X1SD 1M18C 3LZ0A 3LZ1A 4LD9B 2RVQD 1P3PD 5B2JB 1M18B 1P3ID 1P34B 4Z66A 5B1MD 2CV5D 4KGCD 5F99B 1P3AC 4KUDA 3AZID 3W96A 4Z5TC 5BS7A 5E5AB 5AV9C 4LD9D 2BYMB 1B6WA 1M1AC 3REKA 3B6FB 3LZ1B 4LD9A 3KWQD 1P3FA 5CP6C 5GT3D 3C1BD 3AZGB 1BH8A 1F66B 4WZSB 3W97C 5B1LC 5BT1C 1EQZA 1P3AA 2F8NH 4KUDC 3AFAB 5AV5C 4H9QA 3X1VA 4DRAA 5B1LD 5BT1D 5DNMC 3B6FA 1P3FB 4G91B 4ZUXB 2FJ7A 4H9SC 5BO0B 5GT0D 1M19D 3REHB 1EQZB 1N1JB 3W97B 3LJAB 3AZIC 3REJB 2BYKA 3AZGC 3O62A 3C1CB 1M1AD 1ULYA 3MGRD 5GXQC 2YFVA 3AZLB 3VH6W 5CPKB 5GXQD 4NE3A 1KX3C 5B24C 5B31C 1S32A 3X1VD 3MGPC 1P3IA 3VH5W 4R8PA 3UTAA 5B31A 3AV1C 2F8NA 5DNMD 3V9RA 4H9RA 3UT9B 3W99A 5F99A 4WNNA 3AZNB
chains in the Genus database with same CATH superfamily
2Y2JA 3NQUA 4CAYA 5F99C 3WAAD 3P5JB 1S32B 3O62C 4J8UC 4X23C 4XZQC 2G5HC 5B32B 3UT9A 4NFTA 3W99B 3R45B 3MGRC 1P3PB 2RIQA 2PYOC 5BNVB 4X23D 5AV8C 1P3LB 5B0YD 1P3BA 1P3MD 2NQBC 1HTAA 3TU4D 2CV5C 3EG5B 5AV8D 4X23B 3EPKA 3X1VB 1P3MC 3X1TB 1HQ3B 4YM6B 4Z5TD 5DNND 3MGQB 4JJNC 4NE6A 5AV9B 1KX5A 3X1UD 5AV5B 3WA9B 3WTPD 5B32G 1P34C 3LJAA 1Z2CB 5B2JD 1HQ3D 1F66C 3LELA 1ZLAA 5B33B 3X1SC 3MGPB 3B0CW 4YM6A 2LY8A 3MGQA 3AZKD 1ZLAC 1BH9A 2JSSA 5AV9A 1KX5B 5CPJC 3WKJD 5AV5A 3B6FD 5GT0B 2W8SA 4J8VB 2YFWB 5B0YB 4Z66C 2NZDB 1P3KD 1P3AD 1P3IB 4JJNA 1KX4A 2CV5B 1P3KB 3VH6A 5AV9D 4XUJC 4LD9C 3RELB 3REKC 1TZYA 3H0MC 5B1MC 5C3IC 5AVCC 1P3OC 5B40C 1AOIB 3B6GB 3MGRA 3VH5A 4WU9C 1P3GA 3AZMD 4UPKA 1TZYB 5B0ZA 5AVCB 1P3OB 2AROA 3AV2A 1P3BB 4KUDD 2CWEA 5CPID 3MGRB 1F1EA 2Y2NA 3AZHB 4X23A 1WWSA 5CPIA 3UTAC 3AV1A 2Y2KA 1ID3A 4H9NA 1WWIA 3KUYC 5B0ZD 3VH5T 5FUGB 3LJAD 5B0ZC 3B6GD 1P3GD 3AZLC 5B32D 3MNNC 4DQYB 5CPJB 3EPLA 3LELB 3MGSD 2Y2LA 3AV1B 4J8XB 3AZHC 5CPIC 1BH9B 3AZND 5B40A 3AN2D 3AZMC 3AZIA 3AV1D 5AVBB 3AV2C 5GSUD 2NZDA 1JFIB 4JJND 4XUJA 3W98B 5DNMB 4H9SA 5GSUB 4WV4B 3MVDB 3UT9D 1P3GC 3RELA 4WU9B 1BFMA 2Y2HA 2HIOC 4QLCB 3MGSA 3O62D 3B6GA 3KXBB 4QLCC 3WAAC 1TZYC 5F99D 1Q9CA 3AZJD 2FJ7C 3X1UB 3AFAD 4CSRB 2F8NK 4QLCD 3B6FC 5DNNB 5CP6A 4R8PD 2VQRA 4J8WB 3W98C 4XZQD 3B0DC 3MNNB 1P34A 5AY8C 4J8UD 3KWQB 2G5IC 1PZRA 5B1LA 4Z5TA 2HUEB 3AL0C 3KUYB 5AY8A 5B33D 3LZ1D 1M19B 1KX5C 4ZUXD 4J8WD 3MGPD 5B33C 4KGCB 1P3MA 4H9NB 1P34D 5JRGD 3LELC 1P3BC 2NQBA 1F66A 4EO5C 3W96C 5BS7C 2PYOA 5E5AC 2IO5B 2Y2MA 5JRGB 3C1CD 1P3AB 2PYOD 4H9OB 3A6NB 3AZKB 5GT3B 3LZ0C 4J8XA 3REHD 3AZEB 1KU5A 3A6ND 2ZY4A 3REJC 3WKJC 2PYOB 3AYWB 3LZ0D 5AV8A 3REHC 3UTAD 2Y2IA 3REID 4Z2MG 3LZ0B 4XZQA 4ZBJC 3REIB 1HQ3C 5GT3A 5DNNC 5B2IC 4Z66B 3UTBA 3AZLA 3C1BC 2ZY5A 3AZFB 1H3OB 5BNXB 3AYWA 3KSYA 3W97D 2Y2OA 2BYMA 3REKB 1KX3D 1ID3C 1KX4D 5DNNA 5CP6B 3REIA 3W99D 4J8WA 3AZGA 5B31B 1BH8B 1S32C 3TU4A 3A6NC 4WJ3C 1ID3D 4XUJD 4M6BA 4Z5TB 5B24A 3AZFA 4AWLB 4WNNB 2IO5C 5AY8B 1S32D 3REHA 4H9QB 1N1JA 4EO5B 4WU8B 5GXQA 1P3MB 1P3LD 2XD1A 4J8XC 2JE5A 5B2JA 5BO0A 4WU8C 5KDMB 1M19C 2Y2PA 5JRGA 3W97A 4WU8D 5E5AA 2BYKB 4G91C 5GSUC 3AZEA 5B31D 2JCHA 2YFVB 3X1VC 2L5AA 3AZNC 3V9RB 5KDMA 1W2EA 5AV8B 5B24D 1P3LC 3AZNA 3WKJB 3AFAA 3C1BB 3AZGD 4Z2MH 4XZQB 3X1SA 5B32C 3MNND 4R8PB 5E5AD 2F8NB 1P3FC 1A7WA 3A1IA 4H9RB 4HGAB 3UTBB 5B32A 3EPHA 4KHAA 1H3OA 5BNXA 4UUZB 3VH6T 3WA9D 3RELD 3UTBD 5BNVA 5C3IB 4CAYB 1P3LA 3AZMB 2F8ND 5B2JC 2CV5A 3AZEC 3LZ1C 1KX5D 3B0CT 5B24B 1P3PA 4KHAB 2DF4C 2NZDC 1U35D 4H9PB 5AV6A 4J8VC 5B2IB 3B0DB 3AZMA 5GXQB 4WU8A 4HGAC 4J8UA 5AVCD 3X1TA 5CPKD 1P3OD 3UTAB 5CP6D 3AYWD 3WAAB 3REKD 3AYWC 3WA9A 2AROB 3REJD 5GT0A 3W96D 3W99C 3WTPA 2YFWA 4H9PA 3NQUB 2F8NG 4NE5A 5B2IA 1P3KC 4YS3D 1TAFB 4Z66D 3AZFD 3MGPA 1P3IC 4JJNB 4J8WC 1U35A 1P3KA 5AVBD 2AROD 3X1TC 3X1UC 3R45A 5GT0C 5AV6C 4J8VA 1M18D 5AV5D 5B0YA 1P3BD 5B1MB 4J8XD 2DQNC 3WTPB 5B2ID 5B31G 3C1BA 3X1SB 1KX4B 1TAFA 1HQ3A 5GT3C 3AZJA 1P3GB 3IP4C 3FDDA 2HUEC 4UUZA 5CHLB 5AVCA 1P3OA 3KWQC 1AOIA 5B1MA 2Y2GA 3B0BA 1ZLAB 5DNMA 5B33A 4DRBA 1ID3B 3AZJB 4KGCC 3KXBC 1KX4C 3NQJA 4G92B 4E45A 1EQZC 5FUGA 4YM6D 3MGQD 2HIOB 5AV6B 5B40D 3AV2D 3AN2A 5G49B 4WU9D 2ZY3A 3KXBA 4J8UB 5CPJA 1EQZD 4YM6C 3MGQC 4CSRA 1AOID 1M1AA 3WAAA 3AFAC 5B40B 3B6GC 3KWQA 1P3FD 1T3UA 3LJAC 5B1LB 3AZIB 3AN2C 3AZLD 3MGSC 2HIOA 3KXBD 4G92C 1M19A 5JA4A 1JFIA 1TZYD 3AZJC 3W98A 4KGCA 1U35B 5GSUA 2NZDD 1M1AB 3KUYD 4J8VD 1M18A 4E44A 5B0ZB 4QLCA 3AZED 4AWLC 5AVBA 5JRGC 5CPKC 2HIOD 3AV2B 1AOIC 3W96B 5JA4B 4H9OA 3A6NA 3AZHA 1U35C 3UT9C 3MVDA 3C1CC 3AZKA 5CPIB 2XD5A 3WTPE 3RELC 3AZHD 2F2AC 3LELD 3MNNA 3MGSB 3WTPC 4YS3C 3WA9C 3AZFC 1KX3B 3WKJA 5B0YC 3TU4C 2NQBD 3KUYA 4ZUXC 3UTBC 2FJ7D 2BG1A 3X1UA 3REIC 3H0RC 3W98D 4R8PC 3NQJB 4ZUXA 2FJ7B 5AY8D 2NQBB 2RVQC 2FFFB 4YS3A 3AN2B 1P3PC 1KX3A 5G49A 4XUJB 3REJA 1B67A 3O62B 3AZKC 1ZLAD 3MVDC 3C1CA 5CPJD 4ZBJB 2ZM5A 4WU9A 3TU4B 1F66D 3H0LC 4KUDB 5AVBC 3X1TD 3MVDD 5CPKA 4YS3B 1R4VA 2AROC 2UWXA 5AV6D 3X1SD 1M18C 3LZ0A 3LZ1A 4LD9B 2RVQD 1P3PD 5B2JB 1M18B 1P3ID 1P34B 4Z66A 5B1MD 2CV5D 3EPJA 4KGCD 5F99B 1P3AC 4KUDA 3AZID 3W96A 4Z5TC 5BS7A 5E5AB 5AV9C 4LD9D 2BYMB 1B6WA 1M1AC 3REKA 3B6FB 3KFUG 3LZ1B 4LD9A 3KWQD 1P3FA 5CP6C 5GT3D 3C1BD 3AZGB 1BH8A 1F66B 4WZSB 3F6TA 3W97C 5B1LC 5BT1C 1EQZA 1P3AA 2F8NH 4KUDC 3AFAB 5AV5C 4H9QA 3X1VA 4DRAA 5B1LD 2ZY2A 5BT1D 5DNMC 3B6FA 1P3FB 4G91B 4ZUXB 2FJ7A 4H9SC 5BO0B 5GT0D 1M19D 3REHB 1EQZB 1N1JB 3W97B 3LJAB 3AZIC 3REJB 2BYKA 3AZGC 3O62A 2J8PA 3C1CB 2Y2QA 1M1AD 1ULYA 3MGRD 5GXQC 2YFVA 3AZLB 3VH6W 5CPKB 5GXQD 4NE3A 1KX3C 5B24C 5B31C 1S32A 3A1KA 3X1VD 3MGPC 1P3IA 3VH5W 4R8PA 3UTAA 5B31A 3AV1C 2F8NA 5DNMD 3V9RA 4H9RA 3UT9B 3W99A 5F99A 4WNNA 3AZNB
chains in the Genus database with same CATH topology
2Y2JA 3NQUA 4CAYA 5F99C 3WAAD 3P5JB 1S32B 3O62C 4J8UC 4X23C 4XZQC 2G5HC 5B32B 3UT9A 4NFTA 3W99B 3R45B 3MGRC 1P3PB 2RIQA 2PYOC 5BNVB 4X23D 5AV8C 1P3LB 5B0YD 1P3BA 1P3MD 2NQBC 1HTAA 3TU4D 2CV5C 3EG5B 5AV8D 4X23B 3EPKA 3X1VB 1P3MC 3X1TB 1HQ3B 4YM6B 4Z5TD 5DNND 3MGQB 4JJNC 4NE6A 5AV9B 1KX5A 3X1UD 5AV5B 3WA9B 3WTPD 5B32G 1P34C 3LJAA 1Z2CB 5B2JD 1HQ3D 1F66C 3LELA 1ZLAA 5B33B 3X1SC 3MGPB 3B0CW 4YM6A 2LY8A 3MGQA 3AZKD 1ZLAC 1BH9A 2JSSA 5AV9A 1KX5B 5CPJC 3WKJD 5AV5A 3B6FD 5GT0B 2W8SA 4J8VB 2YFWB 5B0YB 4Z66C 2NZDB 1P3KD 1P3AD 1P3IB 4JJNA 1KX4A 2CV5B 1P3KB 3VH6A 5AV9D 4XUJC 4LD9C 3RELB 3REKC 1TZYA 3H0MC 5B1MC 5C3IC 5AVCC 1P3OC 5B40C 1AOIB 3B6GB 3MGRA 3VH5A 4WU9C 1P3GA 3AZMD 4UPKA 1TZYB 5B0ZA 5AVCB 1P3OB 2AROA 3AV2A 1P3BB 4KUDD 2CWEA 5CPID 3MGRB 1F1EA 2Y2NA 3AZHB 4X23A 1WWSA 5CPIA 3UTAC 3AV1A 2Y2KA 1ID3A 4H9NA 1WWIA 3KUYC 5B0ZD 3VH5T 5FUGB 3LJAD 5B0ZC 3B6GD 1P3GD 3AZLC 5B32D 3MNNC 4DQYB 5CPJB 3EPLA 3LELB 3MGSD 2Y2LA 3AV1B 4J8XB 3AZHC 5CPIC 1BH9B 3AZND 5B40A 3AN2D 3AZMC 3AZIA 3AV1D 5AVBB 3AV2C 5GSUD 2NZDA 1JFIB 4JJND 4XUJA 3W98B 5DNMB 4H9SA 5GSUB 4WV4B 3MVDB 3UT9D 1P3GC 3RELA 4WU9B 1BFMA 2Y2HA 2HIOC 4QLCB 3MGSA 3O62D 3B6GA 3KXBB 4QLCC 3WAAC 1TZYC 5F99D 1Q9CA 3AZJD 2FJ7C 3X1UB 3AFAD 4CSRB 2F8NK 4QLCD 3B6FC 5DNNB 5CP6A 4R8PD 2VQRA 4J8WB 3W98C 4XZQD 3B0DC 3MNNB 1P34A 5AY8C 4J8UD 3KWQB 2G5IC 1PZRA 5B1LA 4Z5TA 2HUEB 3AL0C 3KUYB 5AY8A 5B33D 3LZ1D 1M19B 1KX5C 4ZUXD 4J8WD 3MGPD 5B33C 4KGCB 1P3MA 4H9NB 1P34D 5JRGD 3LELC 1P3BC 2NQBA 1F66A 4EO5C 3W96C 5BS7C 2PYOA 5E5AC 2IO5B 2Y2MA 5JRGB 3C1CD 1P3AB 2PYOD 4H9OB 3A6NB 3AZKB 5GT3B 3LZ0C 4J8XA 3REHD 3AZEB 1KU5A 3A6ND 2ZY4A 3REJC 3WKJC 2PYOB 3AYWB 3LZ0D 5AV8A 3REHC 3UTAD 2Y2IA 3REID 4Z2MG 3LZ0B 4XZQA 4ZBJC 3REIB 1HQ3C 5GT3A 5DNNC 5B2IC 4Z66B 3UTBA 3AZLA 3C1BC 2ZY5A 3AZFB 1H3OB 5BNXB 3AYWA 3KSYA 3W97D 2Y2OA 2BYMA 3REKB 1KX3D 1ID3C 1KX4D 5DNNA 5CP6B 3REIA 3W99D 4J8WA 3AZGA 5B31B 1BH8B 1S32C 3TU4A 3A6NC 4WJ3C 1ID3D 4XUJD 4M6BA 4Z5TB 5B24A 3AZFA 4AWLB 4WNNB 2IO5C 5AY8B 1S32D 3REHA 4H9QB 1N1JA 4EO5B 4WU8B 5GXQA 1P3MB 1P3LD 2XD1A 4J8XC 2JE5A 5B2JA 5BO0A 4WU8C 5KDMB 1M19C 2Y2PA 5JRGA 3W97A 4WU8D 5E5AA 2BYKB 4G91C 5GSUC 3AZEA 5B31D 2JCHA 2YFVB 3X1VC 2L5AA 3AZNC 3V9RB 5KDMA 1W2EA 5AV8B 5B24D 1P3LC 3AZNA 3WKJB 3AFAA 3C1BB 3AZGD 4Z2MH 4XZQB 3X1SA 5B32C 3MNND 4R8PB 5E5AD 2F8NB 1P3FC 1A7WA 3A1IA 4H9RB 4HGAB 3UTBB 5B32A 3EPHA 4KHAA 1H3OA 5BNXA 4UUZB 3VH6T 3WA9D 3RELD 3UTBD 5BNVA 5C3IB 4CAYB 1P3LA 3AZMB 2F8ND 5B2JC 2CV5A 3AZEC 3LZ1C 1KX5D 3B0CT 5B24B 1P3PA 4KHAB 2DF4C 2NZDC 1U35D 4H9PB 5AV6A 4J8VC 5B2IB 3B0DB 3AZMA 5GXQB 4WU8A 4HGAC 4J8UA 5AVCD 3X1TA 5CPKD 1P3OD 3UTAB 5CP6D 3AYWD 3WAAB 3REKD 3AYWC 3WA9A 2AROB 3REJD 5GT0A 3W96D 3W99C 3WTPA 2YFWA 4H9PA 3NQUB 2F8NG 4NE5A 5B2IA 1P3KC 4YS3D 1TAFB 4Z66D 3AZFD 3MGPA 1P3IC 4JJNB 4J8WC 1U35A 1P3KA 5AVBD 2AROD 3X1TC 3X1UC 3R45A 5GT0C 5AV6C 4J8VA 1M18D 5AV5D 5B0YA 1P3BD 5B1MB 4J8XD 2DQNC 3WTPB 5B2ID 5B31G 3C1BA 3X1SB 1KX4B 1TAFA 1HQ3A 5GT3C 3AZJA 1P3GB 3IP4C 3FDDA 2HUEC 4UUZA 5CHLB 5AVCA 1P3OA 3KWQC 1AOIA 5B1MA 2Y2GA 3B0BA 1ZLAB 5DNMA 5B33A 4DRBA 1ID3B 3AZJB 4KGCC 3KXBC 1KX4C 3NQJA 4G92B 4E45A 1EQZC 5FUGA 4YM6D 3MGQD 2HIOB 5AV6B 5B40D 3AV2D 3AN2A 5G49B 4WU9D 2ZY3A 3KXBA 4J8UB 5CPJA 1EQZD 4YM6C 3MGQC 4CSRA 1AOID 1M1AA 3WAAA 3AFAC 5B40B 3B6GC 3KWQA 1P3FD 1T3UA 3LJAC 5B1LB 3AZIB 3AN2C 3AZLD 3MGSC 2HIOA 3KXBD 4G92C 1M19A 5JA4A 1JFIA 1TZYD 3AZJC 3W98A 4KGCA 1U35B 5GSUA 2NZDD 1M1AB 3KUYD 4J8VD 1M18A 4E44A 5B0ZB 4QLCA 3AZED 4AWLC 5AVBA 5JRGC 5CPKC 2HIOD 3AV2B 1AOIC 3W96B 5JA4B 4H9OA 3A6NA 3AZHA 1U35C 3UT9C 3MVDA 3C1CC 3AZKA 5CPIB 2XD5A 3WTPE 3RELC 3AZHD 2F2AC 3LELD 3MNNA 3MGSB 3WTPC 4YS3C 3WA9C 3AZFC 1KX3B 3WKJA 5B0YC 3TU4C 2NQBD 3KUYA 4ZUXC 3UTBC 2FJ7D 2BG1A 3X1UA 3REIC 3H0RC 3W98D 4R8PC 3NQJB 4ZUXA 2FJ7B 5AY8D 2NQBB 2RVQC 2FFFB 4YS3A 3AN2B 1P3PC 1KX3A 5G49A 4XUJB 3REJA 1B67A 3O62B 3AZKC 1ZLAD 3MVDC 3C1CA 5CPJD 4ZBJB 2ZM5A 4WU9A 3TU4B 1F66D 3H0LC 4KUDB 5AVBC 3X1TD 3MVDD 5CPKA 4YS3B 1R4VA 2AROC 2UWXA 5AV6D 3X1SD 1M18C 3LZ0A 3LZ1A 4LD9B 2RVQD 1P3PD 5B2JB 1M18B 1P3ID 1P34B 4Z66A 5B1MD 2CV5D 3EPJA 4KGCD 5F99B 1P3AC 4KUDA 3AZID 3W96A 4Z5TC 5BS7A 5E5AB 5AV9C 4LD9D 2BYMB 1B6WA 1M1AC 3REKA 3B6FB 3KFUG 3LZ1B 4LD9A 3KWQD 1P3FA 5CP6C 5GT3D 3C1BD 3AZGB 1BH8A 1F66B 4WZSB 3F6TA 3W97C 5B1LC 5BT1C 1EQZA 1P3AA 2F8NH 4KUDC 3AFAB 5AV5C 4H9QA 3X1VA 4DRAA 5B1LD 2ZY2A 5BT1D 5DNMC 3B6FA 1P3FB 4G91B 4ZUXB 2FJ7A 4H9SC 5BO0B 5GT0D 1M19D 3REHB 1EQZB 1N1JB 3W97B 3LJAB 3AZIC 3REJB 2BYKA 3AZGC 3O62A 2J8PA 3C1CB 2Y2QA 1M1AD 1ULYA 3MGRD 5GXQC 2YFVA 3AZLB 3VH6W 5CPKB 5GXQD 4NE3A 1KX3C 5B24C 5B31C 1S32A 3A1KA 3X1VD 3MGPC 1P3IA 3VH5W 4R8PA 3UTAA 5B31A 3AV1C 2F8NA 5DNMD 3V9RA 4H9RA 3UT9B 3W99A 5F99A 4WNNA 3AZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  4CAY A;  5F99 C;  3WAA D;  1S32 B;  3O62 C;  4J8U C;  4X23 C;  4XZQ C;  5B32 B;  3UT9 A;  4NFT A;  3W99 B;  3R45 B;  3MGR C;  1P3P B;  2PYO C;  5BNV B;  4X23 D;  5AV8 C;  1P3L B;  5B0Y D;  1P3B A;  1P3M D;  2NQB C;  1HTA A;  3TU4 D;  2CV5 C;  3X1V B;  5AV8 D;  4X23 B;  1P3M C;  3X1T B;  1HQ3 B;  4YM6 B;  4Z5T D;  5DNN D;  3MGQ B;  4JJN C;  4NE6 A;  5AV9 B;  1KX5 A;  3X1U D;  5AV5 B;  3WA9 B;  3WTP D;  5B32 G;  1P34 C;  3LJA A;  5B2J D;  1HQ3 D;  1F66 C;  3LEL A;  1ZLA A;  5B33 B;  3X1S C;  3MGP B;  3B0C W;  4YM6 A;  2LY8 A;  3MGQ A;  3AZK D;  1ZLA C;  1BH9 A;  2JSS A;  5AV9 A;  1KX5 B;  5CPJ C;  3WKJ D;  5AV5 A;  3B6F D;  5GT0 B;  4J8V B;  2YFW B;  5B0Y B;  4Z66 C;  2NZD B;  1P3K D;  1P3A D;  1P3I B;  4JJN A;  1KX4 A;  2CV5 B;  1P3K B;  3VH6 A;  5AV9 D;  4XUJ C;  4LD9 C;  3REL B;  3REK C;  1TZY A;  5B1M C;  5C3I C;  5AVC C;  1P3O C;  5B40 C;  1AOI B;  3B6G B;  3MGR A;  3VH5 A;  4WU9 C;  1P3G A;  3AZM D;  1TZY B;  5B0Z A;  5AVC B;  1P3O B;  2ARO A;  3AV2 A;  1P3B B;  4KUD D;  2CWE A;  5CPI D;  3MGR B;  1F1E A;  3AZH B;  4X23 A;  1WWS A;  5CPI A;  3UTA C;  3AV1 A;  1ID3 A;  4H9N A;  1WWI A;  3KUY C;  5B0Z D;  3VH5 T;  5FUG B;  3LJA D;  5B0Z C;  3B6G D;  1P3G D;  3AZL C;  5B32 D;  3MNN C;  5CPJ B;  3LEL B;  3MGS D;  3AV1 B;  4J8X B;  3AZH C;  5CPI C;  1BH9 B;  3AZN D;  5B40 A;  3AN2 D;  3AZM C;  3AZI A;  3AV1 D;  5AVB B;  3AV2 C;  5GSU D;  2NZD A;  1JFI B;  4JJN D;  4XUJ A;  3W98 B;  5DNM B;  4H9S A;  5GSU B;  4WV4 B;  3MVD B;  3UT9 D;  1P3G C;  3REL A;  4WU9 B;  1BFM A;  2HIO C;  4QLC B;  3MGS A;  3O62 D;  3B6G A;  3KXB B;  4QLC C;  3WAA C;  1TZY C;  5F99 D;  1Q9C A;  3AZJ D;  2FJ7 C;  3X1U B;  3AFA D;  4CSR B;  2F8N K;  4QLC D;  3B6F C;  5DNN B;  5CP6 A;  4R8P D;  4J8W B;  3W98 C;  4XZQ D;  3B0D C;  3MNN B;  1P34 A;  5AY8 C;  4J8U D;  3KWQ B;  5B1L A;  4Z5T A;  2HUE B;  3KUY B;  5AY8 A;  5B33 D;  3LZ1 D;  1M19 B;  1KX5 C;  4ZUX D;  4J8W D;  3MGP D;  5B33 C;  4KGC B;  1P3M A;  4H9N B;  1P34 D;  5JRG D;  3LEL C;  1P3B C;  2NQB A;  1F66 A;  4EO5 C;  3W96 C;  5BS7 C;  2PYO A;  5E5A C;  2IO5 B;  5JRG B;  3C1C D;  1P3A B;  2PYO D;  4H9O B;  3A6N B;  3AZK B;  5GT3 B;  3LZ0 C;  4J8X A;  3REH D;  3AZE B;  1KU5 A;  3A6N D;  3REJ C;  3WKJ C;  2PYO B;  3AYW B;  3LZ0 D;  5AV8 A;  3REH C;  3UTA D;  3REI D;  4Z2M G;  3LZ0 B;  4XZQ A;  4ZBJ C;  3REI B;  1HQ3 C;  5GT3 A;  5DNN C;  5B2I C;  4Z66 B;  3UTB A;  3AZL A;  3C1B C;  3AZF B;  1H3O B;  5BNX B;  3AYW A;  3KSY A;  3W97 D;  2BYM A;  3REK B;  1KX3 D;  1ID3 C;  1KX4 D;  5DNN A;  5CP6 B;  3REI A;  3W99 D;  4J8W A;  3AZG A;  5B31 B;  1BH8 B;  1S32 C;  3TU4 A;  3A6N C;  1ID3 D;  4XUJ D;  4M6B A;  4Z5T B;  5B24 A;  3AZF A;  4AWL B;  4WNN B;  2IO5 C;  5AY8 B;  1S32 D;  3REH A;  4H9Q B;  1N1J A;  4EO5 B;  4WU8 B;  5GXQ A;  1P3M B;  1P3L D;  4J8X C;  5B2J A;  5BO0 A;  4WU8 C;  5KDM B;  1M19 C;  5JRG A;  3W97 A;  4WU8 D;  5E5A A;  2BYK B;  4G91 C;  5GSU C;  3AZE A;  5B31 D;  2YFV B;  3X1V C;  2L5A A;  3AZN C;  3V9R B;  5KDM A;  5AV8 B;  5B24 D;  1P3L C;  3AZN A;  3WKJ B;  3AFA A;  3C1B B;  3AZG D;  4Z2M H;  4XZQ B;  3X1S A;  5B32 C;  3MNN D;  4R8P B;  5E5A D;  2F8N B;  1P3F C;  1A7W A;  4H9R B;  4HGA B;  3UTB B;  5B32 A;  4KHA A;  1H3O A;  5BNX A;  4UUZ B;  3VH6 T;  3WA9 D;  3REL D;  3UTB D;  5BNV A;  5C3I B;  4CAY B;  1P3L A;  3AZM B;  2F8N D;  5B2J C;  2CV5 A;  3AZE C;  3LZ1 C;  1KX5 D;  3B0C T;  5B24 B;  1P3P A;  4KHA B;  2NZD C;  1U35 D;  4H9P B;  5AV6 A;  4J8V C;  5B2I B;  3B0D B;  3AZM A;  5GXQ B;  4WU8 A;  4HGA C;  4J8U A;  5AVC D;  3X1T A;  5CPK D;  1P3O D;  3UTA B;  5CP6 D;  3AYW D;  3WAA B;  3REK D;  3AYW C;  3WA9 A;  2ARO B;  3REJ D;  5GT0 A;  3W96 D;  3W99 C;  3WTP A;  2YFW A;  4H9P A;  3NQU B;  2F8N G;  4NE5 A;  5B2I A;  1P3K C;  4YS3 D;  1TAF B;  4Z66 D;  3AZF D;  3MGP A;  1P3I C;  4JJN B;  4J8W C;  1U35 A;  1P3K A;  5AVB D;  2ARO D;  3X1T C;  3X1U C;  3R45 A;  5GT0 C;  5AV6 C;  4J8V A;  1M18 D;  5AV5 D;  5B0Y A;  1P3B D;  5B1M B;  4J8X D;  3WTP B;  5B2I D;  5B31 G;  3C1B A;  3X1S B;  1KX4 B;  1TAF A;  1HQ3 A;  5GT3 C;  3AZJ A;  1P3G B;  2HUE C;  4UUZ A;  5CHL B;  5AVC A;  1P3O A;  3KWQ C;  1AOI A;  5B1M A;  3B0B A;  1ZLA B;  5DNM A;  5B33 A;  4DRB A;  1ID3 B;  3AZJ B;  4KGC C;  3KXB C;  1KX4 C;  3NQJ A;  4G92 B;  4E45 A;  1EQZ C;  5FUG A;  4YM6 D;  3MGQ D;  2HIO B;  5AV6 B;  5B40 D;  3AV2 D;  3AN2 A;  5G49 B;  4WU9 D;  3KXB A;  4J8U B;  5CPJ A;  1EQZ D;  4YM6 C;  3MGQ C;  4CSR A;  1AOI D;  1M1A A;  3WAA A;  3AFA C;  5B40 B;  3B6G C;  3KWQ A;  1P3F D;  3LJA C;  5B1L B;  3AZI B;  3AN2 C;  3AZL D;  3MGS C;  2HIO A;  3KXB D;  4G92 C;  1M19 A;  5JA4 A;  1JFI A;  1TZY D;  3AZJ C;  3W98 A;  4KGC A;  1U35 B;  5GSU A;  2NZD D;  1M1A B;  3KUY D;  4J8V D;  1M18 A;  4E44 A;  5B0Z B;  4QLC A;  3AZE D;  4AWL C;  5AVB A;  5JRG C;  5CPK C;  2HIO D;  3AV2 B;  1AOI C;  3W96 B;  5JA4 B;  3A6N A;  4H9O A;  3AZH A;  1U35 C;  3UT9 C;  3MVD A;  3C1C C;  3AZK A;  5CPI B;  3WTP E;  3REL C;  3AZH D;  3LEL D;  3MNN A;  3MGS B;  3WTP C;  4YS3 C;  3WA9 C;  3AZF C;  1KX3 B;  3WKJ A;  5B0Y C;  3TU4 C;  2NQB D;  3KUY A;  4ZUX C;  3UTB C;  2FJ7 D;  3X1U A;  3REI C;  3W98 D;  4R8P C;  3NQJ B;  4ZUX A;  2FJ7 B;  5AY8 D;  2NQB B;  2RVQ C;  1P3P C;  4YS3 A;  3AN2 B;  1KX3 A;  5G49 A;  4XUJ B;  3REJ A;  1B67 A;  3O62 B;  3AZK C;  1ZLA D;  3MVD C;  3C1C A;  5CPJ D;  4ZBJ B;  4WU9 A;  3TU4 B;  1F66 D;  4KUD B;  5AVB C;  3X1T D;  3MVD D;  5CPK A;  4YS3 B;  1R4V A;  2ARO C;  5AV6 D;  3X1S D;  1M18 C;  3LZ0 A;  3LZ1 A;  4LD9 B;  2RVQ D;  1P3P D;  5B2J B;  1M18 B;  1P3I D;  1P34 B;  4Z66 A;  5B1M D;  2CV5 D;  4KGC D;  5F99 B;  1P3A C;  4KUD A;  3AZI D;  3W96 A;  4Z5T C;  5BS7 A;  5E5A B;  5AV9 C;  4LD9 D;  2BYM B;  1B6W A;  1M1A C;  3REK A;  3B6F B;  3LZ1 B;  4LD9 A;  3KWQ D;  1P3F A;  5CP6 C;  5GT3 D;  3C1B D;  3AZG B;  1BH8 A;  1F66 B;  4WZS B;  3W97 C;  5B1L C;  5BT1 C;  1EQZ A;  1P3A A;  2F8N H;  4KUD C;  3AFA B;  5AV5 C;  4H9Q A;  3X1V A;  4DRA A;  5B1L D;  5BT1 D;  5DNM C;  3B6F A;  1P3F B;  4G91 B;  4ZUX B;  2FJ7 A;  4H9S C;  5BO0 B;  5GT0 D;  1M19 D;  3REH B;  1EQZ B;  1N1J B;  3W97 B;  3LJA B;  3AZI C;  3REJ B;  2BYK A;  3AZG C;  3O62 A;  3C1C B;  1M1A D;  1ULY A;  3MGR D;  5GXQ C;  2YFV A;  3AZL B;  3VH6 W;  5CPK B;  5GXQ D;  4NE3 A;  1KX3 C;  5B24 C;  5B31 C;  1S32 A;  3X1V D;  3MGP C;  1P3I A;  3VH5 W;  4R8P A;  3UTA A;  5B31 A;  3AV1 C;  2F8N A;  5DNM D;  3V9R A;  4H9R A;  3UT9 B;  3W99 A;  5F99 A;  4WNN A;  3AZN B; 
#chains in the Genus database with same CATH topology
 2Y2J A;  3NQU A;  4CAY A;  5F99 C;  3WAA D;  3P5J B;  1S32 B;  3O62 C;  4J8U C;  4X23 C;  4XZQ C;  2G5H C;  5B32 B;  3UT9 A;  4NFT A;  3W99 B;  3R45 B;  3MGR C;  1P3P B;  2RIQ A;  2PYO C;  5BNV B;  4X23 D;  5AV8 C;  1P3L B;  5B0Y D;  1P3B A;  1P3M D;  2NQB C;  1HTA A;  3TU4 D;  2CV5 C;  3EG5 B;  5AV8 D;  4X23 B;  3EPK A;  3X1V B;  1P3M C;  3X1T B;  1HQ3 B;  4YM6 B;  4Z5T D;  5DNN D;  3MGQ B;  4JJN C;  4NE6 A;  5AV9 B;  1KX5 A;  3X1U D;  5AV5 B;  3WA9 B;  3WTP D;  5B32 G;  1P34 C;  3LJA A;  1Z2C B;  5B2J D;  1HQ3 D;  1F66 C;  3LEL A;  1ZLA A;  5B33 B;  3X1S C;  3MGP B;  3B0C W;  4YM6 A;  2LY8 A;  3MGQ A;  3AZK D;  1ZLA C;  1BH9 A;  2JSS A;  5AV9 A;  1KX5 B;  5CPJ C;  3WKJ D;  5AV5 A;  3B6F D;  5GT0 B;  2W8S A;  4J8V B;  2YFW B;  5B0Y B;  4Z66 C;  2NZD B;  1P3K D;  1P3A D;  1P3I B;  4JJN A;  1KX4 A;  2CV5 B;  1P3K B;  3VH6 A;  5AV9 D;  4XUJ C;  4LD9 C;  3REL B;  3REK C;  1TZY A;  3H0M C;  5B1M C;  5C3I C;  5AVC C;  1P3O C;  5B40 C;  1AOI B;  3B6G B;  3MGR A;  3VH5 A;  4WU9 C;  1P3G A;  3AZM D;  4UPK A;  1TZY B;  5B0Z A;  5AVC B;  1P3O B;  2ARO A;  3AV2 A;  1P3B B;  4KUD D;  2CWE A;  5CPI D;  3MGR B;  1F1E A;  2Y2N A;  3AZH B;  4X23 A;  1WWS A;  5CPI A;  3UTA C;  3AV1 A;  2Y2K A;  1ID3 A;  4H9N A;  1WWI A;  3KUY C;  5B0Z D;  3VH5 T;  5FUG B;  3LJA D;  5B0Z C;  3B6G D;  1P3G D;  3AZL C;  5B32 D;  3MNN C;  4DQY B;  5CPJ B;  3EPL A;  3LEL B;  3MGS D;  2Y2L A;  3AV1 B;  4J8X B;  3AZH C;  5CPI C;  1BH9 B;  3AZN D;  5B40 A;  3AN2 D;  3AZM C;  3AZI A;  3AV1 D;  5AVB B;  3AV2 C;  5GSU D;  2NZD A;  1JFI B;  4JJN D;  4XUJ A;  3W98 B;  5DNM B;  4H9S A;  5GSU B;  4WV4 B;  3MVD B;  3UT9 D;  1P3G C;  3REL A;  4WU9 B;  1BFM A;  2Y2H A;  2HIO C;  4QLC B;  3MGS A;  3O62 D;  3B6G A;  3KXB B;  4QLC C;  3WAA C;  1TZY C;  5F99 D;  1Q9C A;  3AZJ D;  2FJ7 C;  3X1U B;  3AFA D;  4CSR B;  2F8N K;  4QLC D;  3B6F C;  5DNN B;  5CP6 A;  4R8P D;  2VQR A;  4J8W B;  3W98 C;  4XZQ D;  3B0D C;  3MNN B;  1P34 A;  5AY8 C;  4J8U D;  3KWQ B;  2G5I C;  1PZR A;  5B1L A;  4Z5T A;  2HUE B;  3AL0 C;  3KUY B;  5AY8 A;  5B33 D;  3LZ1 D;  1M19 B;  1KX5 C;  4ZUX D;  4J8W D;  3MGP D;  5B33 C;  4KGC B;  1P3M A;  4H9N B;  1P34 D;  5JRG D;  3LEL C;  1P3B C;  2NQB A;  1F66 A;  4EO5 C;  3W96 C;  5BS7 C;  2PYO A;  5E5A C;  2IO5 B;  2Y2M A;  5JRG B;  3C1C D;  1P3A B;  2PYO D;  4H9O B;  3A6N B;  3AZK B;  5GT3 B;  3LZ0 C;  4J8X A;  3REH D;  3AZE B;  1KU5 A;  3A6N D;  2ZY4 A;  3REJ C;  3WKJ C;  2PYO B;  3AYW B;  3LZ0 D;  5AV8 A;  3REH C;  3UTA D;  2Y2I A;  3REI D;  4Z2M G;  3LZ0 B;  4XZQ A;  4ZBJ C;  3REI B;  1HQ3 C;  5GT3 A;  5DNN C;  5B2I C;  4Z66 B;  3UTB A;  3AZL A;  3C1B C;  2ZY5 A;  3AZF B;  1H3O B;  5BNX B;  3AYW A;  3KSY A;  3W97 D;  2Y2O A;  2BYM A;  3REK B;  1KX3 D;  1ID3 C;  1KX4 D;  5DNN A;  5CP6 B;  3REI A;  3W99 D;  4J8W A;  3AZG A;  5B31 B;  1BH8 B;  1S32 C;  3TU4 A;  3A6N C;  4WJ3 C;  1ID3 D;  4XUJ D;  4M6B A;  4Z5T B;  5B24 A;  3AZF A;  4AWL B;  4WNN B;  2IO5 C;  5AY8 B;  1S32 D;  3REH A;  4H9Q B;  1N1J A;  4EO5 B;  4WU8 B;  5GXQ A;  1P3M B;  1P3L D;  2XD1 A;  4J8X C;  2JE5 A;  5B2J A;  5BO0 A;  4WU8 C;  5KDM B;  1M19 C;  2Y2P A;  5JRG A;  3W97 A;  4WU8 D;  5E5A A;  2BYK B;  4G91 C;  5GSU C;  3AZE A;  5B31 D;  2JCH A;  2YFV B;  3X1V C;  2L5A A;  3AZN C;  3V9R B;  5KDM A;  1W2E A;  5AV8 B;  5B24 D;  1P3L C;  3AZN A;  3WKJ B;  3AFA A;  3C1B B;  3AZG D;  4Z2M H;  4XZQ B;  3X1S A;  5B32 C;  3MNN D;  4R8P B;  5E5A D;  2F8N B;  1P3F C;  1A7W A;  3A1I A;  4H9R B;  4HGA B;  3UTB B;  5B32 A;  3EPH A;  4KHA A;  1H3O A;  5BNX A;  4UUZ B;  3VH6 T;  3WA9 D;  3REL D;  3UTB D;  5BNV A;  5C3I B;  4CAY B;  1P3L A;  3AZM B;  2F8N D;  5B2J C;  2CV5 A;  3AZE C;  3LZ1 C;  1KX5 D;  3B0C T;  5B24 B;  1P3P A;  4KHA B;  2DF4 C;  2NZD C;  1U35 D;  4H9P B;  5AV6 A;  4J8V C;  5B2I B;  3B0D B;  3AZM A;  5GXQ B;  4WU8 A;  4HGA C;  4J8U A;  5AVC D;  3X1T A;  5CPK D;  1P3O D;  3UTA B;  5CP6 D;  3AYW D;  3WAA B;  3REK D;  3AYW C;  3WA9 A;  2ARO B;  3REJ D;  5GT0 A;  3W96 D;  3W99 C;  3WTP A;  2YFW A;  4H9P A;  3NQU B;  2F8N G;  4NE5 A;  5B2I A;  1P3K C;  4YS3 D;  1TAF B;  4Z66 D;  3AZF D;  3MGP A;  1P3I C;  4JJN B;  4J8W C;  1U35 A;  1P3K A;  5AVB D;  2ARO D;  3X1T C;  3X1U C;  3R45 A;  5GT0 C;  5AV6 C;  4J8V A;  1M18 D;  5AV5 D;  5B0Y A;  1P3B D;  5B1M B;  4J8X D;  2DQN C;  3WTP B;  5B2I D;  5B31 G;  3C1B A;  3X1S B;  1KX4 B;  1TAF A;  1HQ3 A;  5GT3 C;  3AZJ A;  1P3G B;  3IP4 C;  3FDD A;  2HUE C;  4UUZ A;  5CHL B;  5AVC A;  1P3O A;  3KWQ C;  1AOI A;  5B1M A;  2Y2G A;  3B0B A;  1ZLA B;  5DNM A;  5B33 A;  4DRB A;  1ID3 B;  3AZJ B;  4KGC C;  3KXB C;  1KX4 C;  3NQJ A;  4G92 B;  4E45 A;  1EQZ C;  5FUG A;  4YM6 D;  3MGQ D;  2HIO B;  5AV6 B;  5B40 D;  3AV2 D;  3AN2 A;  5G49 B;  4WU9 D;  2ZY3 A;  3KXB A;  4J8U B;  5CPJ A;  1EQZ D;  4YM6 C;  3MGQ C;  4CSR A;  1AOI D;  1M1A A;  3WAA A;  3AFA C;  5B40 B;  3B6G C;  3KWQ A;  1P3F D;  1T3U A;  3LJA C;  5B1L B;  3AZI B;  3AN2 C;  3AZL D;  3MGS C;  2HIO A;  3KXB D;  4G92 C;  1M19 A;  5JA4 A;  1JFI A;  1TZY D;  3AZJ C;  3W98 A;  4KGC A;  1U35 B;  5GSU A;  2NZD D;  1M1A B;  3KUY D;  4J8V D;  1M18 A;  4E44 A;  5B0Z B;  4QLC A;  3AZE D;  4AWL C;  5AVB A;  5JRG C;  5CPK C;  2HIO D;  3AV2 B;  1AOI C;  3W96 B;  5JA4 B;  4H9O A;  3A6N A;  3AZH A;  1U35 C;  3UT9 C;  3MVD A;  3C1C C;  3AZK A;  5CPI B;  2XD5 A;  3WTP E;  3REL C;  3AZH D;  2F2A C;  3LEL D;  3MNN A;  3MGS B;  3WTP C;  4YS3 C;  3WA9 C;  3AZF C;  1KX3 B;  3WKJ A;  5B0Y C;  3TU4 C;  2NQB D;  3KUY A;  4ZUX C;  3UTB C;  2FJ7 D;  2BG1 A;  3X1U A;  3REI C;  3H0R C;  3W98 D;  4R8P C;  3NQJ B;  4ZUX A;  2FJ7 B;  5AY8 D;  2NQB B;  2RVQ C;  2FFF B;  4YS3 A;  3AN2 B;  1P3P C;  1KX3 A;  5G49 A;  4XUJ B;  3REJ A;  1B67 A;  3O62 B;  3AZK C;  1ZLA D;  3MVD C;  3C1C A;  5CPJ D;  4ZBJ B;  2ZM5 A;  4WU9 A;  3TU4 B;  1F66 D;  3H0L C;  4KUD B;  5AVB C;  3X1T D;  3MVD D;  5CPK A;  4YS3 B;  1R4V A;  2ARO C;  2UWX A;  5AV6 D;  3X1S D;  1M18 C;  3LZ0 A;  3LZ1 A;  4LD9 B;  2RVQ D;  1P3P D;  5B2J B;  1M18 B;  1P3I D;  1P34 B;  4Z66 A;  5B1M D;  2CV5 D;  3EPJ A;  4KGC D;  5F99 B;  1P3A C;  4KUD A;  3AZI D;  3W96 A;  4Z5T C;  5BS7 A;  5E5A B;  5AV9 C;  4LD9 D;  2BYM B;  1B6W A;  1M1A C;  3REK A;  3B6F B;  3KFU G;  3LZ1 B;  4LD9 A;  3KWQ D;  1P3F A;  5CP6 C;  5GT3 D;  3C1B D;  3AZG B;  1BH8 A;  1F66 B;  4WZS B;  3F6T A;  3W97 C;  5B1L C;  5BT1 C;  1EQZ A;  1P3A A;  2F8N H;  4KUD C;  3AFA B;  5AV5 C;  4H9Q A;  3X1V A;  4DRA A;  5B1L D;  2ZY2 A;  5BT1 D;  5DNM C;  3B6F A;  1P3F B;  4G91 B;  4ZUX B;  2FJ7 A;  4H9S C;  5BO0 B;  5GT0 D;  1M19 D;  3REH B;  1EQZ B;  1N1J B;  3W97 B;  3LJA B;  3AZI C;  3REJ B;  2BYK A;  3AZG C;  3O62 A;  2J8P A;  3C1C B;  2Y2Q A;  1M1A D;  1ULY A;  3MGR D;  5GXQ C;  2YFV A;  3AZL B;  3VH6 W;  5CPK B;  5GXQ D;  4NE3 A;  1KX3 C;  5B24 C;  5B31 C;  1S32 A;  3A1K A;  3X1V D;  3MGP C;  1P3I A;  3VH5 W;  4R8P A;  3UTA A;  5B31 A;  3AV1 C;  2F8N A;  5DNM D;  3V9R A;  4H9R A;  3UT9 B;  3W99 A;  5F99 A;  4WNN A;  3AZN B; 
#chains in the Genus database with same CATH homology
 2Y2J A;  3NQU A;  4CAY A;  5F99 C;  3WAA D;  3P5J B;  1S32 B;  3O62 C;  4J8U C;  4X23 C;  4XZQ C;  2G5H C;  5B32 B;  3UT9 A;  4NFT A;  3W99 B;  3R45 B;  3MGR C;  1P3P B;  2RIQ A;  2PYO C;  5BNV B;  4X23 D;  5AV8 C;  1P3L B;  5B0Y D;  1P3B A;  1P3M D;  2NQB C;  1HTA A;  3TU4 D;  2CV5 C;  3EG5 B;  5AV8 D;  4X23 B;  3EPK A;  3X1V B;  1P3M C;  3X1T B;  1HQ3 B;  4YM6 B;  4Z5T D;  5DNN D;  3MGQ B;  4JJN C;  4NE6 A;  5AV9 B;  1KX5 A;  3X1U D;  5AV5 B;  3WA9 B;  3WTP D;  5B32 G;  1P34 C;  3LJA A;  1Z2C B;  5B2J D;  1HQ3 D;  1F66 C;  3LEL A;  1ZLA A;  5B33 B;  3X1S C;  3MGP B;  3B0C W;  4YM6 A;  2LY8 A;  3MGQ A;  3AZK D;  1ZLA C;  1BH9 A;  2JSS A;  5AV9 A;  1KX5 B;  5CPJ C;  3WKJ D;  5AV5 A;  3B6F D;  5GT0 B;  2W8S A;  4J8V B;  2YFW B;  5B0Y B;  4Z66 C;  2NZD B;  1P3K D;  1P3A D;  1P3I B;  4JJN A;  1KX4 A;  2CV5 B;  1P3K B;  3VH6 A;  5AV9 D;  4XUJ C;  4LD9 C;  3REL B;  3REK C;  1TZY A;  3H0M C;  5B1M C;  5C3I C;  5AVC C;  1P3O C;  5B40 C;  1AOI B;  3B6G B;  3MGR A;  3VH5 A;  4WU9 C;  1P3G A;  3AZM D;  4UPK A;  1TZY B;  5B0Z A;  5AVC B;  1P3O B;  2ARO A;  3AV2 A;  1P3B B;  4KUD D;  2CWE A;  5CPI D;  3MGR B;  1F1E A;  2Y2N A;  3AZH B;  4X23 A;  1WWS A;  5CPI A;  3UTA C;  3AV1 A;  2Y2K A;  1ID3 A;  4H9N A;  1WWI A;  3KUY C;  5B0Z D;  3VH5 T;  5FUG B;  3LJA D;  5B0Z C;  3B6G D;  1P3G D;  3AZL C;  5B32 D;  3MNN C;  4DQY B;  5CPJ B;  3EPL A;  3LEL B;  3MGS D;  2Y2L A;  3AV1 B;  4J8X B;  3AZH C;  5CPI C;  1BH9 B;  3AZN D;  5B40 A;  3AN2 D;  3AZM C;  3AZI A;  3AV1 D;  5AVB B;  3AV2 C;  5GSU D;  2NZD A;  1JFI B;  4JJN D;  4XUJ A;  3W98 B;  5DNM B;  4H9S A;  5GSU B;  4WV4 B;  3MVD B;  3UT9 D;  1P3G C;  3REL A;  4WU9 B;  1BFM A;  2Y2H A;  2HIO C;  4QLC B;  3MGS A;  3O62 D;  3B6G A;  3KXB B;  4QLC C;  3WAA C;  1TZY C;  5F99 D;  1Q9C A;  3AZJ D;  2FJ7 C;  3X1U B;  3AFA D;  4CSR B;  2F8N K;  4QLC D;  3B6F C;  5DNN B;  5CP6 A;  4R8P D;  2VQR A;  4J8W B;  3W98 C;  4XZQ D;  3B0D C;  3MNN B;  1P34 A;  5AY8 C;  4J8U D;  3KWQ B;  2G5I C;  1PZR A;  5B1L A;  4Z5T A;  2HUE B;  3AL0 C;  3KUY B;  5AY8 A;  5B33 D;  3LZ1 D;  1M19 B;  1KX5 C;  4ZUX D;  4J8W D;  3MGP D;  5B33 C;  4KGC B;  1P3M A;  4H9N B;  1P34 D;  5JRG D;  3LEL C;  1P3B C;  2NQB A;  1F66 A;  4EO5 C;  3W96 C;  5BS7 C;  2PYO A;  5E5A C;  2IO5 B;  2Y2M A;  5JRG B;  3C1C D;  1P3A B;  2PYO D;  4H9O B;  3A6N B;  3AZK B;  5GT3 B;  3LZ0 C;  4J8X A;  3REH D;  3AZE B;  1KU5 A;  3A6N D;  2ZY4 A;  3REJ C;  3WKJ C;  2PYO B;  3AYW B;  3LZ0 D;  5AV8 A;  3REH C;  3UTA D;  2Y2I A;  3REI D;  4Z2M G;  3LZ0 B;  4XZQ A;  4ZBJ C;  3REI B;  1HQ3 C;  5GT3 A;  5DNN C;  5B2I C;  4Z66 B;  3UTB A;  3AZL A;  3C1B C;  2ZY5 A;  3AZF B;  1H3O B;  5BNX B;  3AYW A;  3KSY A;  3W97 D;  2Y2O A;  2BYM A;  3REK B;  1KX3 D;  1ID3 C;  1KX4 D;  5DNN A;  5CP6 B;  3REI A;  3W99 D;  4J8W A;  3AZG A;  5B31 B;  1BH8 B;  1S32 C;  3TU4 A;  3A6N C;  4WJ3 C;  1ID3 D;  4XUJ D;  4M6B A;  4Z5T B;  5B24 A;  3AZF A;  4AWL B;  4WNN B;  2IO5 C;  5AY8 B;  1S32 D;  3REH A;  4H9Q B;  1N1J A;  4EO5 B;  4WU8 B;  5GXQ A;  1P3M B;  1P3L D;  2XD1 A;  4J8X C;  2JE5 A;  5B2J A;  5BO0 A;  4WU8 C;  5KDM B;  1M19 C;  2Y2P A;  5JRG A;  3W97 A;  4WU8 D;  5E5A A;  2BYK B;  4G91 C;  5GSU C;  3AZE A;  5B31 D;  2JCH A;  2YFV B;  3X1V C;  2L5A A;  3AZN C;  3V9R B;  5KDM A;  1W2E A;  5AV8 B;  5B24 D;  1P3L C;  3AZN A;  3WKJ B;  3AFA A;  3C1B B;  3AZG D;  4Z2M H;  4XZQ B;  3X1S A;  5B32 C;  3MNN D;  4R8P B;  5E5A D;  2F8N B;  1P3F C;  1A7W A;  3A1I A;  4H9R B;  4HGA B;  3UTB B;  5B32 A;  3EPH A;  4KHA A;  1H3O A;  5BNX A;  4UUZ B;  3VH6 T;  3WA9 D;  3REL D;  3UTB D;  5BNV A;  5C3I B;  4CAY B;  1P3L A;  3AZM B;  2F8N D;  5B2J C;  2CV5 A;  3AZE C;  3LZ1 C;  1KX5 D;  3B0C T;  5B24 B;  1P3P A;  4KHA B;  2DF4 C;  2NZD C;  1U35 D;  4H9P B;  5AV6 A;  4J8V C;  5B2I B;  3B0D B;  3AZM A;  5GXQ B;  4WU8 A;  4HGA C;  4J8U A;  5AVC D;  3X1T A;  5CPK D;  1P3O D;  3UTA B;  5CP6 D;  3AYW D;  3WAA B;  3REK D;  3AYW C;  3WA9 A;  2ARO B;  3REJ D;  5GT0 A;  3W96 D;  3W99 C;  3WTP A;  2YFW A;  4H9P A;  3NQU B;  2F8N G;  4NE5 A;  5B2I A;  1P3K C;  4YS3 D;  1TAF B;  4Z66 D;  3AZF D;  3MGP A;  1P3I C;  4JJN B;  4J8W C;  1U35 A;  1P3K A;  5AVB D;  2ARO D;  3X1T C;  3X1U C;  3R45 A;  5GT0 C;  5AV6 C;  4J8V A;  1M18 D;  5AV5 D;  5B0Y A;  1P3B D;  5B1M B;  4J8X D;  2DQN C;  3WTP B;  5B2I D;  5B31 G;  3C1B A;  3X1S B;  1KX4 B;  1TAF A;  1HQ3 A;  5GT3 C;  3AZJ A;  1P3G B;  3IP4 C;  3FDD A;  2HUE C;  4UUZ A;  5CHL B;  5AVC A;  1P3O A;  3KWQ C;  1AOI A;  5B1M A;  2Y2G A;  3B0B A;  1ZLA B;  5DNM A;  5B33 A;  4DRB A;  1ID3 B;  3AZJ B;  4KGC C;  3KXB C;  1KX4 C;  3NQJ A;  4G92 B;  4E45 A;  1EQZ C;  5FUG A;  4YM6 D;  3MGQ D;  2HIO B;  5AV6 B;  5B40 D;  3AV2 D;  3AN2 A;  5G49 B;  4WU9 D;  2ZY3 A;  3KXB A;  4J8U B;  5CPJ A;  1EQZ D;  4YM6 C;  3MGQ C;  4CSR A;  1AOI D;  1M1A A;  3WAA A;  3AFA C;  5B40 B;  3B6G C;  3KWQ A;  1P3F D;  1T3U A;  3LJA C;  5B1L B;  3AZI B;  3AN2 C;  3AZL D;  3MGS C;  2HIO A;  3KXB D;  4G92 C;  1M19 A;  5JA4 A;  1JFI A;  1TZY D;  3AZJ C;  3W98 A;  4KGC A;  1U35 B;  5GSU A;  2NZD D;  1M1A B;  3KUY D;  4J8V D;  1M18 A;  4E44 A;  5B0Z B;  4QLC A;  3AZE D;  4AWL C;  5AVB A;  5JRG C;  5CPK C;  2HIO D;  3AV2 B;  1AOI C;  3W96 B;  5JA4 B;  4H9O A;  3A6N A;  3AZH A;  1U35 C;  3UT9 C;  3MVD A;  3C1C C;  3AZK A;  5CPI B;  2XD5 A;  3WTP E;  3REL C;  3AZH D;  2F2A C;  3LEL D;  3MNN A;  3MGS B;  3WTP C;  4YS3 C;  3WA9 C;  3AZF C;  1KX3 B;  3WKJ A;  5B0Y C;  3TU4 C;  2NQB D;  3KUY A;  4ZUX C;  3UTB C;  2FJ7 D;  2BG1 A;  3X1U A;  3REI C;  3H0R C;  3W98 D;  4R8P C;  3NQJ B;  4ZUX A;  2FJ7 B;  5AY8 D;  2NQB B;  2RVQ C;  2FFF B;  4YS3 A;  3AN2 B;  1P3P C;  1KX3 A;  5G49 A;  4XUJ B;  3REJ A;  1B67 A;  3O62 B;  3AZK C;  1ZLA D;  3MVD C;  3C1C A;  5CPJ D;  4ZBJ B;  2ZM5 A;  4WU9 A;  3TU4 B;  1F66 D;  3H0L C;  4KUD B;  5AVB C;  3X1T D;  3MVD D;  5CPK A;  4YS3 B;  1R4V A;  2ARO C;  2UWX A;  5AV6 D;  3X1S D;  1M18 C;  3LZ0 A;  3LZ1 A;  4LD9 B;  2RVQ D;  1P3P D;  5B2J B;  1M18 B;  1P3I D;  1P34 B;  4Z66 A;  5B1M D;  2CV5 D;  3EPJ A;  4KGC D;  5F99 B;  1P3A C;  4KUD A;  3AZI D;  3W96 A;  4Z5T C;  5BS7 A;  5E5A B;  5AV9 C;  4LD9 D;  2BYM B;  1B6W A;  1M1A C;  3REK A;  3B6F B;  3KFU G;  3LZ1 B;  4LD9 A;  3KWQ D;  1P3F A;  5CP6 C;  5GT3 D;  3C1B D;  3AZG B;  1BH8 A;  1F66 B;  4WZS B;  3F6T A;  3W97 C;  5B1L C;  5BT1 C;  1EQZ A;  1P3A A;  2F8N H;  4KUD C;  3AFA B;  5AV5 C;  4H9Q A;  3X1V A;  4DRA A;  5B1L D;  2ZY2 A;  5BT1 D;  5DNM C;  3B6F A;  1P3F B;  4G91 B;  4ZUX B;  2FJ7 A;  4H9S C;  5BO0 B;  5GT0 D;  1M19 D;  3REH B;  1EQZ B;  1N1J B;  3W97 B;  3LJA B;  3AZI C;  3REJ B;  2BYK A;  3AZG C;  3O62 A;  2J8P A;  3C1C B;  2Y2Q A;  1M1A D;  1ULY A;  3MGR D;  5GXQ C;  2YFV A;  3AZL B;  3VH6 W;  5CPK B;  5GXQ D;  4NE3 A;  1KX3 C;  5B24 C;  5B31 C;  1S32 A;  3A1K A;  3X1V D;  3MGP C;  1P3I A;  3VH5 W;  4R8P A;  3UTA A;  5B31 A;  3AV1 C;  2F8N A;  5DNM D;  3V9R A;  4H9R A;  3UT9 B;  3W99 A;  5F99 A;  4WNN A;  3AZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...