3MGSA

Binding of cesium ions to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsA00
4KHAB 3RELC 3TU4B 3MGQD 1KX4D 4XZQD 5BS7A 2RVQC 3WTPD 1P3FD 4XUJD 1BH8A 5B2JB 1P3LD 3AYWC 1H3OB 5E5AA 3LJAC 3AZJB 1M1AB 3MGRC 3MVDD 2AROD 5B1MD 4G92B 3O62A 1M18D 1ULYA 4G91B 1HTAA 3WA9B 5B32A 1S32D 3W97C 4WU9B 3VH6A 2BYMB 1P3MA 5AVBC 3X1VB 4H9OB 5DNMA 3NQJB 5CPIA 1KX3B 4KUDD 2F8ND 3AV2B 3W96B 2IO5C 4UUZA 5B0YD 1HQ3B 3C1CD 5CPJD 3AFAC 3W99B 3KXBB 4J8XA 4Z5TB 1M19B 4LD9B 3MNNC 5DNNB 5B0ZA 5AV6D 3MGPA 5GXQA 3AZEA 3AZGB 1EQZB 3REJD 3A6NC 4Z66B 3TU4C 1JFIB 3AZMA 4H9RB 1P34C 5B24B 5B31D 3UTBA 4NFTA 1ZLAB 5AY8D 5AV8B 5CP6D 2NQBD 3WAAC 4JJNA 5B2JC 1P3BB 5GT3C 2YFWA 5B40D 3KUYA 3AZHD 3AV1D 1M1AC 1U35B 1F66A 3AZIA 3WKJC 2PYOD 5JA4B 1TZYC 5AVCD 5KDMA 3W98C 4WU9C 5B1LA 5G49B 1KX3C 4J8VB 5BS7C 4YS3A 3MGQB 5GT0A 3KWQC 3R45A 4XZQB 3RELA 1KX4B 1HQ3C 3WTPB 5GSUD 1P3FB 1BH9A 5AV5D 3AZFD 4Z5TC 4XUJB 1ID3C 3O62C 1P3GD 4Z66C 3MVDB 4QLCA 3AYWA 2AROB 5B1MB 5B2IA 1M18B 3MGRA 1S32B 5C3IB 5AV8C 3W97A 3LZ0A 3C1BC 4KUDB 1P3BC 1KX5D 3W96D 3REIA 5AVBA 3REHC 1U35C 3B0CT 5B0YB 4CSRB 5B0ZC 3AZEC 5GXQC 3C1CB 3LZ1D 4J8UA 5BT1C 3REKC 3AFAA 3UTAD 5AV6B 3AN2C 3VH5W 4J8VC 3REJB 3MNNA 3LELD 4KGCD 4CAYB 4KHAA 4XZQC 3X1UB 3A6NA 1KX4C 5BNVB 3TU4A 1P3FC 5B31B 3X1SB 5AY8B 5CP6B 2NQBB 4YM6B 1TAFB 3UT9D 5F99D 2CV5D 1P3LC 5B40B 3B0BA 3AZHB 3AV1B 4Z2MG 1P3OD 5B2JA 4H9PB 3MVDC 2AROC 2PYOB 4EO5B 1M1AA 1P3ID 1P3AD 1M18C 3WKJA 5C3IC 1TZYA 3WA9A 3W98A 4WU9A 3B6GD 4KUDC 2BYMA 4AWLB 3X1VA 4H9OA 3NQJA 1KX3A 4WZSB 5B0YC 2BYKB 3AV2A 5AV9D 5GSUB 3KWQA 5CPJC 5B33D 5AV5B 1P3KD 1HQ3A 3AZFB 4QLCC 3W99A 5B2IC 3KXBA 4Z5TA 1ID3A 1P3GB 4LD9A 5DNNA 3AZGA 1EQZA 2F8NH 3AZMD 4Z66A 3LZ0C 1JFIA 1AOID 4H9RA 3VH5A 5AY8C 2NQBC 3REIC 3B0CW 5B24A 1ZLAA 5AV8A 4NE5A 1KX5B 3C1BA 3AV1C 3AZHC 5JRGC 1P3BA 4J8UC 4J8WD 3REHA 1F66D 1U35A 5AVCC 3X1TD 3LZ1B 5JA4A 5BO0B 3KSYA 4WU8C 3UTAB 3AZND 3REKA 5G49A 3AN2A 3AZLD 3X1UD 1A7WA 3LELB 4J8VA 4KGCB 3X1SD 5GT0D 3MGQA 3RELD 5GSUC 1N1JB 2LY8A 3B0DB 1KX4A 4XZQA 4X23D 4YM6D 5AV5C 3WTPA 3AZFC 1P3FA 5BNXB 4ZUXD 3UT9B 5F99B 2CV5B 3AZJC 4XUJA 1P3GC 1P3PD 1P3OB 4G92C 1P3LA 4G91C 3WA9C 1P3AB 1P3IB 3LJAD 3MVDA 2AROA 5B1MA 3MGRD 3B6FD 4ZBJB 5B32B 1M18A 3X1VC 3NQUB 1S32A 4M6BA 3B6GB 3W96C 3AV2C 1KX5C 1KU5A 3VH6T 4KUDA 5CPKD 2FJ7D 2F8NA 1WWSA 5AV9B 3W99C 3KXBC 5B0YA 1M19C 4LD9C 5B33B 3LZ1C 1P3KB 5DNNC 1B67A 4CSRA 3AZGC 4H9SA 3C1CA 5CPJA 1EQZC 3V9RB 1F1EA 5AV6A 3MNND 3LELC 4KGCC 2NZDD 3REJA 3AZMB 5B24C 1ZLAC 1AOIB 4CAYA 3B0DC 5B31A 1P34D 3AZKD 5AY8A 5CP6A 3UT9C 2NQBA 5F99C 4JJNB 3MGSD 2HIOD 1TAFA 3WAAD 5GT3D 5B40A 4J8WB 3AZHA 3AV1A 1P3AC 1F66B 4H9PA 5JRGA 3X1TB 2PYOA 4R8PD 4ZBJC 5KDMB 5B1LB 5AVCA 1TZYD 5FUGB 3B6GC 3AZNB 3W98D 4WU8A 3MGQC 2HUEB 3AZLB 3WTPC 5GT0B 2L5AA 3R45B 5AV9C 3RELB 2BYKA 4WNNB 4E44A 4NE3A 4XUJC 4X23B 1P3KC 5GSUA 4H9QB 4ZUXB 5AV5A 3AZFA 4H9NB 5E5AD 1P3PB 1H3OA 5B1MC 3AZJA 1P3GA 3O62D 1S32C 3LJAB 1AOIC 5B32D 3MGRB 3B6FB 2F8NK 1P3MD 5DNMD 5CPID 5CPKB 3C1BD 3W96A 1KX5A 2FJ7B 4H9SC 3C1CC 3X1TC 2IO5B 4J8XD 5AV6C 1M19A 5B0ZD 3LZ1A 3MGPD 5GXQD 3REJC 3AZNC 5BO0A 3AZED 2HUEC 3MNNB 3X1UC 2NZDB 5B31C 3X1SC 3WTPE 1BFMA 3A6NB 4WV4B 3LELA 3UTBD 4KGCA 5CP6C 2YFVB 4X23C 4YM6C 1N1JA 1P34B 4ZUXC 4JJND 3AZKB 5B40C 3MGSB 2HIOB 5BNXA 3KUYD 1P3PC 3WAAB 3UT9A 5F99A 2CV5A 2PYOC 4EO5C 3AZID 5GT3B 1P3OA 3B6FC 4R8PB 5B1LD 3WKJB 1P3IA 1P3AA 1TZYB 2F8NG 3W98B 4AWLC 3NQUA 4YS3D 3B6GA 5CPKC 2FJ7C 2RVQD 5AV9A 3KWQB 1BH8B 5B33A 1P3KA 5E5AB 1ID3B 3V9RA 4QLCD 3AYWD 5B31G 2NZDC 5B2ID 3O62B 4HGAB 4DRAA 1AOIA 3W97D 1P3MB 3LZ0D 5DNMB 3VH5T 3AZKC 5CPIB 3MGSC 3REID 5AVBD 2HIOC 4UUZB 3C1BB 3REHB 5JRGD 4J8WA 4R8PC 4J8UD 1WWIA 4J8XB 3UTAC 3X1TA 1R4VA 1B6WA 3AFAD 5B0ZB 3MGPB 3AZEB 5GXQB 3REKB 5FUGA 4WU8D 3AZNA 4NE6A 3AN2B 3A6ND 4DRBA 3TU4D 3AZLA 3X1UA 3UTBB 5BNVA 3X1SA 5CHLB 2JSSA 2CV5C 4WNNA 4X23A 4YM6A 4H9QA 2YFWB 5E5AC 1P3OC 4ZUXA 3KUYB 5B2JD 3AZIB 4H9NA 1P3IC 1P3LB 3AZJD 1P3PA 1M1AD 3WKJD 4HGAC 5B32C 3LJAA 3WA9D 1P3MC 4WU9D 3B6FA 5DNMC 5CPIC 4YS3B 3X1VD 1KX3D 3AV2D 5CPKA 2F8NB 2FJ7A 5B33C 3KWQD 1BH9B 1HQ3D 4J8XC 4Z2MH 3W99D 3MGPC 3KXBD 2CWEA 4Z5TD 5CPJB 1M19D 1ID3D 4LD9D 5DNND 3AZGD 3AZMC 1EQZD 4QLCB 3AYWB 5B2IB 3VH6W 4Z66D 2NZDA 3UTBC 4E45A 5B24D 3W97B 3LZ0B 1ZLAD 2YFVA 4JJNC 1Q9CA 5AV8D 3REIB 5AVBB 1P34A 3KUYC 3AZKA 1P3BD 4J8WC 1F66C 3AZIC 3MGSA 2HIOA 3REHD 3WAAA 5B32G 1U35D 5JRGB 5GT3A 5B1LC 4J8UB 3AFAB 4R8PA 5AVCB 5BT1D 3UTAA 3REKD 4YS3C 3AZLC 4WU8B 3AN2D 4J8VD 5GT0C
chains in the Genus database with same CATH superfamily
4KHAB 3RELC 3AL0C 3EPHA 3TU4B 3MGQD 1KX4D 4XZQD 5BS7A 2RVQC 3WTPD 1P3FD 3A1IA 4XUJD 1BH8A 5B2JB 1P3LD 3AYWC 1H3OB 1Z2CB 5E5AA 3LJAC 3AZJB 1M1AB 3MGRC 3MVDD 2AROD 5B1MD 4G92B 3O62A 1M18D 1ULYA 2DF4C 1HTAA 4G91B 3WA9B 5B32A 1S32D 3W97C 4WU9B 3VH6A 2BYMB 1P3MA 5AVBC 3X1VB 4H9OB 5DNMA 3NQJB 5CPIA 1KX3B 4KUDD 2F8ND 3AV2B 3W96B 2IO5C 4UUZA 5B0YD 2W8SA 1HQ3B 3C1CD 5CPJD 3AFAC 3W99B 3KXBB 4J8XA 4Z5TB 1M19B 4LD9B 3H0RC 3MNNC 5DNNB 5B0ZA 5AV6D 3MGPA 5GXQA 3AZEA 2UWXA 3AZGB 1EQZB 3REJD 3A6NC 4Z66B 3TU4C 1JFIB 3AZMA 4H9RB 1P34C 5B24B 5B31D 3UTBA 4NFTA 1ZLAB 5AY8D 5AV8B 5CP6D 2NQBD 3WAAC 2BG1A 4JJNA 2Y2HA 5B2JC 1P3BB 5GT3C 2YFWA 5B40D 3KUYA 3AZHD 3AV1D 1M1AC 1U35B 1F66A 3AZIA 3WKJC 2PYOD 5JA4B 1TZYC 5AVCD 5KDMA 3W98C 4WU9C 5B1LA 2Y2JA 5G49B 1KX3C 4J8VB 5BS7C 4YS3A 3MGQB 2Y2LA 5GT0A 3KWQC 3R45A 4XZQB 3RELA 1KX4B 1HQ3C 3WTPB 5GSUD 1P3FB 1BH9A 5AV5D 3AZFD 4Z5TC 4XUJB 1ID3C 3O62C 1P3GD 4Z66C 3MVDB 4QLCA 3AYWA 2AROB 5B1MB 5B2IA 1M18B 3MGRA 2VQRA 1S32B 5C3IB 2Y2MA 5AV8C 3W97A 3LZ0A 3C1BC 4KUDB 1P3BC 1KX5D 3W96D 3REIA 5AVBA 3REHC 1U35C 3B0CT 3P5JB 5B0YB 4CSRB 5B0ZC 3AZEC 5GXQC 3C1CB 3LZ1D 4J8UA 5BT1C 3REKC 3AFAA 3UTAD 5AV6B 3AN2C 3VH5W 4J8VC 3REJB 3MNNA 2ZY3A 4UPKA 3LELD 4KGCD 4CAYB 4KHAA 4XZQC 3X1UB 3A6NA 1KX4C 2ZY4A 5BNVB 3TU4A 1P3FC 5B31B 3X1SB 5AY8B 5CP6B 2NQBB 4YM6B 2RIQA 1TAFB 3UT9D 5F99D 2CV5D 1P3LC 5B40B 3B0BA 3AZHB 3AV1B 4Z2MG 1P3OD 5B2JA 4H9PB 3MVDC 2AROC 2PYOB 4EO5B 1M1AA 1P3ID 1P3AD 1M18C 3WKJA 5C3IC 1TZYA 3WA9A 3W98A 4WU9A 3B6GD 4KUDC 2BYMA 4AWLB 3X1VA 4H9OA 3NQJA 1KX3A 2DQNC 4WZSB 5B0YC 2BYKB 3AV2A 5AV9D 5GSUB 3KWQA 5CPJC 5B33D 5AV5B 1P3KD 1HQ3A 3AZFB 4QLCC 3W99A 5B2IC 3KXBA 4Z5TA 1ID3A 1P3GB 4LD9A 5DNNA 3AZGA 1EQZA 2F8NH 3AZMD 4Z66A 3LZ0C 1JFIA 1AOID 4H9RA 3VH5A 5AY8C 2NQBC 3REIC 3B0CW 5B24A 1ZLAA 2ZY2A 5AV8A 4NE5A 1KX5B 3C1BA 3AV1C 3AZHC 3H0LC 5JRGC 1P3BA 4J8UC 4J8WD 3REHA 1F66D 1U35A 5AVCC 3X1TD 3LZ1B 5JA4A 5BO0B 2JCHA 3KSYA 4WU8C 3UTAB 3AZND 3REKA 2F2AC 5G49A 3AN2A 3AZLD 3X1UD 1A7WA 3LELB 4J8VA 4KGCB 3H0MC 3X1SD 5GT0D 3MGQA 3RELD 3KFUG 5GSUC 1N1JB 2LY8A 3B0DB 3IP4C 4XZQA 1KX4A 4X23D 4YM6D 5AV5C 3WTPA 3AZFC 1P3FA 5BNXB 4ZUXD 3UT9B 5F99B 3FDDA 3AZJC 2CV5B 4XUJA 1P3GC 1P3PD 1P3OB 4G92C 1P3LA 4G91C 3WA9C 1P3AB 1P3IB 3LJAD 3MVDA 2AROA 3F6TA 5B1MA 3MGRD 2Y2PA 3B6FD 4ZBJB 5B32B 1M18A 3X1VC 3NQUB 1S32A 4M6BA 3B6GB 3W96C 3AV2C 1KX5C 1KU5A 3VH6T 4KUDA 5CPKD 2FJ7D 2F8NA 1WWSA 5AV9B 3EPLA 3W99C 3KXBC 5B0YA 1M19C 4LD9C 5B33B 3LZ1C 1P3KB 2Y2QA 5DNNC 1B67A 4CSRA 3AZGC 4H9SA 3C1CA 5CPJA 1EQZC 3V9RB 1F1EA 5AV6A 3MNND 3LELC 4KGCC 2NZDD 3REJA 2XD5A 3AZMB 5B24C 1ZLAC 1AOIB 4CAYA 3B0DC 5B31A 1P34D 3AZKD 5AY8A 5CP6A 3UT9C 2NQBA 5F99C 4JJNB 3MGSD 2HIOD 1TAFA 3WAAD 5GT3D 5B40A 4J8WB 3AZHA 3AV1A 1P3AC 1F66B 4H9PA 5JRGA 3X1TB 2PYOA 2Y2OA 4ZBJC 4R8PD 5KDMB 5B1LB 5AVCA 1TZYD 5FUGB 3B6GC 3AZNB 3W98D 4WU8A 3MGQC 2HUEB 3AZLB 3WTPC 5GT0B 2L5AA 3R45B 5AV9C 3RELB 2BYKA 4WNNB 4E44A 4NE3A 4XUJC 4X23B 1P3KC 5GSUA 4H9QB 4ZUXB 5AV5A 3AZFA 4H9NB 5E5AD 1P3PB 1H3OA 5B1MC 2J8PA 3AZJA 1P3GA 3O62D 1S32C 3LJAB 1AOIC 5B32D 3A1KA 3MGRB 3B6FB 2F8NK 1P3MD 5DNMD 5CPID 5CPKB 3C1BD 3W96A 1KX5A 2FJ7B 4H9SC 3C1CC 3X1TC 2IO5B 2G5HC 4J8XD 5AV6C 1M19A 5B0ZD 2JE5A 3LZ1A 5GXQD 3MGPD 3REJC 5BO0A 3AZNC 3AZED 2HUEC 3MNNB 3X1UC 2NZDB 5B31C 3X1SC 3WTPE 1BFMA 3A6NB 4WV4B 3LELA 3UTBD 4KGCA 5CP6C 2YFVB 4X23C 4YM6C 1N1JA 1P34B 4ZUXC 4JJND 3AZKB 5B40C 3MGSB 2HIOB 5BNXA 3KUYD 1P3PC 3WAAB 3UT9A 5F99A 2CV5A 2PYOC 4EO5C 3AZID 5GT3B 1P3OA 3B6FC 4R8PB 5B1LD 3WKJB 1P3IA 1P3AA 1TZYB 2F8NG 3W98B 4AWLC 3NQUA 4YS3D 3B6GA 5CPKC 2FJ7C 2RVQD 5AV9A 3KWQB 1BH8B 5B33A 1P3KA 5E5AB 1ID3B 3V9RA 4QLCD 3AYWD 5B31G 2NZDC 5B2ID 3O62B 4HGAB 4DRAA 3EPKA 1AOIA 3W97D 1P3MB 3LZ0D 5DNMB 3VH5T 3AZKC 5CPIB 3MGSC 3REID 5AVBD 2HIOC 4UUZB 3C1BB 2ZY5A 3REHB 5JRGD 4J8WA 4R8PC 4J8UD 1WWIA 4J8XB 3UTAC 3X1TA 1R4VA 1B6WA 3AFAD 5B0ZB 3MGPB 3AZEB 5GXQB 3REKB 5FUGA 4WU8D 3AZNA 4NE6A 3AN2B 3A6ND 4DRBA 3TU4D 3AZLA 3X1UA 3UTBB 5BNVA 4DQYB 3X1SA 5CHLB 3EPJA 4WJ3C 2JSSA 2CV5C 4WNNA 4X23A 4YM6A 4H9QA 2YFWB 5E5AC 1P3OC 4ZUXA 3KUYB 5B2JD 3AZIB 4H9NA 1P3IC 3EG5B 3AZJD 1P3LB 1P3PA 1M1AD 3WKJD 4HGAC 5B32C 3LJAA 3WA9D 1P3MC 4WU9D 3B6FA 5DNMC 5CPIC 2Y2NA 4YS3B 3X1VD 1KX3D 3AV2D 1W2EA 5CPKA 2F8NB 2FJ7A 2Y2IA 3KWQD 5B33C 2Y2GA 1BH9B 1HQ3D 4J8XC 1PZRA 4Z2MH 3W99D 3MGPC 2FFFB 3KXBD 2CWEA 4Z5TD 5CPJB 1M19D 1ID3D 2Y2KA 4LD9D 5DNND 3AZGD 3AZMC 1EQZD 4QLCB 2ZM5A 3AYWB 5B2IB 3VH6W 4Z66D 2NZDA 3UTBC 4E45A 5B24D 3W97B 3LZ0B 1ZLAD 2YFVA 4JJNC 1Q9CA 5AV8D 2XD1A 5AVBB 3REIB 1P34A 3KUYC 3AZKA 1P3BD 4J8WC 1F66C 3AZIC 3MGSA 2HIOA 3REHD 3WAAA 5B32G 1U35D 5JRGB 1T3UA 5GT3A 5B1LC 4J8UB 2G5IC 3AFAB 4R8PA 5AVCB 5BT1D 3UTAA 3REKD 4YS3C 3AZLC 4WU8B 3AN2D 4J8VD 5GT0C
chains in the Genus database with same CATH topology
4KHAB 3RELC 3AL0C 3EPHA 3TU4B 3MGQD 1KX4D 4XZQD 5BS7A 2RVQC 3WTPD 1P3FD 3A1IA 4XUJD 1BH8A 5B2JB 1P3LD 3AYWC 1H3OB 1Z2CB 5E5AA 3LJAC 3AZJB 1M1AB 3MGRC 3MVDD 2AROD 5B1MD 4G92B 3O62A 1M18D 1ULYA 2DF4C 1HTAA 4G91B 3WA9B 5B32A 1S32D 3W97C 4WU9B 3VH6A 2BYMB 1P3MA 5AVBC 3X1VB 4H9OB 5DNMA 3NQJB 5CPIA 1KX3B 4KUDD 2F8ND 3AV2B 3W96B 2IO5C 4UUZA 5B0YD 2W8SA 1HQ3B 3C1CD 5CPJD 3AFAC 3W99B 3KXBB 4J8XA 4Z5TB 1M19B 4LD9B 3H0RC 3MNNC 5DNNB 5B0ZA 5AV6D 3MGPA 5GXQA 3AZEA 2UWXA 3AZGB 1EQZB 3REJD 3A6NC 4Z66B 3TU4C 1JFIB 3AZMA 4H9RB 1P34C 5B24B 5B31D 3UTBA 4NFTA 1ZLAB 5AY8D 5AV8B 5CP6D 2NQBD 3WAAC 2BG1A 4JJNA 2Y2HA 5B2JC 1P3BB 5GT3C 2YFWA 5B40D 3KUYA 3AZHD 3AV1D 1M1AC 1U35B 1F66A 3AZIA 3WKJC 2PYOD 5JA4B 1TZYC 5AVCD 5KDMA 3W98C 4WU9C 5B1LA 2Y2JA 5G49B 1KX3C 4J8VB 5BS7C 4YS3A 3MGQB 2Y2LA 5GT0A 3KWQC 3R45A 4XZQB 3RELA 1KX4B 1HQ3C 3WTPB 5GSUD 1P3FB 1BH9A 5AV5D 3AZFD 4Z5TC 4XUJB 1ID3C 3O62C 1P3GD 4Z66C 3MVDB 4QLCA 3AYWA 2AROB 5B1MB 5B2IA 1M18B 3MGRA 2VQRA 1S32B 5C3IB 2Y2MA 5AV8C 3W97A 3LZ0A 3C1BC 4KUDB 1P3BC 1KX5D 3W96D 3REIA 5AVBA 3REHC 1U35C 3B0CT 3P5JB 5B0YB 4CSRB 5B0ZC 3AZEC 5GXQC 3C1CB 3LZ1D 4J8UA 5BT1C 3REKC 3AFAA 3UTAD 5AV6B 3AN2C 3VH5W 4J8VC 3REJB 3MNNA 2ZY3A 4UPKA 3LELD 4KGCD 4CAYB 4KHAA 4XZQC 3X1UB 3A6NA 1KX4C 2ZY4A 5BNVB 3TU4A 1P3FC 5B31B 3X1SB 5AY8B 5CP6B 2NQBB 4YM6B 2RIQA 1TAFB 3UT9D 5F99D 2CV5D 1P3LC 5B40B 3B0BA 3AZHB 3AV1B 4Z2MG 1P3OD 5B2JA 4H9PB 3MVDC 2AROC 2PYOB 4EO5B 1M1AA 1P3ID 1P3AD 1M18C 3WKJA 5C3IC 1TZYA 3WA9A 3W98A 4WU9A 3B6GD 4KUDC 2BYMA 4AWLB 3X1VA 4H9OA 3NQJA 1KX3A 2DQNC 4WZSB 5B0YC 2BYKB 3AV2A 5AV9D 5GSUB 3KWQA 5CPJC 5B33D 5AV5B 1P3KD 1HQ3A 3AZFB 4QLCC 3W99A 5B2IC 3KXBA 4Z5TA 1ID3A 1P3GB 4LD9A 5DNNA 3AZGA 1EQZA 2F8NH 3AZMD 4Z66A 3LZ0C 1JFIA 1AOID 4H9RA 3VH5A 5AY8C 2NQBC 3REIC 3B0CW 5B24A 1ZLAA 2ZY2A 5AV8A 4NE5A 1KX5B 3C1BA 3AV1C 3AZHC 3H0LC 5JRGC 1P3BA 4J8UC 4J8WD 3REHA 1F66D 1U35A 5AVCC 3X1TD 3LZ1B 5JA4A 5BO0B 2JCHA 3KSYA 4WU8C 3UTAB 3AZND 3REKA 2F2AC 5G49A 3AN2A 3AZLD 3X1UD 1A7WA 3LELB 4J8VA 4KGCB 3H0MC 3X1SD 5GT0D 3MGQA 3RELD 3KFUG 5GSUC 1N1JB 2LY8A 3B0DB 3IP4C 4XZQA 1KX4A 4X23D 4YM6D 5AV5C 3WTPA 3AZFC 1P3FA 5BNXB 4ZUXD 3UT9B 5F99B 3FDDA 3AZJC 2CV5B 4XUJA 1P3GC 1P3PD 1P3OB 4G92C 1P3LA 4G91C 3WA9C 1P3AB 1P3IB 3LJAD 3MVDA 2AROA 3F6TA 5B1MA 3MGRD 2Y2PA 3B6FD 4ZBJB 5B32B 1M18A 3X1VC 3NQUB 1S32A 4M6BA 3B6GB 3W96C 3AV2C 1KX5C 1KU5A 3VH6T 4KUDA 5CPKD 2FJ7D 2F8NA 1WWSA 5AV9B 3EPLA 3W99C 3KXBC 5B0YA 1M19C 4LD9C 5B33B 3LZ1C 1P3KB 2Y2QA 5DNNC 1B67A 4CSRA 3AZGC 4H9SA 3C1CA 5CPJA 1EQZC 3V9RB 1F1EA 5AV6A 3MNND 3LELC 4KGCC 2NZDD 3REJA 2XD5A 3AZMB 5B24C 1ZLAC 1AOIB 4CAYA 3B0DC 5B31A 1P34D 3AZKD 5AY8A 5CP6A 3UT9C 2NQBA 5F99C 4JJNB 3MGSD 2HIOD 1TAFA 3WAAD 5GT3D 5B40A 4J8WB 3AZHA 3AV1A 1P3AC 1F66B 4H9PA 5JRGA 3X1TB 2PYOA 2Y2OA 4ZBJC 4R8PD 5KDMB 5B1LB 5AVCA 1TZYD 5FUGB 3B6GC 3AZNB 3W98D 4WU8A 3MGQC 2HUEB 3AZLB 3WTPC 5GT0B 2L5AA 3R45B 5AV9C 3RELB 2BYKA 4WNNB 4E44A 4NE3A 4XUJC 4X23B 1P3KC 5GSUA 4H9QB 4ZUXB 5AV5A 3AZFA 4H9NB 5E5AD 1P3PB 1H3OA 5B1MC 2J8PA 3AZJA 1P3GA 3O62D 1S32C 3LJAB 1AOIC 5B32D 3A1KA 3MGRB 3B6FB 2F8NK 1P3MD 5DNMD 5CPID 5CPKB 3C1BD 3W96A 1KX5A 2FJ7B 4H9SC 3C1CC 3X1TC 2IO5B 2G5HC 4J8XD 5AV6C 1M19A 5B0ZD 2JE5A 3LZ1A 5GXQD 3MGPD 3REJC 5BO0A 3AZNC 3AZED 2HUEC 3MNNB 3X1UC 2NZDB 5B31C 3X1SC 3WTPE 1BFMA 3A6NB 4WV4B 3LELA 3UTBD 4KGCA 5CP6C 2YFVB 4X23C 4YM6C 1N1JA 1P34B 4ZUXC 4JJND 3AZKB 5B40C 3MGSB 2HIOB 5BNXA 3KUYD 1P3PC 3WAAB 3UT9A 5F99A 2CV5A 2PYOC 4EO5C 3AZID 5GT3B 1P3OA 3B6FC 4R8PB 5B1LD 3WKJB 1P3IA 1P3AA 1TZYB 2F8NG 3W98B 4AWLC 3NQUA 4YS3D 3B6GA 5CPKC 2FJ7C 2RVQD 5AV9A 3KWQB 1BH8B 5B33A 1P3KA 5E5AB 1ID3B 3V9RA 4QLCD 3AYWD 5B31G 2NZDC 5B2ID 3O62B 4HGAB 4DRAA 3EPKA 1AOIA 3W97D 1P3MB 3LZ0D 5DNMB 3VH5T 3AZKC 5CPIB 3MGSC 3REID 5AVBD 2HIOC 4UUZB 3C1BB 2ZY5A 3REHB 5JRGD 4J8WA 4R8PC 4J8UD 1WWIA 4J8XB 3UTAC 3X1TA 1R4VA 1B6WA 3AFAD 5B0ZB 3MGPB 3AZEB 5GXQB 3REKB 5FUGA 4WU8D 3AZNA 4NE6A 3AN2B 3A6ND 4DRBA 3TU4D 3AZLA 3X1UA 3UTBB 5BNVA 4DQYB 3X1SA 5CHLB 3EPJA 4WJ3C 2JSSA 2CV5C 4WNNA 4X23A 4YM6A 4H9QA 2YFWB 5E5AC 1P3OC 4ZUXA 3KUYB 5B2JD 3AZIB 4H9NA 1P3IC 3EG5B 3AZJD 1P3LB 1P3PA 1M1AD 3WKJD 4HGAC 5B32C 3LJAA 3WA9D 1P3MC 4WU9D 3B6FA 5DNMC 5CPIC 2Y2NA 4YS3B 3X1VD 1KX3D 3AV2D 1W2EA 5CPKA 2F8NB 2FJ7A 2Y2IA 3KWQD 5B33C 2Y2GA 1BH9B 1HQ3D 4J8XC 1PZRA 4Z2MH 3W99D 3MGPC 2FFFB 3KXBD 2CWEA 4Z5TD 5CPJB 1M19D 1ID3D 2Y2KA 4LD9D 5DNND 3AZGD 3AZMC 1EQZD 4QLCB 2ZM5A 3AYWB 5B2IB 3VH6W 4Z66D 2NZDA 3UTBC 4E45A 5B24D 3W97B 3LZ0B 1ZLAD 2YFVA 4JJNC 1Q9CA 5AV8D 2XD1A 5AVBB 3REIB 1P34A 3KUYC 3AZKA 1P3BD 4J8WC 1F66C 3AZIC 3MGSA 2HIOA 3REHD 3WAAA 5B32G 1U35D 5JRGB 1T3UA 5GT3A 5B1LC 4J8UB 2G5IC 3AFAB 4R8PA 5AVCB 5BT1D 3UTAA 3REKD 4YS3C 3AZLC 4WU8B 3AN2D 4J8VD 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA B;  3REL C;  3TU4 B;  3MGQ D;  1KX4 D;  4XZQ D;  5BS7 A;  2RVQ C;  3WTP D;  1P3F D;  4XUJ D;  1BH8 A;  5B2J B;  1P3L D;  3AYW C;  1H3O B;  5E5A A;  3LJA C;  3AZJ B;  1M1A B;  3MGR C;  3MVD D;  2ARO D;  5B1M D;  4G92 B;  3O62 A;  1M18 D;  1ULY A;  4G91 B;  1HTA A;  3WA9 B;  5B32 A;  1S32 D;  3W97 C;  4WU9 B;  3VH6 A;  2BYM B;  1P3M A;  5AVB C;  3X1V B;  4H9O B;  5DNM A;  3NQJ B;  5CPI A;  1KX3 B;  4KUD D;  2F8N D;  3AV2 B;  3W96 B;  2IO5 C;  4UUZ A;  5B0Y D;  1HQ3 B;  3C1C D;  5CPJ D;  3AFA C;  3W99 B;  3KXB B;  4J8X A;  4Z5T B;  1M19 B;  4LD9 B;  3MNN C;  5DNN B;  5B0Z A;  5AV6 D;  3MGP A;  5GXQ A;  3AZE A;  3AZG B;  1EQZ B;  3REJ D;  3A6N C;  4Z66 B;  3TU4 C;  1JFI B;  3AZM A;  4H9R B;  1P34 C;  5B24 B;  5B31 D;  3UTB A;  4NFT A;  1ZLA B;  5AY8 D;  5AV8 B;  5CP6 D;  2NQB D;  3WAA C;  4JJN A;  5B2J C;  1P3B B;  5GT3 C;  2YFW A;  5B40 D;  3KUY A;  3AZH D;  3AV1 D;  1M1A C;  1U35 B;  1F66 A;  3AZI A;  3WKJ C;  2PYO D;  5JA4 B;  1TZY C;  5AVC D;  5KDM A;  3W98 C;  4WU9 C;  5B1L A;  5G49 B;  1KX3 C;  4J8V B;  5BS7 C;  4YS3 A;  3MGQ B;  5GT0 A;  3KWQ C;  3R45 A;  4XZQ B;  3REL A;  1KX4 B;  1HQ3 C;  3WTP B;  5GSU D;  1P3F B;  1BH9 A;  5AV5 D;  3AZF D;  4Z5T C;  4XUJ B;  1ID3 C;  3O62 C;  1P3G D;  4Z66 C;  3MVD B;  4QLC A;  3AYW A;  2ARO B;  5B1M B;  5B2I A;  1M18 B;  3MGR A;  1S32 B;  5C3I B;  5AV8 C;  3W97 A;  3LZ0 A;  3C1B C;  4KUD B;  1P3B C;  1KX5 D;  3W96 D;  3REI A;  5AVB A;  3REH C;  1U35 C;  3B0C T;  5B0Y B;  4CSR B;  5B0Z C;  3AZE C;  5GXQ C;  3C1C B;  3LZ1 D;  4J8U A;  5BT1 C;  3REK C;  3AFA A;  3UTA D;  5AV6 B;  3AN2 C;  3VH5 W;  4J8V C;  3REJ B;  3MNN A;  3LEL D;  4KGC D;  4CAY B;  4KHA A;  4XZQ C;  3X1U B;  3A6N A;  1KX4 C;  5BNV B;  3TU4 A;  1P3F C;  5B31 B;  3X1S B;  5AY8 B;  5CP6 B;  2NQB B;  4YM6 B;  1TAF B;  3UT9 D;  5F99 D;  2CV5 D;  1P3L C;  5B40 B;  3B0B A;  3AZH B;  3AV1 B;  4Z2M G;  1P3O D;  5B2J A;  4H9P B;  3MVD C;  2ARO C;  2PYO B;  4EO5 B;  1M1A A;  1P3I D;  1P3A D;  1M18 C;  3WKJ A;  5C3I C;  1TZY A;  3WA9 A;  3W98 A;  4WU9 A;  3B6G D;  4KUD C;  2BYM A;  4AWL B;  3X1V A;  4H9O A;  3NQJ A;  1KX3 A;  4WZS B;  5B0Y C;  2BYK B;  3AV2 A;  5AV9 D;  5GSU B;  3KWQ A;  5CPJ C;  5B33 D;  5AV5 B;  1P3K D;  1HQ3 A;  3AZF B;  4QLC C;  3W99 A;  5B2I C;  3KXB A;  4Z5T A;  1ID3 A;  1P3G B;  4LD9 A;  5DNN A;  3AZG A;  1EQZ A;  2F8N H;  3AZM D;  4Z66 A;  3LZ0 C;  1JFI A;  1AOI D;  4H9R A;  3VH5 A;  5AY8 C;  2NQB C;  3REI C;  3B0C W;  5B24 A;  1ZLA A;  5AV8 A;  4NE5 A;  1KX5 B;  3C1B A;  3AV1 C;  3AZH C;  5JRG C;  1P3B A;  4J8U C;  4J8W D;  3REH A;  1F66 D;  1U35 A;  5AVC C;  3X1T D;  3LZ1 B;  5JA4 A;  5BO0 B;  3KSY A;  4WU8 C;  3UTA B;  3AZN D;  3REK A;  5G49 A;  3AN2 A;  3AZL D;  3X1U D;  1A7W A;  3LEL B;  4J8V A;  4KGC B;  3X1S D;  5GT0 D;  3MGQ A;  3REL D;  5GSU C;  1N1J B;  2LY8 A;  3B0D B;  1KX4 A;  4XZQ A;  4X23 D;  4YM6 D;  5AV5 C;  3WTP A;  3AZF C;  1P3F A;  5BNX B;  4ZUX D;  3UT9 B;  5F99 B;  2CV5 B;  3AZJ C;  4XUJ A;  1P3G C;  1P3P D;  1P3O B;  4G92 C;  1P3L A;  4G91 C;  3WA9 C;  1P3A B;  1P3I B;  3LJA D;  3MVD A;  2ARO A;  5B1M A;  3MGR D;  3B6F D;  4ZBJ B;  5B32 B;  1M18 A;  3X1V C;  3NQU B;  1S32 A;  4M6B A;  3B6G B;  3W96 C;  3AV2 C;  1KX5 C;  1KU5 A;  3VH6 T;  4KUD A;  5CPK D;  2FJ7 D;  2F8N A;  1WWS A;  5AV9 B;  3W99 C;  3KXB C;  5B0Y A;  1M19 C;  4LD9 C;  5B33 B;  3LZ1 C;  1P3K B;  5DNN C;  1B67 A;  4CSR A;  3AZG C;  4H9S A;  3C1C A;  5CPJ A;  1EQZ C;  3V9R B;  1F1E A;  5AV6 A;  3MNN D;  3LEL C;  4KGC C;  2NZD D;  3REJ A;  3AZM B;  5B24 C;  1ZLA C;  1AOI B;  4CAY A;  3B0D C;  5B31 A;  1P34 D;  3AZK D;  5AY8 A;  5CP6 A;  3UT9 C;  2NQB A;  5F99 C;  4JJN B;  3MGS D;  2HIO D;  1TAF A;  3WAA D;  5GT3 D;  5B40 A;  4J8W B;  3AZH A;  3AV1 A;  1P3A C;  1F66 B;  4H9P A;  5JRG A;  3X1T B;  2PYO A;  4R8P D;  4ZBJ C;  5KDM B;  5B1L B;  5AVC A;  1TZY D;  5FUG B;  3B6G C;  3AZN B;  3W98 D;  4WU8 A;  3MGQ C;  2HUE B;  3AZL B;  3WTP C;  5GT0 B;  2L5A A;  3R45 B;  5AV9 C;  3REL B;  2BYK A;  4WNN B;  4E44 A;  4NE3 A;  4XUJ C;  4X23 B;  1P3K C;  5GSU A;  4H9Q B;  4ZUX B;  5AV5 A;  3AZF A;  4H9N B;  5E5A D;  1P3P B;  1H3O A;  5B1M C;  3AZJ A;  1P3G A;  3O62 D;  1S32 C;  3LJA B;  1AOI C;  5B32 D;  3MGR B;  3B6F B;  2F8N K;  1P3M D;  5DNM D;  5CPI D;  5CPK B;  3C1B D;  3W96 A;  1KX5 A;  2FJ7 B;  4H9S C;  3C1C C;  3X1T C;  2IO5 B;  4J8X D;  5AV6 C;  1M19 A;  5B0Z D;  3LZ1 A;  3MGP D;  5GXQ D;  3REJ C;  3AZN C;  5BO0 A;  3AZE D;  2HUE C;  3MNN B;  3X1U C;  2NZD B;  5B31 C;  3X1S C;  3WTP E;  1BFM A;  3A6N B;  4WV4 B;  3LEL A;  3UTB D;  4KGC A;  5CP6 C;  2YFV B;  4X23 C;  4YM6 C;  1N1J A;  1P34 B;  4ZUX C;  4JJN D;  3AZK B;  5B40 C;  3MGS B;  2HIO B;  5BNX A;  3KUY D;  1P3P C;  3WAA B;  3UT9 A;  5F99 A;  2CV5 A;  2PYO C;  4EO5 C;  3AZI D;  5GT3 B;  1P3O A;  3B6F C;  4R8P B;  5B1L D;  3WKJ B;  1P3I A;  1P3A A;  1TZY B;  2F8N G;  3W98 B;  4AWL C;  3NQU A;  4YS3 D;  3B6G A;  5CPK C;  2FJ7 C;  2RVQ D;  5AV9 A;  3KWQ B;  1BH8 B;  5B33 A;  1P3K A;  5E5A B;  1ID3 B;  3V9R A;  4QLC D;  3AYW D;  5B31 G;  2NZD C;  5B2I D;  3O62 B;  4HGA B;  4DRA A;  1AOI A;  3W97 D;  1P3M B;  3LZ0 D;  5DNM B;  3VH5 T;  3AZK C;  5CPI B;  3MGS C;  3REI D;  5AVB D;  2HIO C;  4UUZ B;  3C1B B;  3REH B;  5JRG D;  4J8W A;  4R8P C;  4J8U D;  1WWI A;  4J8X B;  3UTA C;  3X1T A;  1R4V A;  1B6W A;  3AFA D;  5B0Z B;  3MGP B;  3AZE B;  5GXQ B;  3REK B;  5FUG A;  4WU8 D;  3AZN A;  4NE6 A;  3AN2 B;  3A6N D;  4DRB A;  3TU4 D;  3AZL A;  3X1U A;  3UTB B;  5BNV A;  3X1S A;  5CHL B;  2JSS A;  2CV5 C;  4WNN A;  4X23 A;  4YM6 A;  4H9Q A;  2YFW B;  5E5A C;  1P3O C;  4ZUX A;  3KUY B;  5B2J D;  3AZI B;  4H9N A;  1P3I C;  1P3L B;  3AZJ D;  1P3P A;  1M1A D;  3WKJ D;  4HGA C;  5B32 C;  3LJA A;  3WA9 D;  1P3M C;  4WU9 D;  3B6F A;  5DNM C;  5CPI C;  4YS3 B;  3X1V D;  1KX3 D;  3AV2 D;  5CPK A;  2F8N B;  2FJ7 A;  5B33 C;  3KWQ D;  1BH9 B;  1HQ3 D;  4J8X C;  4Z2M H;  3W99 D;  3MGP C;  3KXB D;  2CWE A;  4Z5T D;  5CPJ B;  1M19 D;  1ID3 D;  4LD9 D;  5DNN D;  3AZG D;  3AZM C;  1EQZ D;  4QLC B;  3AYW B;  5B2I B;  3VH6 W;  4Z66 D;  2NZD A;  3UTB C;  4E45 A;  5B24 D;  3W97 B;  3LZ0 B;  1ZLA D;  2YFV A;  4JJN C;  1Q9C A;  5AV8 D;  3REI B;  5AVB B;  1P34 A;  3KUY C;  3AZK A;  1P3B D;  4J8W C;  1F66 C;  3AZI C;  3MGS A;  2HIO A;  3REH D;  3WAA A;  5B32 G;  1U35 D;  5JRG B;  5GT3 A;  5B1L C;  4J8U B;  3AFA B;  4R8P A;  5AVC B;  5BT1 D;  3UTA A;  3REK D;  4YS3 C;  3AZL C;  4WU8 B;  3AN2 D;  4J8V D;  5GT0 C; 
#chains in the Genus database with same CATH topology
 4KHA B;  3REL C;  3AL0 C;  3EPH A;  3TU4 B;  3MGQ D;  1KX4 D;  4XZQ D;  5BS7 A;  2RVQ C;  3WTP D;  1P3F D;  3A1I A;  4XUJ D;  1BH8 A;  5B2J B;  1P3L D;  3AYW C;  1H3O B;  1Z2C B;  5E5A A;  3LJA C;  3AZJ B;  1M1A B;  3MGR C;  3MVD D;  2ARO D;  5B1M D;  4G92 B;  3O62 A;  1M18 D;  1ULY A;  2DF4 C;  1HTA A;  4G91 B;  3WA9 B;  5B32 A;  1S32 D;  3W97 C;  4WU9 B;  3VH6 A;  2BYM B;  1P3M A;  5AVB C;  3X1V B;  4H9O B;  5DNM A;  3NQJ B;  5CPI A;  1KX3 B;  4KUD D;  2F8N D;  3AV2 B;  3W96 B;  2IO5 C;  4UUZ A;  5B0Y D;  2W8S A;  1HQ3 B;  3C1C D;  5CPJ D;  3AFA C;  3W99 B;  3KXB B;  4J8X A;  4Z5T B;  1M19 B;  4LD9 B;  3H0R C;  3MNN C;  5DNN B;  5B0Z A;  5AV6 D;  3MGP A;  5GXQ A;  3AZE A;  2UWX A;  3AZG B;  1EQZ B;  3REJ D;  3A6N C;  4Z66 B;  3TU4 C;  1JFI B;  3AZM A;  4H9R B;  1P34 C;  5B24 B;  5B31 D;  3UTB A;  4NFT A;  1ZLA B;  5AY8 D;  5AV8 B;  5CP6 D;  2NQB D;  3WAA C;  2BG1 A;  4JJN A;  2Y2H A;  5B2J C;  1P3B B;  5GT3 C;  2YFW A;  5B40 D;  3KUY A;  3AZH D;  3AV1 D;  1M1A C;  1U35 B;  1F66 A;  3AZI A;  3WKJ C;  2PYO D;  5JA4 B;  1TZY C;  5AVC D;  5KDM A;  3W98 C;  4WU9 C;  5B1L A;  2Y2J A;  5G49 B;  1KX3 C;  4J8V B;  5BS7 C;  4YS3 A;  3MGQ B;  2Y2L A;  5GT0 A;  3KWQ C;  3R45 A;  4XZQ B;  3REL A;  1KX4 B;  1HQ3 C;  3WTP B;  5GSU D;  1P3F B;  1BH9 A;  5AV5 D;  3AZF D;  4Z5T C;  4XUJ B;  1ID3 C;  3O62 C;  1P3G D;  4Z66 C;  3MVD B;  4QLC A;  3AYW A;  2ARO B;  5B1M B;  5B2I A;  1M18 B;  3MGR A;  2VQR A;  1S32 B;  5C3I B;  2Y2M A;  5AV8 C;  3W97 A;  3LZ0 A;  3C1B C;  4KUD B;  1P3B C;  1KX5 D;  3W96 D;  3REI A;  5AVB A;  3REH C;  1U35 C;  3B0C T;  3P5J B;  5B0Y B;  4CSR B;  5B0Z C;  3AZE C;  5GXQ C;  3C1C B;  3LZ1 D;  4J8U A;  5BT1 C;  3REK C;  3AFA A;  3UTA D;  5AV6 B;  3AN2 C;  3VH5 W;  4J8V C;  3REJ B;  3MNN A;  2ZY3 A;  4UPK A;  3LEL D;  4KGC D;  4CAY B;  4KHA A;  4XZQ C;  3X1U B;  3A6N A;  1KX4 C;  2ZY4 A;  5BNV B;  3TU4 A;  1P3F C;  5B31 B;  3X1S B;  5AY8 B;  5CP6 B;  2NQB B;  4YM6 B;  2RIQ A;  1TAF B;  3UT9 D;  5F99 D;  2CV5 D;  1P3L C;  5B40 B;  3B0B A;  3AZH B;  3AV1 B;  4Z2M G;  1P3O D;  5B2J A;  4H9P B;  3MVD C;  2ARO C;  2PYO B;  4EO5 B;  1M1A A;  1P3I D;  1P3A D;  1M18 C;  3WKJ A;  5C3I C;  1TZY A;  3WA9 A;  3W98 A;  4WU9 A;  3B6G D;  4KUD C;  2BYM A;  4AWL B;  3X1V A;  4H9O A;  3NQJ A;  1KX3 A;  2DQN C;  4WZS B;  5B0Y C;  2BYK B;  3AV2 A;  5AV9 D;  5GSU B;  3KWQ A;  5CPJ C;  5B33 D;  5AV5 B;  1P3K D;  1HQ3 A;  3AZF B;  4QLC C;  3W99 A;  5B2I C;  3KXB A;  4Z5T A;  1ID3 A;  1P3G B;  4LD9 A;  5DNN A;  3AZG A;  1EQZ A;  2F8N H;  3AZM D;  4Z66 A;  3LZ0 C;  1JFI A;  1AOI D;  4H9R A;  3VH5 A;  5AY8 C;  2NQB C;  3REI C;  3B0C W;  5B24 A;  1ZLA A;  2ZY2 A;  5AV8 A;  4NE5 A;  1KX5 B;  3C1B A;  3AV1 C;  3AZH C;  3H0L C;  5JRG C;  1P3B A;  4J8U C;  4J8W D;  3REH A;  1F66 D;  1U35 A;  5AVC C;  3X1T D;  3LZ1 B;  5JA4 A;  5BO0 B;  2JCH A;  3KSY A;  4WU8 C;  3UTA B;  3AZN D;  3REK A;  2F2A C;  5G49 A;  3AN2 A;  3AZL D;  3X1U D;  1A7W A;  3LEL B;  4J8V A;  4KGC B;  3H0M C;  3X1S D;  5GT0 D;  3MGQ A;  3REL D;  3KFU G;  5GSU C;  1N1J B;  2LY8 A;  3B0D B;  3IP4 C;  4XZQ A;  1KX4 A;  4X23 D;  4YM6 D;  5AV5 C;  3WTP A;  3AZF C;  1P3F A;  5BNX B;  4ZUX D;  3UT9 B;  5F99 B;  3FDD A;  3AZJ C;  2CV5 B;  4XUJ A;  1P3G C;  1P3P D;  1P3O B;  4G92 C;  1P3L A;  4G91 C;  3WA9 C;  1P3A B;  1P3I B;  3LJA D;  3MVD A;  2ARO A;  3F6T A;  5B1M A;  3MGR D;  2Y2P A;  3B6F D;  4ZBJ B;  5B32 B;  1M18 A;  3X1V C;  3NQU B;  1S32 A;  4M6B A;  3B6G B;  3W96 C;  3AV2 C;  1KX5 C;  1KU5 A;  3VH6 T;  4KUD A;  5CPK D;  2FJ7 D;  2F8N A;  1WWS A;  5AV9 B;  3EPL A;  3W99 C;  3KXB C;  5B0Y A;  1M19 C;  4LD9 C;  5B33 B;  3LZ1 C;  1P3K B;  2Y2Q A;  5DNN C;  1B67 A;  4CSR A;  3AZG C;  4H9S A;  3C1C A;  5CPJ A;  1EQZ C;  3V9R B;  1F1E A;  5AV6 A;  3MNN D;  3LEL C;  4KGC C;  2NZD D;  3REJ A;  2XD5 A;  3AZM B;  5B24 C;  1ZLA C;  1AOI B;  4CAY A;  3B0D C;  5B31 A;  1P34 D;  3AZK D;  5AY8 A;  5CP6 A;  3UT9 C;  2NQB A;  5F99 C;  4JJN B;  3MGS D;  2HIO D;  1TAF A;  3WAA D;  5GT3 D;  5B40 A;  4J8W B;  3AZH A;  3AV1 A;  1P3A C;  1F66 B;  4H9P A;  5JRG A;  3X1T B;  2PYO A;  2Y2O A;  4ZBJ C;  4R8P D;  5KDM B;  5B1L B;  5AVC A;  1TZY D;  5FUG B;  3B6G C;  3AZN B;  3W98 D;  4WU8 A;  3MGQ C;  2HUE B;  3AZL B;  3WTP C;  5GT0 B;  2L5A A;  3R45 B;  5AV9 C;  3REL B;  2BYK A;  4WNN B;  4E44 A;  4NE3 A;  4XUJ C;  4X23 B;  1P3K C;  5GSU A;  4H9Q B;  4ZUX B;  5AV5 A;  3AZF A;  4H9N B;  5E5A D;  1P3P B;  1H3O A;  5B1M C;  2J8P A;  3AZJ A;  1P3G A;  3O62 D;  1S32 C;  3LJA B;  1AOI C;  5B32 D;  3A1K A;  3MGR B;  3B6F B;  2F8N K;  1P3M D;  5DNM D;  5CPI D;  5CPK B;  3C1B D;  3W96 A;  1KX5 A;  2FJ7 B;  4H9S C;  3C1C C;  3X1T C;  2IO5 B;  2G5H C;  4J8X D;  5AV6 C;  1M19 A;  5B0Z D;  2JE5 A;  3LZ1 A;  5GXQ D;  3MGP D;  3REJ C;  5BO0 A;  3AZN C;  3AZE D;  2HUE C;  3MNN B;  3X1U C;  2NZD B;  5B31 C;  3X1S C;  3WTP E;  1BFM A;  3A6N B;  4WV4 B;  3LEL A;  3UTB D;  4KGC A;  5CP6 C;  2YFV B;  4X23 C;  4YM6 C;  1N1J A;  1P34 B;  4ZUX C;  4JJN D;  3AZK B;  5B40 C;  3MGS B;  2HIO B;  5BNX A;  3KUY D;  1P3P C;  3WAA B;  3UT9 A;  5F99 A;  2CV5 A;  2PYO C;  4EO5 C;  3AZI D;  5GT3 B;  1P3O A;  3B6F C;  4R8P B;  5B1L D;  3WKJ B;  1P3I A;  1P3A A;  1TZY B;  2F8N G;  3W98 B;  4AWL C;  3NQU A;  4YS3 D;  3B6G A;  5CPK C;  2FJ7 C;  2RVQ D;  5AV9 A;  3KWQ B;  1BH8 B;  5B33 A;  1P3K A;  5E5A B;  1ID3 B;  3V9R A;  4QLC D;  3AYW D;  5B31 G;  2NZD C;  5B2I D;  3O62 B;  4HGA B;  4DRA A;  3EPK A;  1AOI A;  3W97 D;  1P3M B;  3LZ0 D;  5DNM B;  3VH5 T;  3AZK C;  5CPI B;  3MGS C;  3REI D;  5AVB D;  2HIO C;  4UUZ B;  3C1B B;  2ZY5 A;  3REH B;  5JRG D;  4J8W A;  4R8P C;  4J8U D;  1WWI A;  4J8X B;  3UTA C;  3X1T A;  1R4V A;  1B6W A;  3AFA D;  5B0Z B;  3MGP B;  3AZE B;  5GXQ B;  3REK B;  5FUG A;  4WU8 D;  3AZN A;  4NE6 A;  3AN2 B;  3A6N D;  4DRB A;  3TU4 D;  3AZL A;  3X1U A;  3UTB B;  5BNV A;  4DQY B;  3X1S A;  5CHL B;  3EPJ A;  4WJ3 C;  2JSS A;  2CV5 C;  4WNN A;  4X23 A;  4YM6 A;  4H9Q A;  2YFW B;  5E5A C;  1P3O C;  4ZUX A;  3KUY B;  5B2J D;  3AZI B;  4H9N A;  1P3I C;  3EG5 B;  3AZJ D;  1P3L B;  1P3P A;  1M1A D;  3WKJ D;  4HGA C;  5B32 C;  3LJA A;  3WA9 D;  1P3M C;  4WU9 D;  3B6F A;  5DNM C;  5CPI C;  2Y2N A;  4YS3 B;  3X1V D;  1KX3 D;  3AV2 D;  1W2E A;  5CPK A;  2F8N B;  2FJ7 A;  2Y2I A;  3KWQ D;  5B33 C;  2Y2G A;  1BH9 B;  1HQ3 D;  4J8X C;  1PZR A;  4Z2M H;  3W99 D;  3MGP C;  2FFF B;  3KXB D;  2CWE A;  4Z5T D;  5CPJ B;  1M19 D;  1ID3 D;  2Y2K A;  4LD9 D;  5DNN D;  3AZG D;  3AZM C;  1EQZ D;  4QLC B;  2ZM5 A;  3AYW B;  5B2I B;  3VH6 W;  4Z66 D;  2NZD A;  3UTB C;  4E45 A;  5B24 D;  3W97 B;  3LZ0 B;  1ZLA D;  2YFV A;  4JJN C;  1Q9C A;  5AV8 D;  2XD1 A;  5AVB B;  3REI B;  1P34 A;  3KUY C;  3AZK A;  1P3B D;  4J8W C;  1F66 C;  3AZI C;  3MGS A;  2HIO A;  3REH D;  3WAA A;  5B32 G;  1U35 D;  5JRG B;  1T3U A;  5GT3 A;  5B1L C;  4J8U B;  2G5I C;  3AFA B;  4R8P A;  5AVC B;  5BT1 D;  3UTA A;  3REK D;  4YS3 C;  3AZL C;  4WU8 B;  3AN2 D;  4J8V D;  5GT0 C; 
#chains in the Genus database with same CATH homology
 4KHA B;  3REL C;  3AL0 C;  3EPH A;  3TU4 B;  3MGQ D;  1KX4 D;  4XZQ D;  5BS7 A;  2RVQ C;  3WTP D;  1P3F D;  3A1I A;  4XUJ D;  1BH8 A;  5B2J B;  1P3L D;  3AYW C;  1H3O B;  1Z2C B;  5E5A A;  3LJA C;  3AZJ B;  1M1A B;  3MGR C;  3MVD D;  2ARO D;  5B1M D;  4G92 B;  3O62 A;  1M18 D;  1ULY A;  2DF4 C;  1HTA A;  4G91 B;  3WA9 B;  5B32 A;  1S32 D;  3W97 C;  4WU9 B;  3VH6 A;  2BYM B;  1P3M A;  5AVB C;  3X1V B;  4H9O B;  5DNM A;  3NQJ B;  5CPI A;  1KX3 B;  4KUD D;  2F8N D;  3AV2 B;  3W96 B;  2IO5 C;  4UUZ A;  5B0Y D;  2W8S A;  1HQ3 B;  3C1C D;  5CPJ D;  3AFA C;  3W99 B;  3KXB B;  4J8X A;  4Z5T B;  1M19 B;  4LD9 B;  3H0R C;  3MNN C;  5DNN B;  5B0Z A;  5AV6 D;  3MGP A;  5GXQ A;  3AZE A;  2UWX A;  3AZG B;  1EQZ B;  3REJ D;  3A6N C;  4Z66 B;  3TU4 C;  1JFI B;  3AZM A;  4H9R B;  1P34 C;  5B24 B;  5B31 D;  3UTB A;  4NFT A;  1ZLA B;  5AY8 D;  5AV8 B;  5CP6 D;  2NQB D;  3WAA C;  2BG1 A;  4JJN A;  2Y2H A;  5B2J C;  1P3B B;  5GT3 C;  2YFW A;  5B40 D;  3KUY A;  3AZH D;  3AV1 D;  1M1A C;  1U35 B;  1F66 A;  3AZI A;  3WKJ C;  2PYO D;  5JA4 B;  1TZY C;  5AVC D;  5KDM A;  3W98 C;  4WU9 C;  5B1L A;  2Y2J A;  5G49 B;  1KX3 C;  4J8V B;  5BS7 C;  4YS3 A;  3MGQ B;  2Y2L A;  5GT0 A;  3KWQ C;  3R45 A;  4XZQ B;  3REL A;  1KX4 B;  1HQ3 C;  3WTP B;  5GSU D;  1P3F B;  1BH9 A;  5AV5 D;  3AZF D;  4Z5T C;  4XUJ B;  1ID3 C;  3O62 C;  1P3G D;  4Z66 C;  3MVD B;  4QLC A;  3AYW A;  2ARO B;  5B1M B;  5B2I A;  1M18 B;  3MGR A;  2VQR A;  1S32 B;  5C3I B;  2Y2M A;  5AV8 C;  3W97 A;  3LZ0 A;  3C1B C;  4KUD B;  1P3B C;  1KX5 D;  3W96 D;  3REI A;  5AVB A;  3REH C;  1U35 C;  3B0C T;  3P5J B;  5B0Y B;  4CSR B;  5B0Z C;  3AZE C;  5GXQ C;  3C1C B;  3LZ1 D;  4J8U A;  5BT1 C;  3REK C;  3AFA A;  3UTA D;  5AV6 B;  3AN2 C;  3VH5 W;  4J8V C;  3REJ B;  3MNN A;  2ZY3 A;  4UPK A;  3LEL D;  4KGC D;  4CAY B;  4KHA A;  4XZQ C;  3X1U B;  3A6N A;  1KX4 C;  2ZY4 A;  5BNV B;  3TU4 A;  1P3F C;  5B31 B;  3X1S B;  5AY8 B;  5CP6 B;  2NQB B;  4YM6 B;  2RIQ A;  1TAF B;  3UT9 D;  5F99 D;  2CV5 D;  1P3L C;  5B40 B;  3B0B A;  3AZH B;  3AV1 B;  4Z2M G;  1P3O D;  5B2J A;  4H9P B;  3MVD C;  2ARO C;  2PYO B;  4EO5 B;  1M1A A;  1P3I D;  1P3A D;  1M18 C;  3WKJ A;  5C3I C;  1TZY A;  3WA9 A;  3W98 A;  4WU9 A;  3B6G D;  4KUD C;  2BYM A;  4AWL B;  3X1V A;  4H9O A;  3NQJ A;  1KX3 A;  2DQN C;  4WZS B;  5B0Y C;  2BYK B;  3AV2 A;  5AV9 D;  5GSU B;  3KWQ A;  5CPJ C;  5B33 D;  5AV5 B;  1P3K D;  1HQ3 A;  3AZF B;  4QLC C;  3W99 A;  5B2I C;  3KXB A;  4Z5T A;  1ID3 A;  1P3G B;  4LD9 A;  5DNN A;  3AZG A;  1EQZ A;  2F8N H;  3AZM D;  4Z66 A;  3LZ0 C;  1JFI A;  1AOI D;  4H9R A;  3VH5 A;  5AY8 C;  2NQB C;  3REI C;  3B0C W;  5B24 A;  1ZLA A;  2ZY2 A;  5AV8 A;  4NE5 A;  1KX5 B;  3C1B A;  3AV1 C;  3AZH C;  3H0L C;  5JRG C;  1P3B A;  4J8U C;  4J8W D;  3REH A;  1F66 D;  1U35 A;  5AVC C;  3X1T D;  3LZ1 B;  5JA4 A;  5BO0 B;  2JCH A;  3KSY A;  4WU8 C;  3UTA B;  3AZN D;  3REK A;  2F2A C;  5G49 A;  3AN2 A;  3AZL D;  3X1U D;  1A7W A;  3LEL B;  4J8V A;  4KGC B;  3H0M C;  3X1S D;  5GT0 D;  3MGQ A;  3REL D;  3KFU G;  5GSU C;  1N1J B;  2LY8 A;  3B0D B;  3IP4 C;  4XZQ A;  1KX4 A;  4X23 D;  4YM6 D;  5AV5 C;  3WTP A;  3AZF C;  1P3F A;  5BNX B;  4ZUX D;  3UT9 B;  5F99 B;  3FDD A;  3AZJ C;  2CV5 B;  4XUJ A;  1P3G C;  1P3P D;  1P3O B;  4G92 C;  1P3L A;  4G91 C;  3WA9 C;  1P3A B;  1P3I B;  3LJA D;  3MVD A;  2ARO A;  3F6T A;  5B1M A;  3MGR D;  2Y2P A;  3B6F D;  4ZBJ B;  5B32 B;  1M18 A;  3X1V C;  3NQU B;  1S32 A;  4M6B A;  3B6G B;  3W96 C;  3AV2 C;  1KX5 C;  1KU5 A;  3VH6 T;  4KUD A;  5CPK D;  2FJ7 D;  2F8N A;  1WWS A;  5AV9 B;  3EPL A;  3W99 C;  3KXB C;  5B0Y A;  1M19 C;  4LD9 C;  5B33 B;  3LZ1 C;  1P3K B;  2Y2Q A;  5DNN C;  1B67 A;  4CSR A;  3AZG C;  4H9S A;  3C1C A;  5CPJ A;  1EQZ C;  3V9R B;  1F1E A;  5AV6 A;  3MNN D;  3LEL C;  4KGC C;  2NZD D;  3REJ A;  2XD5 A;  3AZM B;  5B24 C;  1ZLA C;  1AOI B;  4CAY A;  3B0D C;  5B31 A;  1P34 D;  3AZK D;  5AY8 A;  5CP6 A;  3UT9 C;  2NQB A;  5F99 C;  4JJN B;  3MGS D;  2HIO D;  1TAF A;  3WAA D;  5GT3 D;  5B40 A;  4J8W B;  3AZH A;  3AV1 A;  1P3A C;  1F66 B;  4H9P A;  5JRG A;  3X1T B;  2PYO A;  2Y2O A;  4ZBJ C;  4R8P D;  5KDM B;  5B1L B;  5AVC A;  1TZY D;  5FUG B;  3B6G C;  3AZN B;  3W98 D;  4WU8 A;  3MGQ C;  2HUE B;  3AZL B;  3WTP C;  5GT0 B;  2L5A A;  3R45 B;  5AV9 C;  3REL B;  2BYK A;  4WNN B;  4E44 A;  4NE3 A;  4XUJ C;  4X23 B;  1P3K C;  5GSU A;  4H9Q B;  4ZUX B;  5AV5 A;  3AZF A;  4H9N B;  5E5A D;  1P3P B;  1H3O A;  5B1M C;  2J8P A;  3AZJ A;  1P3G A;  3O62 D;  1S32 C;  3LJA B;  1AOI C;  5B32 D;  3A1K A;  3MGR B;  3B6F B;  2F8N K;  1P3M D;  5DNM D;  5CPI D;  5CPK B;  3C1B D;  3W96 A;  1KX5 A;  2FJ7 B;  4H9S C;  3C1C C;  3X1T C;  2IO5 B;  2G5H C;  4J8X D;  5AV6 C;  1M19 A;  5B0Z D;  2JE5 A;  3LZ1 A;  5GXQ D;  3MGP D;  3REJ C;  5BO0 A;  3AZN C;  3AZE D;  2HUE C;  3MNN B;  3X1U C;  2NZD B;  5B31 C;  3X1S C;  3WTP E;  1BFM A;  3A6N B;  4WV4 B;  3LEL A;  3UTB D;  4KGC A;  5CP6 C;  2YFV B;  4X23 C;  4YM6 C;  1N1J A;  1P34 B;  4ZUX C;  4JJN D;  3AZK B;  5B40 C;  3MGS B;  2HIO B;  5BNX A;  3KUY D;  1P3P C;  3WAA B;  3UT9 A;  5F99 A;  2CV5 A;  2PYO C;  4EO5 C;  3AZI D;  5GT3 B;  1P3O A;  3B6F C;  4R8P B;  5B1L D;  3WKJ B;  1P3I A;  1P3A A;  1TZY B;  2F8N G;  3W98 B;  4AWL C;  3NQU A;  4YS3 D;  3B6G A;  5CPK C;  2FJ7 C;  2RVQ D;  5AV9 A;  3KWQ B;  1BH8 B;  5B33 A;  1P3K A;  5E5A B;  1ID3 B;  3V9R A;  4QLC D;  3AYW D;  5B31 G;  2NZD C;  5B2I D;  3O62 B;  4HGA B;  4DRA A;  3EPK A;  1AOI A;  3W97 D;  1P3M B;  3LZ0 D;  5DNM B;  3VH5 T;  3AZK C;  5CPI B;  3MGS C;  3REI D;  5AVB D;  2HIO C;  4UUZ B;  3C1B B;  2ZY5 A;  3REH B;  5JRG D;  4J8W A;  4R8P C;  4J8U D;  1WWI A;  4J8X B;  3UTA C;  3X1T A;  1R4V A;  1B6W A;  3AFA D;  5B0Z B;  3MGP B;  3AZE B;  5GXQ B;  3REK B;  5FUG A;  4WU8 D;  3AZN A;  4NE6 A;  3AN2 B;  3A6N D;  4DRB A;  3TU4 D;  3AZL A;  3X1U A;  3UTB B;  5BNV A;  4DQY B;  3X1S A;  5CHL B;  3EPJ A;  4WJ3 C;  2JSS A;  2CV5 C;  4WNN A;  4X23 A;  4YM6 A;  4H9Q A;  2YFW B;  5E5A C;  1P3O C;  4ZUX A;  3KUY B;  5B2J D;  3AZI B;  4H9N A;  1P3I C;  3EG5 B;  3AZJ D;  1P3L B;  1P3P A;  1M1A D;  3WKJ D;  4HGA C;  5B32 C;  3LJA A;  3WA9 D;  1P3M C;  4WU9 D;  3B6F A;  5DNM C;  5CPI C;  2Y2N A;  4YS3 B;  3X1V D;  1KX3 D;  3AV2 D;  1W2E A;  5CPK A;  2F8N B;  2FJ7 A;  2Y2I A;  3KWQ D;  5B33 C;  2Y2G A;  1BH9 B;  1HQ3 D;  4J8X C;  1PZR A;  4Z2M H;  3W99 D;  3MGP C;  2FFF B;  3KXB D;  2CWE A;  4Z5T D;  5CPJ B;  1M19 D;  1ID3 D;  2Y2K A;  4LD9 D;  5DNN D;  3AZG D;  3AZM C;  1EQZ D;  4QLC B;  2ZM5 A;  3AYW B;  5B2I B;  3VH6 W;  4Z66 D;  2NZD A;  3UTB C;  4E45 A;  5B24 D;  3W97 B;  3LZ0 B;  1ZLA D;  2YFV A;  4JJN C;  1Q9C A;  5AV8 D;  2XD1 A;  5AVB B;  3REI B;  1P34 A;  3KUY C;  3AZK A;  1P3B D;  4J8W C;  1F66 C;  3AZI C;  3MGS A;  2HIO A;  3REH D;  3WAA A;  5B32 G;  1U35 D;  5JRG B;  1T3U A;  5GT3 A;  5B1L C;  4J8U B;  2G5I C;  3AFA B;  4R8P A;  5AVC B;  5BT1 D;  3UTA A;  3REK D;  4YS3 C;  3AZL C;  4WU8 B;  3AN2 D;  4J8V D;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...