3MGSA

Binding of cesium ions to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsA00
3X1UA 3W99D 4R8PD 3TU4C 1P3MC 3KUYD 2AROB 3UTAD 4Z66D 3KXBB 3AZLD 3REJD 3V9RB 3MNNC 2NQBC 1TZYA 3WA9B 3AZGB 4XUJA 4ZUXC 1N1JB 1P3KD 3W96B 3W98A 3RELC 2HIOD 3X1VD 3KUYA 1ULYA 3VH6T 4QLCA 3X1SB 3MGQA 1U35B 3AZNB 3AZLA 4YM6D 4H9NA 3REJA 3B6FA 5GSUD 3AZJC 3KXBD 5B31A 5GT3D 4KHAB 5B40A 4XZQC 3AV2C 3B0CT 5B1LB 3MGPA 4WU9C 1KX5D 1S32B 5GXQC 5DNMD 3W96D 2PYOA 5C3IB 3AZFC 1P3FB 2AROA 3X1SD 3KXBA 4NFTA 3V9RA 1B67A 1AOID 1HTAA 5AY8D 3WA9A 3AZGA 1N1JA 4H9SA 5FUGB 4H9OB 3W96A 3REIC 5B1LD 3AZEC 3AZHC 1S32D 2NZDB 3C1CD 5KDMB 3X1SA 1HQ3C 1U35A 3AZNA 1P3FD 5F99C 3X1UC 5B2JB 3MGRB 4KGCB 3VH5T 4KHAA 5B1LA 5B2ID 1S32A 5AV6C 2NZDD 1P3FA 1KX3B 3W98C 1M1AC 2YFWB 5B33B 4QLCC 3MGQC 3C1BB 5B2JD 1P3IB 4KGCD 1WWSA 2FJ7D 5FUGA 4H9OA 4Z5TD 3B6FC 3UTBB 2NZDA 5B31C 5B40C 4H9RB 3MGPC 1EQZD 5KDMA 1KX3D 2PYOC 5B2JA 3MGRA 4KGCA 3LZ0D 3B6GB 2AROC 5B0YD 1M19B 1M18B 3WA9C 3AZGC 3A6NB 4H9SC 3W96C 1KX3A 5AVBD 2YFWA 3B0DB 1P3LD 1ZLAB 5B33A 3C1BA 3X1SC 1U35C 1P3IA 3AZNC 5B32B 3UTBA 1F66B 3AZMB 5CPIB 5AV8D 1KX4D 4H9RA 1M18D 5CPJC 3WAAD 4J8UB 1P3FC 1ZLAD 3B6GA 4G91B 1M19A 5CPKD 5B24D 5CP6B 5BT1C 1M18A 1F66D 2BYMB 3MVDA 4WZSB 3A6NA 3AZMD 4CSRB 2NZDC 3WKJC 1ZLAA 5AVCB 4AWLB 4R8PB 3W99B 3AV1D 5B32A 1KU5A 2HUEB 3LELD 1F66A 3MGRC 3UTAB 4Z66B 3AZMA 5CPIA 5CP6D 5B0ZD 4JJND 5GT0D 1P3PB 1P3KB 3W97D 5AV9B 2HIOB 4J8UA 3X1VB 1KX3C 1P3BD 1P3AB 4NE6A 5B33C 3C1BC 3AN2B 3R45B 5CP6A 4YM6B 1P3IC 2BYMA 5GSUB 5DNND 5GT3B 3UTBC 4CSRA 4WNNB 1KX5B 3AZKC 5AVCA 5DNMB 1P3PD 2IO5B 5AV5C 5AV9D 4R8PA 3W99A 1P3AD 3UTAA 4Z66A 3B6GC 3AN2D 1M19C 3AZID 1AOIB 5E5AD 5AY8B 1P3PA 1P3KA 4H9PB 5AV9A 3MVDC 2HIOA 3A6NC 2F8NG 5B1MD 3X1VA 1P3AA 3C1CB 2YFVB 4X23B 1ZLAC 4J8XD 3AN2A 1P3OD 3R45A 4YM6A 5GSUA 5B32C 3REHB 3LZ1D 4YS3D 1A7WA 5GT3A 1F66C 2RVQC 4WNNA 1KX5A 5CPIC 5B2IB 3B0BA 5DNMA 1TAFB 2F8ND 4J8VD 4J8UC 4X23D 3REHD 3REKD 1AOIA 5AY8A 2FJ7B 3MGSD 4H9PA 4Z5TB 3KWQB 4EO5B 3C1CA 1TZYC 1EQZB 2JSSA 2YFVA 4X23A 3UT9D 4XUJC 5AVCC 4AWLC 4R8PC 3W99C 3KUYC 3REHA 2HUEC 3X1TB 3O62B 3LZ0B 4J8WB 4M6BA 3UTAC 5B0YB 4Z66C 5B2IA 3AZLC 3REJC 2F8NH 1TAFA 3KWQD 1P3KC 3AFAD 2HIOC 5AVBB 3LJAB 3X1VC 3WTPD 1P3LB 2BYKB 1P34D 5BS7A 3X1TD 1H3OB 3AN2C 3O62D 4YM6C 2FJ7A 4J8WD 4Z5TA 5GSUC 3KXBC 3KWQA 5GT3C 5AV8B 1KX4B 1KX5C 1P3MB 1EQZA 5DNMC 3WAAB 2IO5C 3AYWD 4LD9D 1P3GB 3LJAD 4WU8D 3X1TA 3O62A 3LZ0A 4J8WA 4ZBJB 2CV5D 4KUDD 5B0YA 5CPKB 5B24B 4UUZB 3RELB 1AOIC 5AY8C 5AVBA 3LJAA 5B1LC 3TU4D 1P3MD 1S32C 1P3LA 1P3GD 5C3IC 3C1CC 1BFMA 2BYKA 5CHLB 1H3OA 3AV1B 3LELB 4XZQB 3MNND 3REHC 2NQBD 4ZUXD 5AV8A 3RELD 1KX4A 5B0ZB 1P3MA 5B2IC 3WAAA 4JJNB 1P3GA 5GT0B 3W97B 1P3BB 2CWEA 4DRAA 3AZJD 5CPKA 5B24A 4XZQD 4UUZA 3RELA 3AV2D 5B2JC 4WU9D 4KGCC 5GXQD 2FJ7C 4Z5TC 5DNNB 3AZFD 3KWQC 4EO5C 1EQZC 3AV1A 3LELA 4XZQA 3LZ0C 3REID 5B0ZA 5AV6B 5B0YC 3AZED 3AZIB 3AZHD 5E5AB 4JJNA 5GT0A 3W97A 1HQ3D 1M1AB 5G49B 5B1MB 5F99D 5AVBC 5JA4B 3X1UD 1P3BA 4NE5A 1P3LC 4J8XB 5B31G 1P3OB 1B6WA 3LZ1B 4YS3B 5DNNA 5AV6D 5AV8C 3W98D 1KX4C 1M18C 1M1AD 3WAAC 1R4VA 1P3GC 4QLCD 3MGQD 2F8NB 4J8VB 3B0DC 3B6FD 4ZBJC 5AV6A 3AZIA 5B31D 5B24C 5B40D 3REKB 5E5AA 4HGAB 5CPKC 4DRBA 3MGPD 3MGSB 1M1AA 5BO0B 3AZMC 5G49A 5B1MA 2PYOD 5JA4A 3VH5W 3UT9B 4J8XA 2AROD 1P3OA 3AV1C 3LELC 3LZ1A 4YS3A 4G91C 5BNVB 3WA9D 3AZGD 5CPJB 4E44A 5CP6C 5B0ZC 4E45A 1BH9B 4JJNC 5GT0C 1ID3B 3W97C 2F8NA 3AFAB 1U35D 4J8VA 3AZND 1P3BC 3WTPB 1P34B 3REKA 1BH8B 5JRGB 3MGSA 5CPJD 5BO0A 3WKJB 5DNNC 4WV4B 4H9QB 4G92B 3UT9A 1P3PC 1ID3D 4LD9B 3AYWB 5AV9C 4WU8B 1P3AC 5BT1D 5BNVA 2CV5B 5CPJA 4KUDB 2F8NK 5JRGD 3AZIC 1BH9A 3WTPE 5E5AC 3WKJD 1ID3A 3AFAA 3TU4B 5B1MC 3WTPA 3MGRD 1P34A 4J8XC 1P3OC 1BH8A 5JRGA 3MNNB 2NQBB 3AZKB 3WKJA 4ZUXB 4YS3C 3LZ1C 5AV5B 4H9QA 5BNXB 4LD9A 3AYWA 4WU8A 1JFIB 3VH6A 5B33D 3C1BD 4Z2MG 1P3ID 4J8VC 2CV5A 4X23C 3AZJB 4KUDA 3UTBD 4CAYB 3MVDB 3AV2B 3REKC 3AZKD 4WU9B 4HGAC 5GXQB 3MGSC 5AV5D 3KSYA 3TU4A 2LY8A 3AZFB 5B32G 3UT9C 3B6GD 1M19D 3MNNA 2NQBA 3AZKA 4ZUXA 3NQJB 3MVDD 5AV5A 3REIB 3A6ND 5BS7C 3AZEB 3AZHB 1WWIA 5BNXA 3NQUB 1HQ3B 1JFIA 1ID3C 5F99B 3AFAC 3X1UB 5B32D 3AZJA 3WTPC 4NE3A 4CAYA 2RVQD 3AV2A 3VH5A 1P34C 4WU9A 5CPID 3X1TC 3O62C 5GXQA 4J8WC 5JRGC 1TZYB 4XUJB 3AZFA 3W98B 3VH6W 4J8UD 1Q9CA 4G92C 3KUYB 1F1EA 4LD9C 3AYWC 3LJAC 4Z2MH 4QLCB 3MGQB 4WU8C 2L5AA 3AZLB 3NQJA 3B0CW 4H9NB 3REJB 3REIA 2CV5C 3B6FB 4KUDC 3AZEA 3AZHA 5B31B 5B40B 3NQUA 3MGPB 1TZYD 1HQ3A 4XUJD 5AVCD 2PYOB 5F99A
chains in the Genus database with same CATH superfamily
3X1UA 3W99D 4R8PD 3TU4C 1P3MC 3KUYD 2AROB 3UTAD 2ZY4A 4Z66D 3KXBB 3AZLD 3REJD 3V9RB 3MNNC 2Y2MA 2NQBC 1TZYA 3WA9B 3AZGB 4XUJA 4ZUXC 1N1JB 1P3KD 3W96B 3W98A 3RELC 2HIOD 2Y2QA 3X1VD 3KUYA 1ULYA 3VH6T 4QLCA 3X1SB 3MGQA 1U35B 3AZNB 3AZLA 4YM6D 4H9NA 3REJA 3B6FA 5GSUD 3AZJC 3KXBD 5B31A 5GT3D 4KHAB 5B40A 4XZQC 3AV2C 3B0CT 5B1LB 3MGPA 4WU9C 1KX5D 1S32B 5GXQC 5DNMD 3W96D 2PYOA 5C3IB 2W8SA 2Y2NA 3AZFC 1P3FB 2AROA 3X1SD 3KXBA 4NFTA 3V9RA 1B67A 1AOID 1HTAA 2Y2OA 5AY8D 3AZGA 3WA9A 1N1JA 4H9SA 5FUGB 4H9OB 3W96A 2F2AC 3REIC 5B1LD 3AZEC 3AZHC 1S32D 2NZDB 2Y2LA 3C1CD 5KDMB 3X1SA 1HQ3C 1U35A 3AZNA 1P3FD 5F99C 3X1UC 5B2JB 3MGRB 4KGCB 3VH5T 4KHAA 5B1LA 5B2ID 1S32A 5AV6C 2NZDD 1P3FA 1KX3B 3W98C 1M1AC 2YFWB 5B33B 4QLCC 3MGQC 3C1BB 5B2JD 1P3IB 4KGCD 1WWSA 2FJ7D 5FUGA 4H9OA 4Z5TD 3B6FC 3UTBB 2NZDA 5B31C 5B40C 4H9RB 3MGPC 1EQZD 5KDMA 1KX3D 2PYOC 2Y2PA 5B2JA 3MGRA 4KGCA 3LZ0D 3B6GB 2AROC 5B0YD 1M19B 1M18B 3WA9C 3AZGC 3A6NB 4H9SC 3W96C 1KX3A 5AVBD 2YFWA 3B0DB 1P3LD 1ZLAB 5B33A 3C1BA 3X1SC 1U35C 1P3IA 3AZNC 5B32B 3UTBA 1F66B 3AZMB 5CPIB 5AV8D 1KX4D 4H9RA 1M18D 5CPJC 3WAAD 4J8UB 1P3FC 1ZLAD 3B6GA 2ZY3A 4G91B 1M19A 5CPKD 5B24D 5CP6B 5BT1C 1M18A 1F66D 2BYMB 3MVDA 4WZSB 3A6NA 3AZMD 2RIQA 4CSRB 3H0RC 2NZDC 3WKJC 1ZLAA 5AVCB 4AWLB 3A1IA 4R8PB 3W99B 3AV1D 5B32A 1KU5A 2HUEB 3LELD 1F66A 3MGRC 3UTAB 4Z66B 3AZMA 2Y2KA 5CPIA 5CP6D 5B0ZD 2DQNC 4JJND 5GT0D 1P3PB 1P3KB 3W97D 5AV9B 2HIOB 4J8UA 3X1VB 1KX3C 1P3BD 2ZY5A 1P3AB 4NE6A 5B33C 3C1BC 3AN2B 3R45B 5CP6A 4YM6B 1P3IC 2BYMA 5GSUB 5DNND 5GT3B 3UTBC 4CSRA 4WNNB 1KX5B 3AZKC 5AVCA 5DNMB 1P3PD 2IO5B 5AV5C 5AV9D 4R8PA 3W99A 1P3AD 3UTAA 4Z66A 3B6GC 3AN2D 1M19C 3AZID 1AOIB 5E5AD 5AY8B 1P3PA 1P3KA 4H9PB 5AV9A 3MVDC 2HIOA 3A6NC 2F8NG 5B1MD 3X1VA 2G5IC 1P3AA 3H0MC 3C1CB 2YFVB 4X23B 1ZLAC 2VQRA 4J8XD 3AN2A 1P3OD 3R45A 4YM6A 5GSUA 5B32C 3REHB 3LZ1D 4YS3D 1A7WA 5GT3A 1F66C 2RVQC 4WNNA 1KX5A 5CPIC 5B2IB 2Y2IA 3B0BA 5DNMA 3EPHA 1TAFB 2F8ND 3EPJA 4J8VD 4J8UC 4X23D 3EPLA 3REHD 3REKD 1AOIA 5AY8A 2FJ7B 3MGSD 4H9PA 4Z5TB 2Y2JA 3KWQB 4EO5B 3C1CA 1TZYC 1EQZB 2JSSA 2YFVA 4X23A 3UT9D 4XUJC 5AVCC 4AWLC 4R8PC 3W99C 3KUYC 3REHA 2HUEC 3X1TB 3O62B 3LZ0B 4J8WB 4M6BA 3UTAC 5B0YB 4Z66C 5B2IA 3AZLC 3REJC 2F8NH 2J8PA 1TAFA 3KWQD 1P3KC 3AFAD 2HIOC 5AVBB 3LJAB 3X1VC 3WTPD 1P3LB 3AL0C 2JCHA 2BYKB 1P34D 5BS7A 1H3OB 3X1TD 3AN2C 3O62D 4YM6C 2FJ7A 4J8WD 2G5HC 4Z5TA 5GSUC 3KXBC 3KWQA 5GT3C 5AV8B 1KX4B 1KX5C 1P3MB 1EQZA 5DNMC 3WAAB 2IO5C 3AYWD 4LD9D 1P3GB 3IP4C 3LJAD 4WU8D 4WJ3C 3X1TA 3O62A 3LZ0A 4J8WA 4ZBJB 2CV5D 4KUDD 5B0YA 3EPKA 5CPKB 5B24B 4UUZB 3RELB 1AOIC 5AY8C 5AVBA 3LJAA 5B1LC 3TU4D 1P3MD 1S32C 1P3LA 1P3GD 5C3IC 3C1CC 1BFMA 2BYKA 5CHLB 1H3OA 3AV1B 3LELB 4XZQB 3MNND 3REHC 2NQBD 4ZUXD 5AV8A 3RELD 1KX4A 5B0ZB 1P3MA 5B2IC 3WAAA 4JJNB 1P3GA 5GT0B 3W97B 1P3BB 2CWEA 4DRAA 3AZJD 5CPKA 5B24A 4XZQD 4UUZA 3RELA 3AV2D 5B2JC 4WU9D 4KGCC 2ZM5A 5GXQD 2FJ7C 4Z5TC 5DNNB 3AZFD 3H0LC 3KWQC 4EO5C 1EQZC 2FFFB 3AV1A 3LELA 4XZQA 3LZ0C 3REID 5B0ZA 5AV6B 5B0YC 3AZED 3AZIB 3AZHD 5E5AB 4JJNA 5GT0A 3W97A 1HQ3D 1M1AB 5G49B 5B1MB 5F99D 5AVBC 5JA4B 3X1UD 4DQYB 1P3BA 4NE5A 1P3LC 1Z2CB 4J8XB 5B31G 1P3OB 1B6WA 3LZ1B 4YS3B 5DNNA 5AV6D 2DF4C 5AV8C 3W98D 1KX4C 1M18C 1M1AD 3WAAC 1R4VA 1P3GC 4QLCD 3MGQD 2F8NB 4J8VB 3B0DC 3B6FD 4ZBJC 5AV6A 3AZIA 5B31D 5B24C 5B40D 3REKB 5E5AA 4HGAB 5CPKC 4DRBA 3MGPD 3MGSB 1PZRA 2UWXA 1M1AA 5BO0B 3AZMC 5G49A 5B1MA 2PYOD 5JA4A 3VH5W 3UT9B 4J8XA 2AROD 1P3OA 3AV1C 3LELC 3LZ1A 4YS3A 4G91C 5BNVB 3WA9D 3AZGD 5CPJB 4E44A 5CP6C 5B0ZC 4E45A 1BH9B 4JJNC 5GT0C 1ID3B 3W97C 2F8NA 3AFAB 1U35D 4J8VA 3AZND 2JE5A 1P3BC 3WTPB 1P34B 3REKA 1BH8B 5JRGB 3MGSA 5CPJD 5BO0A 3WKJB 5DNNC 4WV4B 4H9QB 2BG1A 4G92B 3UT9A 1P3PC 1ID3D 4LD9B 3AYWB 5AV9C 4WU8B 1P3AC 5BT1D 2ZY2A 5BNVA 2CV5B 5CPJA 4KUDB 2F8NK 1W2EA 5JRGD 3AZIC 1BH9A 3WTPE 5E5AC 3WKJD 1ID3A 3AFAA 3P5JB 3TU4B 5B1MC 3WTPA 3EG5B 3MGRD 1P34A 4J8XC 1P3OC 3FDDA 1BH8A 5JRGA 3MNNB 2NQBB 3AZKB 3WKJA 4ZUXB 4YS3C 3LZ1C 5AV5B 4H9QA 5BNXB 4LD9A 2Y2GA 3AYWA 1T3UA 4WU8A 1JFIB 3VH6A 5B33D 3C1BD 4Z2MG 1P3ID 4J8VC 2CV5A 4X23C 3AZJB 4KUDA 3UTBD 4CAYB 3MVDB 3AV2B 3REKC 3AZKD 4WU9B 4HGAC 2XD5A 5GXQB 3MGSC 5AV5D 3KSYA 3TU4A 2LY8A 3AZFB 5B32G 2Y2HA 3UT9C 3B6GD 1M19D 3MNNA 2NQBA 3AZKA 3KFUG 4ZUXA 3NQJB 3MVDD 5AV5A 3REIB 3A6ND 5BS7C 3AZEB 3AZHB 1WWIA 5BNXA 3NQUB 4UPKA 1HQ3B 1JFIA 1ID3C 5F99B 3AFAC 3X1UB 5B32D 3AZJA 3WTPC 4NE3A 4CAYA 2RVQD 3F6TA 3VH5A 3AV2A 1P34C 4WU9A 5CPID 3X1TC 3O62C 5GXQA 4J8WC 5JRGC 1TZYB 4XUJB 3AZFA 3W98B 3VH6W 4J8UD 1Q9CA 4G92C 3KUYB 1F1EA 4LD9C 3AYWC 3LJAC 4Z2MH 4QLCB 3MGQB 4WU8C 2L5AA 3AZLB 3NQJA 3B0CW 4H9NB 3REJB 3REIA 2CV5C 3B6FB 4KUDC 3A1KA 3AZEA 3AZHA 5B31B 5B40B 3NQUA 2XD1A 3MGPB 1TZYD 1HQ3A 4XUJD 5AVCD 2PYOB 5F99A
chains in the Genus database with same CATH topology
3X1UA 3W99D 4R8PD 3TU4C 1P3MC 3KUYD 2AROB 3UTAD 2ZY4A 4Z66D 3KXBB 3AZLD 3REJD 3V9RB 3MNNC 2Y2MA 2NQBC 1TZYA 3WA9B 3AZGB 4XUJA 4ZUXC 1N1JB 1P3KD 3W96B 3W98A 3RELC 2HIOD 2Y2QA 3X1VD 3KUYA 1ULYA 3VH6T 4QLCA 3X1SB 3MGQA 1U35B 3AZNB 3AZLA 4YM6D 4H9NA 3REJA 3B6FA 5GSUD 3AZJC 3KXBD 5B31A 5GT3D 4KHAB 5B40A 4XZQC 3AV2C 3B0CT 5B1LB 3MGPA 4WU9C 1KX5D 1S32B 5GXQC 5DNMD 3W96D 2PYOA 5C3IB 2W8SA 2Y2NA 3AZFC 1P3FB 2AROA 3X1SD 3KXBA 4NFTA 3V9RA 1B67A 1AOID 1HTAA 2Y2OA 5AY8D 3AZGA 3WA9A 1N1JA 4H9SA 5FUGB 4H9OB 3W96A 2F2AC 3REIC 5B1LD 3AZEC 3AZHC 1S32D 2NZDB 2Y2LA 3C1CD 5KDMB 3X1SA 1HQ3C 1U35A 3AZNA 1P3FD 5F99C 3X1UC 5B2JB 3MGRB 4KGCB 3VH5T 4KHAA 5B1LA 5B2ID 1S32A 5AV6C 2NZDD 1P3FA 1KX3B 3W98C 1M1AC 2YFWB 5B33B 4QLCC 3MGQC 3C1BB 5B2JD 1P3IB 4KGCD 1WWSA 2FJ7D 5FUGA 4H9OA 4Z5TD 3B6FC 3UTBB 2NZDA 5B31C 5B40C 4H9RB 3MGPC 1EQZD 5KDMA 1KX3D 2PYOC 2Y2PA 5B2JA 3MGRA 4KGCA 3LZ0D 3B6GB 2AROC 5B0YD 1M19B 1M18B 3WA9C 3AZGC 3A6NB 4H9SC 3W96C 1KX3A 5AVBD 2YFWA 3B0DB 1P3LD 1ZLAB 5B33A 3C1BA 3X1SC 1U35C 1P3IA 3AZNC 5B32B 3UTBA 1F66B 3AZMB 5CPIB 5AV8D 1KX4D 4H9RA 1M18D 5CPJC 3WAAD 4J8UB 1P3FC 1ZLAD 3B6GA 2ZY3A 4G91B 1M19A 5CPKD 5B24D 5CP6B 5BT1C 1M18A 1F66D 2BYMB 3MVDA 4WZSB 3A6NA 3AZMD 2RIQA 4CSRB 3H0RC 2NZDC 3WKJC 1ZLAA 5AVCB 4AWLB 3A1IA 4R8PB 3W99B 3AV1D 5B32A 1KU5A 2HUEB 3LELD 1F66A 3MGRC 3UTAB 4Z66B 3AZMA 2Y2KA 5CPIA 5CP6D 5B0ZD 2DQNC 4JJND 5GT0D 1P3PB 1P3KB 3W97D 5AV9B 2HIOB 4J8UA 3X1VB 1KX3C 1P3BD 2ZY5A 1P3AB 4NE6A 5B33C 3C1BC 3AN2B 3R45B 5CP6A 4YM6B 1P3IC 2BYMA 5GSUB 5DNND 5GT3B 3UTBC 4CSRA 4WNNB 1KX5B 3AZKC 5AVCA 5DNMB 1P3PD 2IO5B 5AV5C 5AV9D 4R8PA 3W99A 1P3AD 3UTAA 4Z66A 3B6GC 3AN2D 1M19C 3AZID 1AOIB 5E5AD 5AY8B 1P3PA 1P3KA 4H9PB 5AV9A 3MVDC 2HIOA 3A6NC 2F8NG 5B1MD 3X1VA 2G5IC 1P3AA 3H0MC 3C1CB 2YFVB 4X23B 1ZLAC 2VQRA 4J8XD 3AN2A 1P3OD 3R45A 4YM6A 5GSUA 5B32C 3REHB 3LZ1D 4YS3D 1A7WA 5GT3A 1F66C 2RVQC 4WNNA 1KX5A 5CPIC 5B2IB 2Y2IA 3B0BA 5DNMA 3EPHA 1TAFB 2F8ND 3EPJA 4J8VD 4J8UC 4X23D 3EPLA 3REHD 3REKD 1AOIA 5AY8A 2FJ7B 3MGSD 4H9PA 4Z5TB 2Y2JA 3KWQB 4EO5B 3C1CA 1TZYC 1EQZB 2JSSA 2YFVA 4X23A 3UT9D 4XUJC 5AVCC 4AWLC 4R8PC 3W99C 3KUYC 3REHA 2HUEC 3X1TB 3O62B 3LZ0B 4J8WB 4M6BA 3UTAC 5B0YB 4Z66C 5B2IA 3AZLC 3REJC 2F8NH 2J8PA 1TAFA 3KWQD 1P3KC 3AFAD 2HIOC 5AVBB 3LJAB 3X1VC 3WTPD 1P3LB 3AL0C 2JCHA 2BYKB 1P34D 5BS7A 1H3OB 3X1TD 3AN2C 3O62D 4YM6C 2FJ7A 4J8WD 2G5HC 4Z5TA 5GSUC 3KXBC 3KWQA 5GT3C 5AV8B 1KX4B 1KX5C 1P3MB 1EQZA 5DNMC 3WAAB 2IO5C 3AYWD 4LD9D 1P3GB 3IP4C 3LJAD 4WU8D 4WJ3C 3X1TA 3O62A 3LZ0A 4J8WA 4ZBJB 2CV5D 4KUDD 5B0YA 3EPKA 5CPKB 5B24B 4UUZB 3RELB 1AOIC 5AY8C 5AVBA 3LJAA 5B1LC 3TU4D 1P3MD 1S32C 1P3LA 1P3GD 5C3IC 3C1CC 1BFMA 2BYKA 5CHLB 1H3OA 3AV1B 3LELB 4XZQB 3MNND 3REHC 2NQBD 4ZUXD 5AV8A 3RELD 1KX4A 5B0ZB 1P3MA 5B2IC 3WAAA 4JJNB 1P3GA 5GT0B 3W97B 1P3BB 2CWEA 4DRAA 3AZJD 5CPKA 5B24A 4XZQD 4UUZA 3RELA 3AV2D 5B2JC 4WU9D 4KGCC 2ZM5A 5GXQD 2FJ7C 4Z5TC 5DNNB 3AZFD 3H0LC 3KWQC 4EO5C 1EQZC 2FFFB 3AV1A 3LELA 4XZQA 3LZ0C 3REID 5B0ZA 5AV6B 5B0YC 3AZED 3AZIB 3AZHD 5E5AB 4JJNA 5GT0A 3W97A 1HQ3D 1M1AB 5G49B 5B1MB 5F99D 5AVBC 5JA4B 3X1UD 4DQYB 1P3BA 4NE5A 1P3LC 1Z2CB 4J8XB 5B31G 1P3OB 1B6WA 3LZ1B 4YS3B 5DNNA 5AV6D 2DF4C 5AV8C 3W98D 1KX4C 1M18C 1M1AD 3WAAC 1R4VA 1P3GC 4QLCD 3MGQD 2F8NB 4J8VB 3B0DC 3B6FD 4ZBJC 5AV6A 3AZIA 5B31D 5B24C 5B40D 3REKB 5E5AA 4HGAB 5CPKC 4DRBA 3MGPD 3MGSB 1PZRA 2UWXA 1M1AA 5BO0B 3AZMC 5G49A 5B1MA 2PYOD 5JA4A 3VH5W 3UT9B 4J8XA 2AROD 1P3OA 3AV1C 3LELC 3LZ1A 4YS3A 4G91C 5BNVB 3WA9D 3AZGD 5CPJB 4E44A 5CP6C 5B0ZC 4E45A 1BH9B 4JJNC 5GT0C 1ID3B 3W97C 2F8NA 3AFAB 1U35D 4J8VA 3AZND 2JE5A 1P3BC 3WTPB 1P34B 3REKA 1BH8B 5JRGB 3MGSA 5CPJD 5BO0A 3WKJB 5DNNC 4WV4B 4H9QB 2BG1A 4G92B 3UT9A 1P3PC 1ID3D 4LD9B 3AYWB 5AV9C 4WU8B 1P3AC 5BT1D 2ZY2A 5BNVA 2CV5B 5CPJA 4KUDB 2F8NK 1W2EA 5JRGD 3AZIC 1BH9A 3WTPE 5E5AC 3WKJD 1ID3A 3AFAA 3P5JB 3TU4B 5B1MC 3WTPA 3EG5B 3MGRD 1P34A 4J8XC 1P3OC 3FDDA 1BH8A 5JRGA 3MNNB 2NQBB 3AZKB 3WKJA 4ZUXB 4YS3C 3LZ1C 5AV5B 4H9QA 5BNXB 4LD9A 2Y2GA 3AYWA 1T3UA 4WU8A 1JFIB 3VH6A 5B33D 3C1BD 4Z2MG 1P3ID 4J8VC 2CV5A 4X23C 3AZJB 4KUDA 3UTBD 4CAYB 3MVDB 3AV2B 3REKC 3AZKD 4WU9B 4HGAC 2XD5A 5GXQB 3MGSC 5AV5D 3KSYA 3TU4A 2LY8A 3AZFB 5B32G 2Y2HA 3UT9C 3B6GD 1M19D 3MNNA 2NQBA 3AZKA 3KFUG 4ZUXA 3NQJB 3MVDD 5AV5A 3REIB 3A6ND 5BS7C 3AZEB 3AZHB 1WWIA 5BNXA 3NQUB 4UPKA 1HQ3B 1JFIA 1ID3C 5F99B 3AFAC 3X1UB 5B32D 3AZJA 3WTPC 4NE3A 4CAYA 2RVQD 3F6TA 3VH5A 3AV2A 1P34C 4WU9A 5CPID 3X1TC 3O62C 5GXQA 4J8WC 5JRGC 1TZYB 4XUJB 3AZFA 3W98B 3VH6W 4J8UD 1Q9CA 4G92C 3KUYB 1F1EA 4LD9C 3AYWC 3LJAC 4Z2MH 4QLCB 3MGQB 4WU8C 2L5AA 3AZLB 3NQJA 3B0CW 4H9NB 3REJB 3REIA 2CV5C 3B6FB 4KUDC 3A1KA 3AZEA 3AZHA 5B31B 5B40B 3NQUA 2XD1A 3MGPB 1TZYD 1HQ3A 4XUJD 5AVCD 2PYOB 5F99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U A;  3W99 D;  4R8P D;  3TU4 C;  1P3M C;  3KUY D;  2ARO B;  3UTA D;  4Z66 D;  3KXB B;  3AZL D;  3REJ D;  3V9R B;  3MNN C;  2NQB C;  1TZY A;  3WA9 B;  3AZG B;  4XUJ A;  4ZUX C;  1N1J B;  1P3K D;  3W96 B;  3W98 A;  3REL C;  2HIO D;  3X1V D;  3KUY A;  1ULY A;  3VH6 T;  4QLC A;  3X1S B;  3MGQ A;  1U35 B;  3AZN B;  3AZL A;  4YM6 D;  4H9N A;  3REJ A;  3B6F A;  5GSU D;  3AZJ C;  3KXB D;  5B31 A;  5GT3 D;  4KHA B;  5B40 A;  4XZQ C;  3AV2 C;  3B0C T;  5B1L B;  3MGP A;  4WU9 C;  1KX5 D;  1S32 B;  5GXQ C;  5DNM D;  3W96 D;  2PYO A;  5C3I B;  3AZF C;  1P3F B;  2ARO A;  3X1S D;  3KXB A;  4NFT A;  3V9R A;  1B67 A;  1AOI D;  1HTA A;  5AY8 D;  3WA9 A;  3AZG A;  1N1J A;  4H9S A;  5FUG B;  4H9O B;  3W96 A;  3REI C;  5B1L D;  3AZE C;  3AZH C;  1S32 D;  2NZD B;  3C1C D;  5KDM B;  3X1S A;  1HQ3 C;  1U35 A;  3AZN A;  1P3F D;  5F99 C;  3X1U C;  5B2J B;  3MGR B;  4KGC B;  3VH5 T;  4KHA A;  5B1L A;  5B2I D;  1S32 A;  5AV6 C;  2NZD D;  1P3F A;  1KX3 B;  3W98 C;  1M1A C;  2YFW B;  5B33 B;  4QLC C;  3MGQ C;  3C1B B;  5B2J D;  1P3I B;  4KGC D;  1WWS A;  2FJ7 D;  5FUG A;  4H9O A;  4Z5T D;  3B6F C;  3UTB B;  2NZD A;  5B31 C;  5B40 C;  4H9R B;  3MGP C;  1EQZ D;  5KDM A;  1KX3 D;  2PYO C;  5B2J A;  3MGR A;  4KGC A;  3LZ0 D;  3B6G B;  2ARO C;  5B0Y D;  1M19 B;  1M18 B;  3WA9 C;  3AZG C;  3A6N B;  4H9S C;  3W96 C;  1KX3 A;  5AVB D;  2YFW A;  3B0D B;  1P3L D;  1ZLA B;  5B33 A;  3C1B A;  3X1S C;  1U35 C;  1P3I A;  3AZN C;  5B32 B;  3UTB A;  1F66 B;  3AZM B;  5CPI B;  5AV8 D;  1KX4 D;  4H9R A;  1M18 D;  5CPJ C;  3WAA D;  4J8U B;  1P3F C;  1ZLA D;  3B6G A;  4G91 B;  1M19 A;  5CPK D;  5B24 D;  5CP6 B;  5BT1 C;  1M18 A;  1F66 D;  2BYM B;  3MVD A;  4WZS B;  3A6N A;  3AZM D;  4CSR B;  2NZD C;  3WKJ C;  1ZLA A;  5AVC B;  4AWL B;  4R8P B;  3W99 B;  3AV1 D;  5B32 A;  1KU5 A;  2HUE B;  3LEL D;  1F66 A;  3MGR C;  3UTA B;  4Z66 B;  3AZM A;  5CPI A;  5CP6 D;  5B0Z D;  4JJN D;  5GT0 D;  1P3P B;  1P3K B;  3W97 D;  5AV9 B;  2HIO B;  4J8U A;  3X1V B;  1KX3 C;  1P3B D;  1P3A B;  4NE6 A;  5B33 C;  3C1B C;  3AN2 B;  3R45 B;  5CP6 A;  4YM6 B;  1P3I C;  2BYM A;  5GSU B;  5DNN D;  5GT3 B;  3UTB C;  4CSR A;  4WNN B;  1KX5 B;  3AZK C;  5AVC A;  5DNM B;  1P3P D;  2IO5 B;  5AV5 C;  5AV9 D;  4R8P A;  3W99 A;  1P3A D;  3UTA A;  4Z66 A;  3B6G C;  3AN2 D;  1M19 C;  3AZI D;  1AOI B;  5E5A D;  5AY8 B;  1P3P A;  1P3K A;  4H9P B;  5AV9 A;  3MVD C;  2HIO A;  3A6N C;  2F8N G;  5B1M D;  3X1V A;  1P3A A;  3C1C B;  2YFV B;  4X23 B;  1ZLA C;  4J8X D;  3AN2 A;  1P3O D;  3R45 A;  4YM6 A;  5GSU A;  5B32 C;  3REH B;  3LZ1 D;  4YS3 D;  1A7W A;  5GT3 A;  1F66 C;  2RVQ C;  4WNN A;  1KX5 A;  5CPI C;  5B2I B;  3B0B A;  5DNM A;  1TAF B;  2F8N D;  4J8V D;  4J8U C;  4X23 D;  3REH D;  3REK D;  1AOI A;  5AY8 A;  2FJ7 B;  3MGS D;  4H9P A;  4Z5T B;  3KWQ B;  4EO5 B;  3C1C A;  1TZY C;  1EQZ B;  2JSS A;  2YFV A;  4X23 A;  3UT9 D;  4XUJ C;  5AVC C;  4AWL C;  4R8P C;  3W99 C;  3KUY C;  3REH A;  2HUE C;  3X1T B;  3O62 B;  3LZ0 B;  4J8W B;  4M6B A;  3UTA C;  5B0Y B;  4Z66 C;  5B2I A;  3AZL C;  3REJ C;  2F8N H;  1TAF A;  3KWQ D;  1P3K C;  3AFA D;  2HIO C;  5AVB B;  3LJA B;  3X1V C;  3WTP D;  1P3L B;  2BYK B;  1P34 D;  5BS7 A;  3X1T D;  1H3O B;  3AN2 C;  3O62 D;  4YM6 C;  2FJ7 A;  4J8W D;  4Z5T A;  5GSU C;  3KXB C;  3KWQ A;  5GT3 C;  5AV8 B;  1KX4 B;  1KX5 C;  1P3M B;  1EQZ A;  5DNM C;  3WAA B;  2IO5 C;  3AYW D;  4LD9 D;  1P3G B;  3LJA D;  4WU8 D;  3X1T A;  3O62 A;  3LZ0 A;  4J8W A;  4ZBJ B;  2CV5 D;  4KUD D;  5B0Y A;  5CPK B;  5B24 B;  4UUZ B;  3REL B;  1AOI C;  5AY8 C;  5AVB A;  3LJA A;  5B1L C;  3TU4 D;  1P3M D;  1S32 C;  1P3L A;  1P3G D;  5C3I C;  3C1C C;  1BFM A;  2BYK A;  5CHL B;  1H3O A;  3AV1 B;  3LEL B;  4XZQ B;  3MNN D;  3REH C;  2NQB D;  4ZUX D;  5AV8 A;  3REL D;  1KX4 A;  5B0Z B;  1P3M A;  5B2I C;  3WAA A;  4JJN B;  1P3G A;  5GT0 B;  3W97 B;  1P3B B;  2CWE A;  4DRA A;  3AZJ D;  5CPK A;  5B24 A;  4XZQ D;  4UUZ A;  3REL A;  3AV2 D;  5B2J C;  4WU9 D;  4KGC C;  5GXQ D;  2FJ7 C;  4Z5T C;  5DNN B;  3AZF D;  3KWQ C;  4EO5 C;  1EQZ C;  3AV1 A;  3LEL A;  4XZQ A;  3LZ0 C;  3REI D;  5B0Z A;  5AV6 B;  5B0Y C;  3AZE D;  3AZI B;  3AZH D;  5E5A B;  4JJN A;  5GT0 A;  3W97 A;  1HQ3 D;  1M1A B;  5G49 B;  5B1M B;  5F99 D;  5AVB C;  5JA4 B;  3X1U D;  1P3B A;  4NE5 A;  1P3L C;  4J8X B;  5B31 G;  1P3O B;  1B6W A;  3LZ1 B;  4YS3 B;  5DNN A;  5AV6 D;  5AV8 C;  3W98 D;  1KX4 C;  1M18 C;  1M1A D;  3WAA C;  1R4V A;  1P3G C;  4QLC D;  3MGQ D;  2F8N B;  4J8V B;  3B0D C;  3B6F D;  4ZBJ C;  5AV6 A;  3AZI A;  5B31 D;  5B24 C;  5B40 D;  3REK B;  5E5A A;  4HGA B;  5CPK C;  4DRB A;  3MGP D;  3MGS B;  1M1A A;  5BO0 B;  3AZM C;  5G49 A;  5B1M A;  2PYO D;  5JA4 A;  3VH5 W;  3UT9 B;  4J8X A;  2ARO D;  1P3O A;  3AV1 C;  3LEL C;  3LZ1 A;  4YS3 A;  4G91 C;  5BNV B;  3WA9 D;  3AZG D;  5CPJ B;  4E44 A;  5CP6 C;  5B0Z C;  4E45 A;  1BH9 B;  4JJN C;  5GT0 C;  1ID3 B;  3W97 C;  2F8N A;  3AFA B;  1U35 D;  4J8V A;  3AZN D;  1P3B C;  3WTP B;  1P34 B;  3REK A;  1BH8 B;  5JRG B;  3MGS A;  5CPJ D;  5BO0 A;  3WKJ B;  5DNN C;  4WV4 B;  4H9Q B;  4G92 B;  3UT9 A;  1P3P C;  1ID3 D;  4LD9 B;  3AYW B;  5AV9 C;  4WU8 B;  1P3A C;  5BT1 D;  5BNV A;  2CV5 B;  5CPJ A;  4KUD B;  2F8N K;  5JRG D;  3AZI C;  1BH9 A;  3WTP E;  5E5A C;  3WKJ D;  1ID3 A;  3AFA A;  3TU4 B;  5B1M C;  3WTP A;  3MGR D;  1P34 A;  4J8X C;  1P3O C;  1BH8 A;  5JRG A;  3MNN B;  2NQB B;  3AZK B;  3WKJ A;  4ZUX B;  4YS3 C;  3LZ1 C;  5AV5 B;  4H9Q A;  5BNX B;  4LD9 A;  3AYW A;  4WU8 A;  1JFI B;  3VH6 A;  5B33 D;  3C1B D;  4Z2M G;  1P3I D;  4J8V C;  2CV5 A;  4X23 C;  3AZJ B;  4KUD A;  3UTB D;  4CAY B;  3MVD B;  3AV2 B;  3REK C;  3AZK D;  4WU9 B;  4HGA C;  5GXQ B;  3MGS C;  5AV5 D;  3KSY A;  3TU4 A;  2LY8 A;  3AZF B;  5B32 G;  3UT9 C;  3B6G D;  1M19 D;  3MNN A;  2NQB A;  3AZK A;  4ZUX A;  3NQJ B;  3MVD D;  5AV5 A;  3REI B;  3A6N D;  5BS7 C;  3AZE B;  3AZH B;  1WWI A;  5BNX A;  3NQU B;  1HQ3 B;  1JFI A;  1ID3 C;  5F99 B;  3AFA C;  3X1U B;  5B32 D;  3AZJ A;  3WTP C;  4NE3 A;  4CAY A;  2RVQ D;  3AV2 A;  3VH5 A;  1P34 C;  4WU9 A;  5CPI D;  3X1T C;  3O62 C;  5GXQ A;  4J8W C;  5JRG C;  1TZY B;  4XUJ B;  3AZF A;  3W98 B;  3VH6 W;  4J8U D;  1Q9C A;  4G92 C;  3KUY B;  1F1E A;  4LD9 C;  3AYW C;  3LJA C;  4Z2M H;  4QLC B;  3MGQ B;  4WU8 C;  2L5A A;  3AZL B;  3NQJ A;  3B0C W;  4H9N B;  3REJ B;  3REI A;  2CV5 C;  3B6F B;  4KUD C;  3AZE A;  3AZH A;  5B31 B;  5B40 B;  3NQU A;  3MGP B;  1TZY D;  1HQ3 A;  4XUJ D;  5AVC D;  2PYO B;  5F99 A; 
#chains in the Genus database with same CATH topology
 3X1U A;  3W99 D;  4R8P D;  3TU4 C;  1P3M C;  3KUY D;  2ARO B;  3UTA D;  2ZY4 A;  4Z66 D;  3KXB B;  3AZL D;  3REJ D;  3V9R B;  3MNN C;  2Y2M A;  2NQB C;  1TZY A;  3WA9 B;  3AZG B;  4XUJ A;  4ZUX C;  1N1J B;  1P3K D;  3W96 B;  3W98 A;  3REL C;  2HIO D;  2Y2Q A;  3X1V D;  3KUY A;  1ULY A;  3VH6 T;  4QLC A;  3X1S B;  3MGQ A;  1U35 B;  3AZN B;  3AZL A;  4YM6 D;  4H9N A;  3REJ A;  3B6F A;  5GSU D;  3AZJ C;  3KXB D;  5B31 A;  5GT3 D;  4KHA B;  5B40 A;  4XZQ C;  3AV2 C;  3B0C T;  5B1L B;  3MGP A;  4WU9 C;  1KX5 D;  1S32 B;  5GXQ C;  5DNM D;  3W96 D;  2PYO A;  5C3I B;  2W8S A;  2Y2N A;  3AZF C;  1P3F B;  2ARO A;  3X1S D;  3KXB A;  4NFT A;  3V9R A;  1B67 A;  1AOI D;  1HTA A;  2Y2O A;  5AY8 D;  3AZG A;  3WA9 A;  1N1J A;  4H9S A;  5FUG B;  4H9O B;  3W96 A;  2F2A C;  3REI C;  5B1L D;  3AZE C;  3AZH C;  1S32 D;  2NZD B;  2Y2L A;  3C1C D;  5KDM B;  3X1S A;  1HQ3 C;  1U35 A;  3AZN A;  1P3F D;  5F99 C;  3X1U C;  5B2J B;  3MGR B;  4KGC B;  3VH5 T;  4KHA A;  5B1L A;  5B2I D;  1S32 A;  5AV6 C;  2NZD D;  1P3F A;  1KX3 B;  3W98 C;  1M1A C;  2YFW B;  5B33 B;  4QLC C;  3MGQ C;  3C1B B;  5B2J D;  1P3I B;  4KGC D;  1WWS A;  2FJ7 D;  5FUG A;  4H9O A;  4Z5T D;  3B6F C;  3UTB B;  2NZD A;  5B31 C;  5B40 C;  4H9R B;  3MGP C;  1EQZ D;  5KDM A;  1KX3 D;  2PYO C;  2Y2P A;  5B2J A;  3MGR A;  4KGC A;  3LZ0 D;  3B6G B;  2ARO C;  5B0Y D;  1M19 B;  1M18 B;  3WA9 C;  3AZG C;  3A6N B;  4H9S C;  3W96 C;  1KX3 A;  5AVB D;  2YFW A;  3B0D B;  1P3L D;  1ZLA B;  5B33 A;  3C1B A;  3X1S C;  1U35 C;  1P3I A;  3AZN C;  5B32 B;  3UTB A;  1F66 B;  3AZM B;  5CPI B;  5AV8 D;  1KX4 D;  4H9R A;  1M18 D;  5CPJ C;  3WAA D;  4J8U B;  1P3F C;  1ZLA D;  3B6G A;  2ZY3 A;  4G91 B;  1M19 A;  5CPK D;  5B24 D;  5CP6 B;  5BT1 C;  1M18 A;  1F66 D;  2BYM B;  3MVD A;  4WZS B;  3A6N A;  3AZM D;  2RIQ A;  4CSR B;  3H0R C;  2NZD C;  3WKJ C;  1ZLA A;  5AVC B;  4AWL B;  3A1I A;  4R8P B;  3W99 B;  3AV1 D;  5B32 A;  1KU5 A;  2HUE B;  3LEL D;  1F66 A;  3MGR C;  3UTA B;  4Z66 B;  3AZM A;  2Y2K A;  5CPI A;  5CP6 D;  5B0Z D;  2DQN C;  4JJN D;  5GT0 D;  1P3P B;  1P3K B;  3W97 D;  5AV9 B;  2HIO B;  4J8U A;  3X1V B;  1KX3 C;  1P3B D;  2ZY5 A;  1P3A B;  4NE6 A;  5B33 C;  3C1B C;  3AN2 B;  3R45 B;  5CP6 A;  4YM6 B;  1P3I C;  2BYM A;  5GSU B;  5DNN D;  5GT3 B;  3UTB C;  4CSR A;  4WNN B;  1KX5 B;  3AZK C;  5AVC A;  5DNM B;  1P3P D;  2IO5 B;  5AV5 C;  5AV9 D;  4R8P A;  3W99 A;  1P3A D;  3UTA A;  4Z66 A;  3B6G C;  3AN2 D;  1M19 C;  3AZI D;  1AOI B;  5E5A D;  5AY8 B;  1P3P A;  1P3K A;  4H9P B;  5AV9 A;  3MVD C;  2HIO A;  3A6N C;  2F8N G;  5B1M D;  3X1V A;  2G5I C;  1P3A A;  3H0M C;  3C1C B;  2YFV B;  4X23 B;  1ZLA C;  2VQR A;  4J8X D;  3AN2 A;  1P3O D;  3R45 A;  4YM6 A;  5GSU A;  5B32 C;  3REH B;  3LZ1 D;  4YS3 D;  1A7W A;  5GT3 A;  1F66 C;  2RVQ C;  4WNN A;  1KX5 A;  5CPI C;  5B2I B;  2Y2I A;  3B0B A;  5DNM A;  3EPH A;  1TAF B;  2F8N D;  3EPJ A;  4J8V D;  4J8U C;  4X23 D;  3EPL A;  3REH D;  3REK D;  1AOI A;  5AY8 A;  2FJ7 B;  3MGS D;  4H9P A;  4Z5T B;  2Y2J A;  3KWQ B;  4EO5 B;  3C1C A;  1TZY C;  1EQZ B;  2JSS A;  2YFV A;  4X23 A;  3UT9 D;  4XUJ C;  5AVC C;  4AWL C;  4R8P C;  3W99 C;  3KUY C;  3REH A;  2HUE C;  3X1T B;  3O62 B;  3LZ0 B;  4J8W B;  4M6B A;  3UTA C;  5B0Y B;  4Z66 C;  5B2I A;  3AZL C;  3REJ C;  2F8N H;  2J8P A;  1TAF A;  3KWQ D;  1P3K C;  3AFA D;  2HIO C;  5AVB B;  3LJA B;  3X1V C;  3WTP D;  1P3L B;  3AL0 C;  2JCH A;  2BYK B;  1P34 D;  5BS7 A;  1H3O B;  3X1T D;  3AN2 C;  3O62 D;  4YM6 C;  2FJ7 A;  4J8W D;  2G5H C;  4Z5T A;  5GSU C;  3KXB C;  3KWQ A;  5GT3 C;  5AV8 B;  1KX4 B;  1KX5 C;  1P3M B;  1EQZ A;  5DNM C;  3WAA B;  2IO5 C;  3AYW D;  4LD9 D;  1P3G B;  3IP4 C;  3LJA D;  4WU8 D;  4WJ3 C;  3X1T A;  3O62 A;  3LZ0 A;  4J8W A;  4ZBJ B;  2CV5 D;  4KUD D;  5B0Y A;  3EPK A;  5CPK B;  5B24 B;  4UUZ B;  3REL B;  1AOI C;  5AY8 C;  5AVB A;  3LJA A;  5B1L C;  3TU4 D;  1P3M D;  1S32 C;  1P3L A;  1P3G D;  5C3I C;  3C1C C;  1BFM A;  2BYK A;  5CHL B;  1H3O A;  3AV1 B;  3LEL B;  4XZQ B;  3MNN D;  3REH C;  2NQB D;  4ZUX D;  5AV8 A;  3REL D;  1KX4 A;  5B0Z B;  1P3M A;  5B2I C;  3WAA A;  4JJN B;  1P3G A;  5GT0 B;  3W97 B;  1P3B B;  2CWE A;  4DRA A;  3AZJ D;  5CPK A;  5B24 A;  4XZQ D;  4UUZ A;  3REL A;  3AV2 D;  5B2J C;  4WU9 D;  4KGC C;  2ZM5 A;  5GXQ D;  2FJ7 C;  4Z5T C;  5DNN B;  3AZF D;  3H0L C;  3KWQ C;  4EO5 C;  1EQZ C;  2FFF B;  3AV1 A;  3LEL A;  4XZQ A;  3LZ0 C;  3REI D;  5B0Z A;  5AV6 B;  5B0Y C;  3AZE D;  3AZI B;  3AZH D;  5E5A B;  4JJN A;  5GT0 A;  3W97 A;  1HQ3 D;  1M1A B;  5G49 B;  5B1M B;  5F99 D;  5AVB C;  5JA4 B;  3X1U D;  4DQY B;  1P3B A;  4NE5 A;  1P3L C;  1Z2C B;  4J8X B;  5B31 G;  1P3O B;  1B6W A;  3LZ1 B;  4YS3 B;  5DNN A;  5AV6 D;  2DF4 C;  5AV8 C;  3W98 D;  1KX4 C;  1M18 C;  1M1A D;  3WAA C;  1R4V A;  1P3G C;  4QLC D;  3MGQ D;  2F8N B;  4J8V B;  3B0D C;  3B6F D;  4ZBJ C;  5AV6 A;  3AZI A;  5B31 D;  5B24 C;  5B40 D;  3REK B;  5E5A A;  4HGA B;  5CPK C;  4DRB A;  3MGP D;  3MGS B;  1PZR A;  2UWX A;  1M1A A;  5BO0 B;  3AZM C;  5G49 A;  5B1M A;  2PYO D;  5JA4 A;  3VH5 W;  3UT9 B;  4J8X A;  2ARO D;  1P3O A;  3AV1 C;  3LEL C;  3LZ1 A;  4YS3 A;  4G91 C;  5BNV B;  3WA9 D;  3AZG D;  5CPJ B;  4E44 A;  5CP6 C;  5B0Z C;  4E45 A;  1BH9 B;  4JJN C;  5GT0 C;  1ID3 B;  3W97 C;  2F8N A;  3AFA B;  1U35 D;  4J8V A;  3AZN D;  2JE5 A;  1P3B C;  3WTP B;  1P34 B;  3REK A;  1BH8 B;  5JRG B;  3MGS A;  5CPJ D;  5BO0 A;  3WKJ B;  5DNN C;  4WV4 B;  4H9Q B;  2BG1 A;  4G92 B;  3UT9 A;  1P3P C;  1ID3 D;  4LD9 B;  3AYW B;  5AV9 C;  4WU8 B;  1P3A C;  5BT1 D;  2ZY2 A;  5BNV A;  2CV5 B;  5CPJ A;  4KUD B;  2F8N K;  1W2E A;  5JRG D;  3AZI C;  1BH9 A;  3WTP E;  5E5A C;  3WKJ D;  1ID3 A;  3AFA A;  3P5J B;  3TU4 B;  5B1M C;  3WTP A;  3EG5 B;  3MGR D;  1P34 A;  4J8X C;  1P3O C;  3FDD A;  1BH8 A;  5JRG A;  3MNN B;  2NQB B;  3AZK B;  3WKJ A;  4ZUX B;  4YS3 C;  3LZ1 C;  5AV5 B;  4H9Q A;  5BNX B;  4LD9 A;  2Y2G A;  3AYW A;  1T3U A;  4WU8 A;  1JFI B;  3VH6 A;  5B33 D;  3C1B D;  4Z2M G;  1P3I D;  4J8V C;  2CV5 A;  4X23 C;  3AZJ B;  4KUD A;  3UTB D;  4CAY B;  3MVD B;  3AV2 B;  3REK C;  3AZK D;  4WU9 B;  4HGA C;  2XD5 A;  5GXQ B;  3MGS C;  5AV5 D;  3KSY A;  3TU4 A;  2LY8 A;  3AZF B;  5B32 G;  2Y2H A;  3UT9 C;  3B6G D;  1M19 D;  3MNN A;  2NQB A;  3AZK A;  3KFU G;  4ZUX A;  3NQJ B;  3MVD D;  5AV5 A;  3REI B;  3A6N D;  5BS7 C;  3AZE B;  3AZH B;  1WWI A;  5BNX A;  3NQU B;  4UPK A;  1HQ3 B;  1JFI A;  1ID3 C;  5F99 B;  3AFA C;  3X1U B;  5B32 D;  3AZJ A;  3WTP C;  4NE3 A;  4CAY A;  2RVQ D;  3F6T A;  3VH5 A;  3AV2 A;  1P34 C;  4WU9 A;  5CPI D;  3X1T C;  3O62 C;  5GXQ A;  4J8W C;  5JRG C;  1TZY B;  4XUJ B;  3AZF A;  3W98 B;  3VH6 W;  4J8U D;  1Q9C A;  4G92 C;  3KUY B;  1F1E A;  4LD9 C;  3AYW C;  3LJA C;  4Z2M H;  4QLC B;  3MGQ B;  4WU8 C;  2L5A A;  3AZL B;  3NQJ A;  3B0C W;  4H9N B;  3REJ B;  3REI A;  2CV5 C;  3B6F B;  4KUD C;  3A1K A;  3AZE A;  3AZH A;  5B31 B;  5B40 B;  3NQU A;  2XD1 A;  3MGP B;  1TZY D;  1HQ3 A;  4XUJ D;  5AVC D;  2PYO B;  5F99 A; 
#chains in the Genus database with same CATH homology
 3X1U A;  3W99 D;  4R8P D;  3TU4 C;  1P3M C;  3KUY D;  2ARO B;  3UTA D;  2ZY4 A;  4Z66 D;  3KXB B;  3AZL D;  3REJ D;  3V9R B;  3MNN C;  2Y2M A;  2NQB C;  1TZY A;  3WA9 B;  3AZG B;  4XUJ A;  4ZUX C;  1N1J B;  1P3K D;  3W96 B;  3W98 A;  3REL C;  2HIO D;  2Y2Q A;  3X1V D;  3KUY A;  1ULY A;  3VH6 T;  4QLC A;  3X1S B;  3MGQ A;  1U35 B;  3AZN B;  3AZL A;  4YM6 D;  4H9N A;  3REJ A;  3B6F A;  5GSU D;  3AZJ C;  3KXB D;  5B31 A;  5GT3 D;  4KHA B;  5B40 A;  4XZQ C;  3AV2 C;  3B0C T;  5B1L B;  3MGP A;  4WU9 C;  1KX5 D;  1S32 B;  5GXQ C;  5DNM D;  3W96 D;  2PYO A;  5C3I B;  2W8S A;  2Y2N A;  3AZF C;  1P3F B;  2ARO A;  3X1S D;  3KXB A;  4NFT A;  3V9R A;  1B67 A;  1AOI D;  1HTA A;  2Y2O A;  5AY8 D;  3AZG A;  3WA9 A;  1N1J A;  4H9S A;  5FUG B;  4H9O B;  3W96 A;  2F2A C;  3REI C;  5B1L D;  3AZE C;  3AZH C;  1S32 D;  2NZD B;  2Y2L A;  3C1C D;  5KDM B;  3X1S A;  1HQ3 C;  1U35 A;  3AZN A;  1P3F D;  5F99 C;  3X1U C;  5B2J B;  3MGR B;  4KGC B;  3VH5 T;  4KHA A;  5B1L A;  5B2I D;  1S32 A;  5AV6 C;  2NZD D;  1P3F A;  1KX3 B;  3W98 C;  1M1A C;  2YFW B;  5B33 B;  4QLC C;  3MGQ C;  3C1B B;  5B2J D;  1P3I B;  4KGC D;  1WWS A;  2FJ7 D;  5FUG A;  4H9O A;  4Z5T D;  3B6F C;  3UTB B;  2NZD A;  5B31 C;  5B40 C;  4H9R B;  3MGP C;  1EQZ D;  5KDM A;  1KX3 D;  2PYO C;  2Y2P A;  5B2J A;  3MGR A;  4KGC A;  3LZ0 D;  3B6G B;  2ARO C;  5B0Y D;  1M19 B;  1M18 B;  3WA9 C;  3AZG C;  3A6N B;  4H9S C;  3W96 C;  1KX3 A;  5AVB D;  2YFW A;  3B0D B;  1P3L D;  1ZLA B;  5B33 A;  3C1B A;  3X1S C;  1U35 C;  1P3I A;  3AZN C;  5B32 B;  3UTB A;  1F66 B;  3AZM B;  5CPI B;  5AV8 D;  1KX4 D;  4H9R A;  1M18 D;  5CPJ C;  3WAA D;  4J8U B;  1P3F C;  1ZLA D;  3B6G A;  2ZY3 A;  4G91 B;  1M19 A;  5CPK D;  5B24 D;  5CP6 B;  5BT1 C;  1M18 A;  1F66 D;  2BYM B;  3MVD A;  4WZS B;  3A6N A;  3AZM D;  2RIQ A;  4CSR B;  3H0R C;  2NZD C;  3WKJ C;  1ZLA A;  5AVC B;  4AWL B;  3A1I A;  4R8P B;  3W99 B;  3AV1 D;  5B32 A;  1KU5 A;  2HUE B;  3LEL D;  1F66 A;  3MGR C;  3UTA B;  4Z66 B;  3AZM A;  2Y2K A;  5CPI A;  5CP6 D;  5B0Z D;  2DQN C;  4JJN D;  5GT0 D;  1P3P B;  1P3K B;  3W97 D;  5AV9 B;  2HIO B;  4J8U A;  3X1V B;  1KX3 C;  1P3B D;  2ZY5 A;  1P3A B;  4NE6 A;  5B33 C;  3C1B C;  3AN2 B;  3R45 B;  5CP6 A;  4YM6 B;  1P3I C;  2BYM A;  5GSU B;  5DNN D;  5GT3 B;  3UTB C;  4CSR A;  4WNN B;  1KX5 B;  3AZK C;  5AVC A;  5DNM B;  1P3P D;  2IO5 B;  5AV5 C;  5AV9 D;  4R8P A;  3W99 A;  1P3A D;  3UTA A;  4Z66 A;  3B6G C;  3AN2 D;  1M19 C;  3AZI D;  1AOI B;  5E5A D;  5AY8 B;  1P3P A;  1P3K A;  4H9P B;  5AV9 A;  3MVD C;  2HIO A;  3A6N C;  2F8N G;  5B1M D;  3X1V A;  2G5I C;  1P3A A;  3H0M C;  3C1C B;  2YFV B;  4X23 B;  1ZLA C;  2VQR A;  4J8X D;  3AN2 A;  1P3O D;  3R45 A;  4YM6 A;  5GSU A;  5B32 C;  3REH B;  3LZ1 D;  4YS3 D;  1A7W A;  5GT3 A;  1F66 C;  2RVQ C;  4WNN A;  1KX5 A;  5CPI C;  5B2I B;  2Y2I A;  3B0B A;  5DNM A;  3EPH A;  1TAF B;  2F8N D;  3EPJ A;  4J8V D;  4J8U C;  4X23 D;  3EPL A;  3REH D;  3REK D;  1AOI A;  5AY8 A;  2FJ7 B;  3MGS D;  4H9P A;  4Z5T B;  2Y2J A;  3KWQ B;  4EO5 B;  3C1C A;  1TZY C;  1EQZ B;  2JSS A;  2YFV A;  4X23 A;  3UT9 D;  4XUJ C;  5AVC C;  4AWL C;  4R8P C;  3W99 C;  3KUY C;  3REH A;  2HUE C;  3X1T B;  3O62 B;  3LZ0 B;  4J8W B;  4M6B A;  3UTA C;  5B0Y B;  4Z66 C;  5B2I A;  3AZL C;  3REJ C;  2F8N H;  2J8P A;  1TAF A;  3KWQ D;  1P3K C;  3AFA D;  2HIO C;  5AVB B;  3LJA B;  3X1V C;  3WTP D;  1P3L B;  3AL0 C;  2JCH A;  2BYK B;  1P34 D;  5BS7 A;  1H3O B;  3X1T D;  3AN2 C;  3O62 D;  4YM6 C;  2FJ7 A;  4J8W D;  2G5H C;  4Z5T A;  5GSU C;  3KXB C;  3KWQ A;  5GT3 C;  5AV8 B;  1KX4 B;  1KX5 C;  1P3M B;  1EQZ A;  5DNM C;  3WAA B;  2IO5 C;  3AYW D;  4LD9 D;  1P3G B;  3IP4 C;  3LJA D;  4WU8 D;  4WJ3 C;  3X1T A;  3O62 A;  3LZ0 A;  4J8W A;  4ZBJ B;  2CV5 D;  4KUD D;  5B0Y A;  3EPK A;  5CPK B;  5B24 B;  4UUZ B;  3REL B;  1AOI C;  5AY8 C;  5AVB A;  3LJA A;  5B1L C;  3TU4 D;  1P3M D;  1S32 C;  1P3L A;  1P3G D;  5C3I C;  3C1C C;  1BFM A;  2BYK A;  5CHL B;  1H3O A;  3AV1 B;  3LEL B;  4XZQ B;  3MNN D;  3REH C;  2NQB D;  4ZUX D;  5AV8 A;  3REL D;  1KX4 A;  5B0Z B;  1P3M A;  5B2I C;  3WAA A;  4JJN B;  1P3G A;  5GT0 B;  3W97 B;  1P3B B;  2CWE A;  4DRA A;  3AZJ D;  5CPK A;  5B24 A;  4XZQ D;  4UUZ A;  3REL A;  3AV2 D;  5B2J C;  4WU9 D;  4KGC C;  2ZM5 A;  5GXQ D;  2FJ7 C;  4Z5T C;  5DNN B;  3AZF D;  3H0L C;  3KWQ C;  4EO5 C;  1EQZ C;  2FFF B;  3AV1 A;  3LEL A;  4XZQ A;  3LZ0 C;  3REI D;  5B0Z A;  5AV6 B;  5B0Y C;  3AZE D;  3AZI B;  3AZH D;  5E5A B;  4JJN A;  5GT0 A;  3W97 A;  1HQ3 D;  1M1A B;  5G49 B;  5B1M B;  5F99 D;  5AVB C;  5JA4 B;  3X1U D;  4DQY B;  1P3B A;  4NE5 A;  1P3L C;  1Z2C B;  4J8X B;  5B31 G;  1P3O B;  1B6W A;  3LZ1 B;  4YS3 B;  5DNN A;  5AV6 D;  2DF4 C;  5AV8 C;  3W98 D;  1KX4 C;  1M18 C;  1M1A D;  3WAA C;  1R4V A;  1P3G C;  4QLC D;  3MGQ D;  2F8N B;  4J8V B;  3B0D C;  3B6F D;  4ZBJ C;  5AV6 A;  3AZI A;  5B31 D;  5B24 C;  5B40 D;  3REK B;  5E5A A;  4HGA B;  5CPK C;  4DRB A;  3MGP D;  3MGS B;  1PZR A;  2UWX A;  1M1A A;  5BO0 B;  3AZM C;  5G49 A;  5B1M A;  2PYO D;  5JA4 A;  3VH5 W;  3UT9 B;  4J8X A;  2ARO D;  1P3O A;  3AV1 C;  3LEL C;  3LZ1 A;  4YS3 A;  4G91 C;  5BNV B;  3WA9 D;  3AZG D;  5CPJ B;  4E44 A;  5CP6 C;  5B0Z C;  4E45 A;  1BH9 B;  4JJN C;  5GT0 C;  1ID3 B;  3W97 C;  2F8N A;  3AFA B;  1U35 D;  4J8V A;  3AZN D;  2JE5 A;  1P3B C;  3WTP B;  1P34 B;  3REK A;  1BH8 B;  5JRG B;  3MGS A;  5CPJ D;  5BO0 A;  3WKJ B;  5DNN C;  4WV4 B;  4H9Q B;  2BG1 A;  4G92 B;  3UT9 A;  1P3P C;  1ID3 D;  4LD9 B;  3AYW B;  5AV9 C;  4WU8 B;  1P3A C;  5BT1 D;  2ZY2 A;  5BNV A;  2CV5 B;  5CPJ A;  4KUD B;  2F8N K;  1W2E A;  5JRG D;  3AZI C;  1BH9 A;  3WTP E;  5E5A C;  3WKJ D;  1ID3 A;  3AFA A;  3P5J B;  3TU4 B;  5B1M C;  3WTP A;  3EG5 B;  3MGR D;  1P34 A;  4J8X C;  1P3O C;  3FDD A;  1BH8 A;  5JRG A;  3MNN B;  2NQB B;  3AZK B;  3WKJ A;  4ZUX B;  4YS3 C;  3LZ1 C;  5AV5 B;  4H9Q A;  5BNX B;  4LD9 A;  2Y2G A;  3AYW A;  1T3U A;  4WU8 A;  1JFI B;  3VH6 A;  5B33 D;  3C1B D;  4Z2M G;  1P3I D;  4J8V C;  2CV5 A;  4X23 C;  3AZJ B;  4KUD A;  3UTB D;  4CAY B;  3MVD B;  3AV2 B;  3REK C;  3AZK D;  4WU9 B;  4HGA C;  2XD5 A;  5GXQ B;  3MGS C;  5AV5 D;  3KSY A;  3TU4 A;  2LY8 A;  3AZF B;  5B32 G;  2Y2H A;  3UT9 C;  3B6G D;  1M19 D;  3MNN A;  2NQB A;  3AZK A;  3KFU G;  4ZUX A;  3NQJ B;  3MVD D;  5AV5 A;  3REI B;  3A6N D;  5BS7 C;  3AZE B;  3AZH B;  1WWI A;  5BNX A;  3NQU B;  4UPK A;  1HQ3 B;  1JFI A;  1ID3 C;  5F99 B;  3AFA C;  3X1U B;  5B32 D;  3AZJ A;  3WTP C;  4NE3 A;  4CAY A;  2RVQ D;  3F6T A;  3VH5 A;  3AV2 A;  1P34 C;  4WU9 A;  5CPI D;  3X1T C;  3O62 C;  5GXQ A;  4J8W C;  5JRG C;  1TZY B;  4XUJ B;  3AZF A;  3W98 B;  3VH6 W;  4J8U D;  1Q9C A;  4G92 C;  3KUY B;  1F1E A;  4LD9 C;  3AYW C;  3LJA C;  4Z2M H;  4QLC B;  3MGQ B;  4WU8 C;  2L5A A;  3AZL B;  3NQJ A;  3B0C W;  4H9N B;  3REJ B;  3REI A;  2CV5 C;  3B6F B;  4KUD C;  3A1K A;  3AZE A;  3AZH A;  5B31 B;  5B40 B;  3NQU A;  2XD1 A;  3MGP B;  1TZY D;  1HQ3 A;  4XUJ D;  5AVC D;  2PYO B;  5F99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...