3KXBA

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
RPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 92
sequence length 92
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbA00
3REJA 1AOIC 4ZUXB 1M19C 4NFTA 3X1TC 1S32C 4ZUXD 5B33D 5AV8A 3AZID 1P3BD 3REJC 3UTAC 4J8UB 1P3GC 3AZGA 1HQ3C 2L5AA 5GT3B 3AZNA 3WKJA 1P3KA 5B32B 5DNNA 5GT3D 5B24C 5FUGB 1ID3D 4X23B 3AZNC 5B32D 5CPKD 3AZLA 1P3KC 5DNNC 1ZLAD 5AVCB 1U35A 2CWEA 1P3FA 1KX3B 3B0DC 1KX5D 5AVCD 5AV5A 3LZ1A 4J8WC 3AZFD 5CP6A 4G91C 3MNND 4LD9A 3R45B 5B1MD 3AZJD 2HIOD 5GXQA 2NQBB 5B0YB 3LZ1C 4XZQA 4LD9C 1F66B 4WNNB 2NQBD 5B0YD 3WA9B 4XUJA 4Z5TD 4H9RA 5E5AC 5BT1C 5CPJC 3MGSB 1TAFA 3V9RB 4XUJC 3UT9A 5BNXA 2PYOC 4WV4B 4KHAA 3UT9C 2FJ7C 1H3OA 3W99A 3AFAB 1P3LB 1BH9A 1P3PB 3W99C 3KXBB 3KSYA 1Q9CA 3VH6W 3B6FA 5B1LC 2CV5A 5BO0A 3LZ0B 2NZDC 4YM6B 4ZBJB 2AROB 5C3IB 3MVDA 4YM6D 3VH6T 5FUGA 5B0ZD 3MVDC 4X23A 3MGRD 3AYWD 5GT0B 3AZKC 5AV9B 4H9PA 3AZED 1KX3A 5B40A 5AV9D 4H9OB 3REKB 3AN2D 3W96A 5CPIA 1TZYD 3REKD 1AOIB 5B31D 1BH8B 3REHD 1M18C 3A6ND 3LJAA 5CPIC 4Z66D 1S32B 3B6GC 1A7WA 3TU4C 3REJB 3UTAB 4QLCC 1F66A 1P3GB 1HQ3B 3W98A 5AV8B 3RELC 5AV8D 3W98C 5B24B 3AZGD 5BS7C 3AZNB 3WKJB 4J8VD 1P3KB 1EQZA 5DNNB 3WKJD 4YS3D 5AV6C 1P3AA 1P3KD 3B0DB 3AZLB 3AFAA 1EQZC 3C1BC 4J8WB 1P3AC 1P3PA 1KU5A 5JRGA 3AZLD 2F8NA 3AZMC 3REIC 3AV1A 1U35D 1P3FD 1KX4D 5AV5B 3LZ1B 5JRGC 3MGQC 4LD9B 5AV5D 3LZ1D 4R8PC 3AV1C 5CP6D 2AROA 3NQJB 5GSUA 4XZQB 3W97C 4H9NA 3X1SC 4KGCC 5CPJB 5GXQD 1M1AD 1WWIA 4XZQD 3WAAA 1R4VA 2RVQD 5BT1D 5GSUC 4XUJB 1TAFB 2YFWA 4XUJD 4J8XA 3VH5W 2PYOB 3UT9B 2FJ7B 5BNXB 3KWQD 1P3ID 4KHAB 3VH5T 1M19A 4H9SA 3AZHC 3X1TA 1H3OB 1S32A 3W99B 3UTAA 1P3MA 1BH9B 4H9SC 5B1LB 3WTPC 1HQ3A 1P3GA 2NZDB 1P3MC 3B6FB 4CAYA 2CV5B 5BO0B 5B24A 4J8UD 3B6FD 2CV5D 3MVDB 4H9PB 4X23D 4J8WA 4E44A 5B40B 1M18B 3W96B 5CPIB 1KX3D 5B40D 3TU4B 3W96D 4QLCB 5CPID 3X1VC 5AY8C 4KUDC 3LJAB 5BNVA 3NQJA 3X1UC 3MGPC 5E5AA 3LJAD 5CPJA 3W98B 1F66D 3WA9D 3W98D 3UTBC 2PYOA 4JJNA 2FJ7A 3MGSD 3KUYA 2HUEC 4JJNC 3AV2A 1EQZB 3NQUB 3KUYC 3C1BB 5F99A 1P3AB 1EQZD 5KDMA 3AZMB 3REIB 3AV2C 5F99C 5B1LA 5JRGB 3AFAD 1P3LD 2F8NB 2NZDA 3AV1B 4R8PB 1P3PD 2F8ND 3W97B 3KXBD 3X1SB 1N1JA 5AVBC 4NE6A 3LZ0D 5GSUB 4DRAA 5B32G 4H9NB 3AZKA 2AROD 5B2IC 3WAAB 4UUZB 5DNMC 1P34A 3WAAD 2YFWB 4J8XB 5GT0D 4NE3A 1P34C 5B33A 4J8XD 3AZHB 3AZIA 1P3BA 1M18A 1JFIA 3B6GA 3TU4A 5B2JA 1M19B 4QLCA 4WZSB 5B33C 3AZIC 3WTPB 3X1TB 1P3BC 1AOID 1M19D 3X1TD 1P3MB 5B2JC 3RELA 1S32D 2IO5C 3REJD 3UTAD 5CPKA 1P3GD 1HQ3D 5BS7A 5GT3C 4CAYB 1ID3C 5B32C 3C1CA 5AV6A 5CPKC 5B24D 1ZLAC 3AZFA 3C1CC 3NQUA 5B1MA 3AZJA 3C1BA 3AZND 1KX5C 2HIOA 5DNND 3AZFC 3AZMA 3REIA 3MNNC 3AZJC 1B6WA 5B1MC 2HIOC 4G91B 3MGQA 5AY8B 4J8WD 4R8PA 2NQBC 3W97A 3X1SA 4KGCA 4Z5TC 5BNVB 4LD9D 5E5AB 3UTBB 4UUZA 5E5AD 5CPJD 3LELA 5CHLB 2HUEB 4JJNB 1F1EA 5B31G 3LELC 3KUYB 3AZHA 2PYOD 2BYKA 4EO5C 3UT9D 2FJ7D 3AV2B 3KUYD 5F99B 3WTPA 5KDMB 3O62A 4WU9A 3W99D 3VH6A 5B0ZA 3MGRA 5B1LD 4YM6C 3O62C 4WU9C 4ZBJC 5C3IC 2NZDD 1N1JB 5B0ZC 3AZEA 3MGRC 3AYWC 5DNMB 3AN2A 1TZYA 3AZKB 3AZEC 5AV9C 3MVDD 4G92C 3REHA 3A6NA 3AZKD 3AN2C 4Z66A 1P34B 1TZYC 1P3OA 3REKC 5B31C 3REHC 1P34D 3A6NC 4Z66C 4AWLC 5B33B 3AZIB 3X1VA 5AY8A 1P3BB 1P3OC 1JFIB 3B6GB 4KUDA 5G49A 3X1UA 3MGPA 1M18D 5B2JB 3WTPE 3B6GD 2IO5B 3TU4D 5B2JD 4QLCD 5AV8C 4J8VA 1ULYA 2BYMA 4E45A 4WU8A 3RELB 1ID3B 3UTBA 4YS3A 3AZGC 3RELD 4J8VC 5CPKB 4WU8C 1ZLAB 3WKJC 4YS3C 3C1CB 5AV6B 1KX5B 1KX4A 3B0CW 3C1CD 3AZFB 5AV6D 3MNNB 4H9QB 3AZLC 3AZJB 5B1MB 2HIOB 1U35C 2JSSA 1P3FC 1KX4C 3C1BD 3B0CT 1P3AD 5AV5C 1M1AA 3AZMD 5CP6C 1HTAA 3MGQB 3REID 4Z5TB 5AVBA 5JRGD 3MGQD 5GXQC 2YFVA 4XZQC 1M1AC 3AV1D 4R8PD 4KGCB 2RVQC 5B2IA 3W97D 3KWQA 3X1SD 5DNMA 4KGCD 4CSRA 1P3IA 4HGAC 5GSUD 3VH5A 3KWQC 5JA4B 1P3IC 3LELB 4EO5B 3LELD 3B0BA 4ZUXA 2BYKB 3AZHD 4DRBA 2LY8A 4ZUXC 4J8UA 3WTPD 3O62B 4WU9B 5GT3A 4J8UC 1ID3A 5B0ZB 3B6FC 2CV5C 3MGRB 3O62D 1P3MD 5B32A 4WU9D 3AYWB 1ZLAA 4Z2MG 3AZEB 1B67A 4G92B 1KX5A 5AVCA 3AN2B 2F8NK 4X23C 1TZYB 4M6BA 3MNNA 4H9QA 5B31B 3REHB 5AVCC 3A6NB 4Z66B 4AWLB 1KX3C 5B40C 3R45A 1P3OB 3W96C 2F8NG 2NQBA 5B0YA 1P3OD 4Z5TA 3X1VB 4KUDB 4WNNA 3WA9A 5G49B 3LJAC 3X1UB 5B0YC 3X1VD 5AY8D 3MGPB 4KUDD 1BFMA 3X1UD 3MGSA 3V9RA 1F66C 3AZGB 3WA9C 3MGPD 4J8VB 2BYMB 4WU8B 3MGSC 4YS3B 5JA4A 4WU8D 3UTBD 1P3LA 1U35B 4JJND 1P3FB 1KX4B 3KXBA 3AFAC 1P3LC 1P3PC 3AV2D 5CP6B 3LZ0A 4Z2MH 3KXBC 5F99D 4YM6A 5GXQB 1M1AB 3LZ0C 5AVBB 3AYWA 2AROC 2YFVB 5AVBD 4H9RB 4HGAB 5GT0A 5AV9A 4NE5A 5B2IB 3KWQB 3WAAC 2F8NH 4CSRB 1P3IB 5B2ID 4H9OA 5GT0C 3REKA 5DNMD 5B31A 4J8XC 1WWSA 1AOIA 1BH8A
chains in the Genus database with same CATH superfamily
2Y2OA 3REJA 1AOIC 4ZUXB 1M19C 4NFTA 3X1TC 1S32C 4ZUXD 5B33D 3FDDA 5AV8A 3AZID 1P3BD 3REJC 3UTAC 4J8UB 1P3GC 3AZGA 1HQ3C 2L5AA 3IP4C 5GT3B 3AZNA 3WKJA 2XD5A 1P3KA 5B32B 5DNNA 5GT3D 5B24C 5FUGB 1ID3D 4X23B 3AZNC 5B32D 5CPKD 3AZLA 1P3KC 5DNNC 2Y2MA 1ZLAD 5AVCB 1U35A 2CWEA 1P3FA 1KX3B 3B0DC 1KX5D 5AVCD 2ZY5A 5AV5A 3LZ1A 4J8WC 3AZFD 5CP6A 4G91C 3MNND 4LD9A 3R45B 5B1MD 3AZJD 2HIOD 5GXQA 2NQBB 5B0YB 3LZ1C 4XZQA 4LD9C 1F66B 4WNNB 2NQBD 5B0YD 3WA9B 4XUJA 4Z5TD 4H9RA 5E5AC 5BT1C 5CPJC 3MGSB 1TAFA 3V9RB 4XUJC 3UT9A 5BNXA 2PYOC 4WV4B 3H0LC 4KHAA 3UT9C 2FJ7C 2VQRA 1H3OA 3W99A 2FFFB 3AFAB 1P3LB 1BH9A 1P3PB 3W99C 3KXBB 3KSYA 1Q9CA 3VH6W 3B6FA 5B1LC 2CV5A 5BO0A 3LZ0B 2NZDC 4YM6B 4ZBJB 1Z2CB 2AROB 5C3IB 3MVDA 2BG1A 4YM6D 3VH6T 5FUGA 5B0ZD 3MVDC 4X23A 3MGRD 3AYWD 5GT0B 3AZKC 5AV9B 4H9PA 3AZED 1KX3A 5B40A 2Y2JA 5AV9D 4H9OB 3REKB 3AN2D 3W96A 5CPIA 2XD1A 1TZYD 3REKD 1AOIB 5B31D 1BH8B 3REHD 1M18C 3A6ND 3LJAA 5CPIC 4Z66D 1S32B 2JCHA 3B6GC 1A7WA 3TU4C 3REJB 3UTAB 4QLCC 1F66A 1P3GB 1HQ3B 3W98A 5AV8B 3RELC 1W2EA 5AV8D 3W98C 5B24B 3AZGD 5BS7C 3AZNB 3WKJB 4J8VD 1P3KB 1EQZA 5DNNB 3WKJD 4YS3D 5AV6C 1P3AA 1P3KD 3B0DB 3AZLB 3AFAA 1EQZC 3C1BC 4J8WB 1P3AC 1P3PA 1KU5A 5JRGA 3AZLD 2F8NA 3AZMC 3REIC 3AV1A 1U35D 1P3FD 1KX4D 5AV5B 3LZ1B 5JRGC 3MGQC 4LD9B 5AV5D 2ZY3A 3LZ1D 4R8PC 3AV1C 5CP6D 2AROA 3NQJB 5GSUA 4XZQB 3W97C 4H9NA 3X1SC 4KGCC 5CPJB 5GXQD 1M1AD 1WWIA 4XZQD 3WAAA 1R4VA 2G5IC 2RVQD 2Y2KA 5BT1D 5GSUC 4XUJB 1TAFB 2YFWA 4XUJD 4J8XA 3VH5W 2PYOB 3UT9B 2FJ7B 5BNXB 3KWQD 1P3ID 2Y2IA 4KHAB 3VH5T 1M19A 4H9SA 3AZHC 3X1TA 1H3OB 2W8SA 1S32A 3W99B 2Y2NA 3UTAA 1P3MA 1BH9B 4H9SC 5B1LB 3WTPC 1HQ3A 1P3GA 2NZDB 1P3MC 3B6FB 4CAYA 2CV5B 5BO0B 5B24A 4J8UD 3B6FD 2CV5D 3MVDB 3EPJA 4H9PB 4X23D 4J8WA 4E44A 5B40B 1M18B 3W96B 5CPIB 1KX3D 5B40D 3TU4B 3W96D 4QLCB 5CPID 3X1VC 5AY8C 4KUDC 3LJAB 5BNVA 3NQJA 3X1UC 3MGPC 5E5AA 3LJAD 5CPJA 3W98B 1F66D 3WA9D 3W98D 4WJ3C 3UTBC 2PYOA 4JJNA 2FJ7A 3AL0C 3MGSD 3KUYA 2ZY2A 2HUEC 4JJNC 3AV2A 1EQZB 3NQUB 3KUYC 3C1BB 5F99A 1P3AB 1EQZD 5KDMA 3AZMB 3REIB 3AV2C 5F99C 2UWXA 5B1LA 5JRGB 3AFAD 1P3LD 2F8NB 2NZDA 3AV1B 4R8PB 1P3PD 3H0MC 2F8ND 3W97B 3KXBD 3X1SB 1N1JA 3P5JB 5AVBC 4NE6A 3LZ0D 5GSUB 4DRAA 5B32G 4H9NB 4UPKA 3AZKA 2AROD 5B2IC 2ZY4A 3WAAB 4UUZB 5DNMC 1PZRA 1P34A 3WAAD 2YFWB 4J8XB 5GT0D 4NE3A 1P34C 5B33A 4J8XD 3AZHB 3AZIA 1P3BA 1M18A 1JFIA 3B6GA 3TU4A 5B2JA 1M19B 4QLCA 4WZSB 5B33C 3AZIC 3WTPB 3X1TB 1P3BC 1AOID 1M19D 3X1TD 1P3MB 5B2JC 3RELA 1S32D 2IO5C 3REJD 3UTAD 5CPKA 1P3GD 1HQ3D 5BS7A 5GT3C 4CAYB 1ID3C 5B32C 3C1CA 5AV6A 5CPKC 5B24D 1ZLAC 3AZFA 3C1CC 3NQUA 5B1MA 3AZJA 3C1BA 3AZND 2Y2PA 2HIOA 1KX5C 3EPHA 5DNND 3AZFC 3AZMA 3REIA 3MNNC 3AZJC 1B6WA 5B1MC 2HIOC 4G91B 3MGQA 5AY8B 4J8WD 4R8PA 2NQBC 3W97A 3X1SA 4KGCA 4Z5TC 5BNVB 4LD9D 5E5AB 3UTBB 4UUZA 5E5AD 5CPJD 3LELA 5CHLB 2HUEB 4JJNB 1F1EA 5B31G 3LELC 3KUYB 3AZHA 2PYOD 2BYKA 4EO5C 3UT9D 2FJ7D 3AV2B 3KUYD 2JE5A 5F99B 3WTPA 5KDMB 3O62A 4WU9A 3W99D 3VH6A 5B0ZA 2DF4C 3MGRA 5B1LD 4YM6C 3O62C 4WU9C 4ZBJC 5C3IC 2NZDD 1N1JB 5B0ZC 3AZEA 3MGRC 3AYWC 5DNMB 3AN2A 1TZYA 3AZKB 3AZEC 5AV9C 3MVDD 3A1KA 4G92C 3REHA 3A6NA 3AZKD 3AN2C 4Z66A 1P34B 1TZYC 1P3OA 3REKC 5B31C 3REHC 1P34D 3A6NC 4Z66C 4AWLC 5B33B 3AZIB 3X1VA 5AY8A 1P3BB 1P3OC 1JFIB 2Y2LA 3B6GB 5G49A 4KUDA 3X1UA 3MGPA 1M18D 5B2JB 3WTPE 3B6GD 2IO5B 3TU4D 5B2JD 4QLCD 5AV8C 4J8VA 1ULYA 2BYMA 4E45A 4WU8A 3RELB 2Y2HA 3UTBA 4YS3A 1ID3B 3AZGC 3RELD 4J8VC 5CPKB 4WU8C 1ZLAB 3WKJC 2J8PA 4YS3C 2ZM5A 3KFUG 3C1CB 5AV6B 3A1IA 1KX5B 1KX4A 3B0CW 3C1CD 3AZFB 5AV6D 3MNNB 4H9QB 3AZLC 3AZJB 5B1MB 2HIOB 1U35C 2JSSA 1P3FC 1KX4C 3C1BD 3B0CT 1P3AD 5AV5C 1M1AA 3AZMD 5CP6C 1HTAA 3MGQB 3REID 4Z5TB 5AVBA 5JRGD 3MGQD 5GXQC 2YFVA 4XZQC 1M1AC 3AV1D 4R8PD 4KGCB 2RVQC 2DQNC 5B2IA 3W97D 3KWQA 3X1SD 5DNMA 4KGCD 4CSRA 4DQYB 3F6TA 1P3IA 4HGAC 5GSUD 1T3UA 3VH5A 3KWQC 5JA4B 1P3IC 3LELB 3EPLA 4EO5B 3LELD 3B0BA 4ZUXA 2BYKB 3EPKA 3AZHD 4DRBA 2LY8A 4ZUXC 4J8UA 3WTPD 3O62B 4WU9B 5GT3A 4J8UC 1ID3A 5B0ZB 3B6FC 2CV5C 3EG5B 3O62D 3MGRB 5B32A 4WU9D 3AYWB 1P3MD 1ZLAA 4Z2MG 3AZEB 1B67A 4G92B 1KX5A 5AVCA 3AN2B 2F8NK 4X23C 1TZYB 4M6BA 3MNNA 4H9QA 5B31B 3REHB 5AVCC 3A6NB 2Y2GA 2G5HC 4Z66B 4AWLB 5B40C 1KX3C 3R45A 1P3OB 3W96C 2F8NG 2NQBA 5B0YA 1P3OD 4Z5TA 3X1VB 4KUDB 4WNNA 3WA9A 5G49B 3LJAC 3X1UB 5B0YC 3X1VD 5AY8D 3MGPB 4KUDD 1BFMA 3X1UD 3MGSA 3V9RA 1F66C 3AZGB 3WA9C 3MGPD 4J8VB 2BYMB 4WU8B 3MGSC 4YS3B 5JA4A 4WU8D 3UTBD 1P3LA 1U35B 4JJND 1P3FB 1KX4B 3KXBA 3AFAC 1P3LC 2F2AC 1P3PC 3AV2D 5CP6B 3LZ0A 4Z2MH 3KXBC 5F99D 2Y2QA 4YM6A 5GXQB 3H0RC 1M1AB 3LZ0C 5AVBB 3AYWA 2AROC 2YFVB 5AVBD 4H9RB 4HGAB 5GT0A 5AV9A 4NE5A 5B2IB 3KWQB 3WAAC 2F8NH 4CSRB 1P3IB 5B2ID 4H9OA 5GT0C 3REKA 5DNMD 5B31A 4J8XC 1WWSA 1AOIA 2RIQA 1BH8A
chains in the Genus database with same CATH topology
2Y2OA 3REJA 1AOIC 4ZUXB 1M19C 4NFTA 3X1TC 1S32C 4ZUXD 5B33D 3FDDA 5AV8A 3AZID 1P3BD 3REJC 3UTAC 4J8UB 1P3GC 3AZGA 1HQ3C 2L5AA 3IP4C 5GT3B 3AZNA 3WKJA 2XD5A 1P3KA 5B32B 5DNNA 5GT3D 5B24C 5FUGB 1ID3D 4X23B 3AZNC 5B32D 5CPKD 3AZLA 1P3KC 5DNNC 2Y2MA 1ZLAD 5AVCB 1U35A 2CWEA 1P3FA 1KX3B 3B0DC 1KX5D 5AVCD 2ZY5A 5AV5A 3LZ1A 4J8WC 3AZFD 5CP6A 4G91C 3MNND 4LD9A 3R45B 5B1MD 3AZJD 2HIOD 5GXQA 2NQBB 5B0YB 3LZ1C 4XZQA 4LD9C 1F66B 4WNNB 2NQBD 5B0YD 3WA9B 4XUJA 4Z5TD 4H9RA 5E5AC 5BT1C 5CPJC 3MGSB 1TAFA 3V9RB 4XUJC 3UT9A 5BNXA 2PYOC 4WV4B 3H0LC 4KHAA 3UT9C 2FJ7C 2VQRA 1H3OA 3W99A 2FFFB 3AFAB 1P3LB 1BH9A 1P3PB 3W99C 3KXBB 3KSYA 1Q9CA 3VH6W 3B6FA 5B1LC 2CV5A 5BO0A 3LZ0B 2NZDC 4YM6B 4ZBJB 1Z2CB 2AROB 5C3IB 3MVDA 2BG1A 4YM6D 3VH6T 5FUGA 5B0ZD 3MVDC 4X23A 3MGRD 3AYWD 5GT0B 3AZKC 5AV9B 4H9PA 3AZED 1KX3A 5B40A 2Y2JA 5AV9D 4H9OB 3REKB 3AN2D 3W96A 5CPIA 2XD1A 1TZYD 3REKD 1AOIB 5B31D 1BH8B 3REHD 1M18C 3A6ND 3LJAA 5CPIC 4Z66D 1S32B 2JCHA 3B6GC 1A7WA 3TU4C 3REJB 3UTAB 4QLCC 1F66A 1P3GB 1HQ3B 3W98A 5AV8B 3RELC 1W2EA 5AV8D 3W98C 5B24B 3AZGD 5BS7C 3AZNB 3WKJB 4J8VD 1P3KB 1EQZA 5DNNB 3WKJD 4YS3D 5AV6C 1P3AA 1P3KD 3B0DB 3AZLB 3AFAA 1EQZC 3C1BC 4J8WB 1P3AC 1P3PA 1KU5A 5JRGA 3AZLD 2F8NA 3AZMC 3REIC 3AV1A 1U35D 1P3FD 1KX4D 5AV5B 3LZ1B 5JRGC 3MGQC 4LD9B 5AV5D 2ZY3A 3LZ1D 4R8PC 3AV1C 5CP6D 2AROA 3NQJB 5GSUA 4XZQB 3W97C 4H9NA 3X1SC 4KGCC 5CPJB 5GXQD 1M1AD 1WWIA 4XZQD 3WAAA 1R4VA 2G5IC 2RVQD 2Y2KA 5BT1D 5GSUC 4XUJB 1TAFB 2YFWA 4XUJD 4J8XA 3VH5W 2PYOB 3UT9B 2FJ7B 5BNXB 3KWQD 1P3ID 2Y2IA 4KHAB 3VH5T 1M19A 4H9SA 3AZHC 3X1TA 1H3OB 2W8SA 1S32A 3W99B 2Y2NA 3UTAA 1P3MA 1BH9B 4H9SC 5B1LB 3WTPC 1HQ3A 1P3GA 2NZDB 1P3MC 3B6FB 4CAYA 2CV5B 5BO0B 5B24A 4J8UD 3B6FD 2CV5D 3MVDB 3EPJA 4H9PB 4X23D 4J8WA 4E44A 5B40B 1M18B 3W96B 5CPIB 1KX3D 5B40D 3TU4B 3W96D 4QLCB 5CPID 3X1VC 5AY8C 4KUDC 3LJAB 5BNVA 3NQJA 3X1UC 3MGPC 5E5AA 3LJAD 5CPJA 3W98B 1F66D 3WA9D 3W98D 4WJ3C 3UTBC 2PYOA 4JJNA 2FJ7A 3AL0C 3MGSD 3KUYA 2ZY2A 2HUEC 4JJNC 3AV2A 1EQZB 3NQUB 3KUYC 3C1BB 5F99A 1P3AB 1EQZD 5KDMA 3AZMB 3REIB 3AV2C 5F99C 2UWXA 5B1LA 5JRGB 3AFAD 1P3LD 2F8NB 2NZDA 3AV1B 4R8PB 1P3PD 3H0MC 2F8ND 3W97B 3KXBD 3X1SB 1N1JA 3P5JB 5AVBC 4NE6A 3LZ0D 5GSUB 4DRAA 5B32G 4H9NB 4UPKA 3AZKA 2AROD 5B2IC 2ZY4A 3WAAB 4UUZB 5DNMC 1PZRA 1P34A 3WAAD 2YFWB 4J8XB 5GT0D 4NE3A 1P34C 5B33A 4J8XD 3AZHB 3AZIA 1P3BA 1M18A 1JFIA 3B6GA 3TU4A 5B2JA 1M19B 4QLCA 4WZSB 5B33C 3AZIC 3WTPB 3X1TB 1P3BC 1AOID 1M19D 3X1TD 1P3MB 5B2JC 3RELA 1S32D 2IO5C 3REJD 3UTAD 5CPKA 1P3GD 1HQ3D 5BS7A 5GT3C 4CAYB 1ID3C 5B32C 3C1CA 5AV6A 5CPKC 5B24D 1ZLAC 3AZFA 3C1CC 3NQUA 5B1MA 3AZJA 3C1BA 3AZND 2Y2PA 2HIOA 1KX5C 3EPHA 5DNND 3AZFC 3AZMA 3REIA 3MNNC 3AZJC 1B6WA 5B1MC 2HIOC 4G91B 3MGQA 5AY8B 4J8WD 4R8PA 2NQBC 3W97A 3X1SA 4KGCA 4Z5TC 5BNVB 4LD9D 5E5AB 3UTBB 4UUZA 5E5AD 5CPJD 3LELA 5CHLB 2HUEB 4JJNB 1F1EA 5B31G 3LELC 3KUYB 3AZHA 2PYOD 2BYKA 4EO5C 3UT9D 2FJ7D 3AV2B 3KUYD 2JE5A 5F99B 3WTPA 5KDMB 3O62A 4WU9A 3W99D 3VH6A 5B0ZA 2DF4C 3MGRA 5B1LD 4YM6C 3O62C 4WU9C 4ZBJC 5C3IC 2NZDD 1N1JB 5B0ZC 3AZEA 3MGRC 3AYWC 5DNMB 3AN2A 1TZYA 3AZKB 3AZEC 5AV9C 3MVDD 3A1KA 4G92C 3REHA 3A6NA 3AZKD 3AN2C 4Z66A 1P34B 1TZYC 1P3OA 3REKC 5B31C 3REHC 1P34D 3A6NC 4Z66C 4AWLC 5B33B 3AZIB 3X1VA 5AY8A 1P3BB 1P3OC 1JFIB 2Y2LA 3B6GB 5G49A 4KUDA 3X1UA 3MGPA 1M18D 5B2JB 3WTPE 3B6GD 2IO5B 3TU4D 5B2JD 4QLCD 5AV8C 4J8VA 1ULYA 2BYMA 4E45A 4WU8A 3RELB 2Y2HA 3UTBA 4YS3A 1ID3B 3AZGC 3RELD 4J8VC 5CPKB 4WU8C 1ZLAB 3WKJC 2J8PA 4YS3C 2ZM5A 3KFUG 3C1CB 5AV6B 3A1IA 1KX5B 1KX4A 3B0CW 3C1CD 3AZFB 5AV6D 3MNNB 4H9QB 3AZLC 3AZJB 5B1MB 2HIOB 1U35C 2JSSA 1P3FC 1KX4C 3C1BD 3B0CT 1P3AD 5AV5C 1M1AA 3AZMD 5CP6C 1HTAA 3MGQB 3REID 4Z5TB 5AVBA 5JRGD 3MGQD 5GXQC 2YFVA 4XZQC 1M1AC 3AV1D 4R8PD 4KGCB 2RVQC 2DQNC 5B2IA 3W97D 3KWQA 3X1SD 5DNMA 4KGCD 4CSRA 4DQYB 3F6TA 1P3IA 4HGAC 5GSUD 1T3UA 3VH5A 3KWQC 5JA4B 1P3IC 3LELB 3EPLA 4EO5B 3LELD 3B0BA 4ZUXA 2BYKB 3EPKA 3AZHD 4DRBA 2LY8A 4ZUXC 4J8UA 3WTPD 3O62B 4WU9B 5GT3A 4J8UC 1ID3A 5B0ZB 3B6FC 2CV5C 3EG5B 3O62D 3MGRB 5B32A 4WU9D 3AYWB 1P3MD 1ZLAA 4Z2MG 3AZEB 1B67A 4G92B 1KX5A 5AVCA 3AN2B 2F8NK 4X23C 1TZYB 4M6BA 3MNNA 4H9QA 5B31B 3REHB 5AVCC 3A6NB 2Y2GA 2G5HC 4Z66B 4AWLB 5B40C 1KX3C 3R45A 1P3OB 3W96C 2F8NG 2NQBA 5B0YA 1P3OD 4Z5TA 3X1VB 4KUDB 4WNNA 3WA9A 5G49B 3LJAC 3X1UB 5B0YC 3X1VD 5AY8D 3MGPB 4KUDD 1BFMA 3X1UD 3MGSA 3V9RA 1F66C 3AZGB 3WA9C 3MGPD 4J8VB 2BYMB 4WU8B 3MGSC 4YS3B 5JA4A 4WU8D 3UTBD 1P3LA 1U35B 4JJND 1P3FB 1KX4B 3KXBA 3AFAC 1P3LC 2F2AC 1P3PC 3AV2D 5CP6B 3LZ0A 4Z2MH 3KXBC 5F99D 2Y2QA 4YM6A 5GXQB 3H0RC 1M1AB 3LZ0C 5AVBB 3AYWA 2AROC 2YFVB 5AVBD 4H9RB 4HGAB 5GT0A 5AV9A 4NE5A 5B2IB 3KWQB 3WAAC 2F8NH 4CSRB 1P3IB 5B2ID 4H9OA 5GT0C 3REKA 5DNMD 5B31A 4J8XC 1WWSA 1AOIA 2RIQA 1BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ A;  1AOI C;  4ZUX B;  1M19 C;  4NFT A;  3X1T C;  1S32 C;  4ZUX D;  5B33 D;  5AV8 A;  3AZI D;  1P3B D;  3REJ C;  3UTA C;  4J8U B;  1P3G C;  3AZG A;  1HQ3 C;  2L5A A;  5GT3 B;  3AZN A;  3WKJ A;  1P3K A;  5B32 B;  5DNN A;  5GT3 D;  5B24 C;  5FUG B;  1ID3 D;  4X23 B;  3AZN C;  5B32 D;  5CPK D;  3AZL A;  1P3K C;  5DNN C;  1ZLA D;  5AVC B;  1U35 A;  2CWE A;  1P3F A;  1KX3 B;  3B0D C;  1KX5 D;  5AVC D;  5AV5 A;  3LZ1 A;  4J8W C;  3AZF D;  5CP6 A;  4G91 C;  3MNN D;  4LD9 A;  3R45 B;  5B1M D;  3AZJ D;  2HIO D;  5GXQ A;  2NQB B;  5B0Y B;  3LZ1 C;  4XZQ A;  4LD9 C;  1F66 B;  4WNN B;  2NQB D;  5B0Y D;  3WA9 B;  4XUJ A;  4Z5T D;  4H9R A;  5E5A C;  5BT1 C;  5CPJ C;  3MGS B;  1TAF A;  3V9R B;  4XUJ C;  3UT9 A;  5BNX A;  2PYO C;  4WV4 B;  4KHA A;  3UT9 C;  2FJ7 C;  1H3O A;  3W99 A;  3AFA B;  1P3L B;  1BH9 A;  1P3P B;  3W99 C;  3KXB B;  3KSY A;  1Q9C A;  3VH6 W;  3B6F A;  5B1L C;  2CV5 A;  5BO0 A;  3LZ0 B;  2NZD C;  4YM6 B;  4ZBJ B;  2ARO B;  5C3I B;  3MVD A;  4YM6 D;  3VH6 T;  5FUG A;  5B0Z D;  3MVD C;  4X23 A;  3MGR D;  3AYW D;  5GT0 B;  3AZK C;  5AV9 B;  4H9P A;  3AZE D;  1KX3 A;  5B40 A;  5AV9 D;  4H9O B;  3REK B;  3AN2 D;  3W96 A;  5CPI A;  1TZY D;  3REK D;  1AOI B;  5B31 D;  1BH8 B;  3REH D;  1M18 C;  3A6N D;  3LJA A;  5CPI C;  4Z66 D;  1S32 B;  3B6G C;  1A7W A;  3TU4 C;  3REJ B;  3UTA B;  4QLC C;  1F66 A;  1P3G B;  1HQ3 B;  3W98 A;  5AV8 B;  3REL C;  5AV8 D;  3W98 C;  5B24 B;  3AZG D;  5BS7 C;  3AZN B;  3WKJ B;  4J8V D;  1P3K B;  1EQZ A;  5DNN B;  3WKJ D;  4YS3 D;  5AV6 C;  1P3A A;  1P3K D;  3B0D B;  3AZL B;  3AFA A;  1EQZ C;  3C1B C;  4J8W B;  1P3A C;  1P3P A;  1KU5 A;  5JRG A;  3AZL D;  2F8N A;  3AZM C;  3REI C;  3AV1 A;  1U35 D;  1P3F D;  1KX4 D;  5AV5 B;  3LZ1 B;  5JRG C;  3MGQ C;  4LD9 B;  5AV5 D;  3LZ1 D;  4R8P C;  3AV1 C;  5CP6 D;  2ARO A;  3NQJ B;  5GSU A;  4XZQ B;  3W97 C;  4H9N A;  3X1S C;  4KGC C;  5CPJ B;  5GXQ D;  1M1A D;  1WWI A;  4XZQ D;  3WAA A;  1R4V A;  2RVQ D;  5BT1 D;  5GSU C;  4XUJ B;  1TAF B;  2YFW A;  4XUJ D;  4J8X A;  3VH5 W;  2PYO B;  3UT9 B;  2FJ7 B;  5BNX B;  3KWQ D;  1P3I D;  4KHA B;  3VH5 T;  1M19 A;  4H9S A;  3AZH C;  3X1T A;  1H3O B;  1S32 A;  3W99 B;  3UTA A;  1P3M A;  1BH9 B;  4H9S C;  5B1L B;  3WTP C;  1HQ3 A;  1P3G A;  2NZD B;  1P3M C;  3B6F B;  4CAY A;  2CV5 B;  5BO0 B;  5B24 A;  4J8U D;  3B6F D;  2CV5 D;  3MVD B;  4H9P B;  4X23 D;  4J8W A;  4E44 A;  5B40 B;  1M18 B;  3W96 B;  5CPI B;  1KX3 D;  5B40 D;  3TU4 B;  3W96 D;  4QLC B;  5CPI D;  3X1V C;  5AY8 C;  4KUD C;  3LJA B;  5BNV A;  3NQJ A;  3X1U C;  3MGP C;  5E5A A;  3LJA D;  5CPJ A;  3W98 B;  1F66 D;  3WA9 D;  3W98 D;  3UTB C;  2PYO A;  4JJN A;  2FJ7 A;  3MGS D;  3KUY A;  2HUE C;  4JJN C;  3AV2 A;  1EQZ B;  3NQU B;  3KUY C;  3C1B B;  5F99 A;  1P3A B;  1EQZ D;  5KDM A;  3AZM B;  3REI B;  3AV2 C;  5F99 C;  5B1L A;  5JRG B;  3AFA D;  1P3L D;  2F8N B;  2NZD A;  3AV1 B;  4R8P B;  1P3P D;  2F8N D;  3W97 B;  3KXB D;  3X1S B;  1N1J A;  5AVB C;  4NE6 A;  3LZ0 D;  5GSU B;  4DRA A;  5B32 G;  4H9N B;  3AZK A;  2ARO D;  5B2I C;  3WAA B;  4UUZ B;  5DNM C;  1P34 A;  3WAA D;  2YFW B;  4J8X B;  5GT0 D;  4NE3 A;  1P34 C;  5B33 A;  4J8X D;  3AZH B;  3AZI A;  1P3B A;  1M18 A;  1JFI A;  3B6G A;  3TU4 A;  5B2J A;  1M19 B;  4QLC A;  4WZS B;  5B33 C;  3AZI C;  3WTP B;  3X1T B;  1P3B C;  1AOI D;  1M19 D;  3X1T D;  1P3M B;  5B2J C;  3REL A;  1S32 D;  2IO5 C;  3REJ D;  3UTA D;  5CPK A;  1P3G D;  1HQ3 D;  5BS7 A;  5GT3 C;  4CAY B;  1ID3 C;  5B32 C;  3C1C A;  5AV6 A;  5CPK C;  5B24 D;  1ZLA C;  3AZF A;  3C1C C;  3NQU A;  5B1M A;  3AZJ A;  3C1B A;  3AZN D;  1KX5 C;  2HIO A;  5DNN D;  3AZF C;  3AZM A;  3REI A;  3MNN C;  3AZJ C;  1B6W A;  5B1M C;  2HIO C;  4G91 B;  3MGQ A;  5AY8 B;  4J8W D;  4R8P A;  2NQB C;  3W97 A;  3X1S A;  4KGC A;  4Z5T C;  5BNV B;  4LD9 D;  5E5A B;  3UTB B;  4UUZ A;  5E5A D;  5CPJ D;  3LEL A;  5CHL B;  2HUE B;  4JJN B;  1F1E A;  5B31 G;  3LEL C;  3KUY B;  3AZH A;  2PYO D;  2BYK A;  4EO5 C;  3UT9 D;  2FJ7 D;  3AV2 B;  3KUY D;  5F99 B;  3WTP A;  5KDM B;  3O62 A;  4WU9 A;  3W99 D;  3VH6 A;  5B0Z A;  3MGR A;  5B1L D;  4YM6 C;  3O62 C;  4WU9 C;  4ZBJ C;  5C3I C;  2NZD D;  1N1J B;  5B0Z C;  3AZE A;  3MGR C;  3AYW C;  5DNM B;  3AN2 A;  1TZY A;  3AZK B;  3AZE C;  5AV9 C;  3MVD D;  4G92 C;  3REH A;  3A6N A;  3AZK D;  3AN2 C;  4Z66 A;  1P34 B;  1TZY C;  1P3O A;  3REK C;  5B31 C;  3REH C;  1P34 D;  3A6N C;  4Z66 C;  4AWL C;  5B33 B;  3AZI B;  3X1V A;  5AY8 A;  1P3B B;  1P3O C;  1JFI B;  3B6G B;  4KUD A;  5G49 A;  3X1U A;  3MGP A;  1M18 D;  5B2J B;  3WTP E;  3B6G D;  2IO5 B;  3TU4 D;  5B2J D;  4QLC D;  5AV8 C;  4J8V A;  1ULY A;  2BYM A;  4E45 A;  4WU8 A;  3REL B;  1ID3 B;  3UTB A;  4YS3 A;  3AZG C;  3REL D;  4J8V C;  5CPK B;  4WU8 C;  1ZLA B;  3WKJ C;  4YS3 C;  3C1C B;  5AV6 B;  1KX5 B;  1KX4 A;  3B0C W;  3C1C D;  3AZF B;  5AV6 D;  3MNN B;  4H9Q B;  3AZL C;  3AZJ B;  5B1M B;  2HIO B;  1U35 C;  2JSS A;  1P3F C;  1KX4 C;  3C1B D;  3B0C T;  1P3A D;  5AV5 C;  1M1A A;  3AZM D;  5CP6 C;  1HTA A;  3MGQ B;  3REI D;  4Z5T B;  5AVB A;  5JRG D;  3MGQ D;  5GXQ C;  2YFV A;  4XZQ C;  1M1A C;  3AV1 D;  4R8P D;  4KGC B;  2RVQ C;  5B2I A;  3W97 D;  3KWQ A;  3X1S D;  5DNM A;  4KGC D;  4CSR A;  1P3I A;  4HGA C;  5GSU D;  3VH5 A;  3KWQ C;  5JA4 B;  1P3I C;  3LEL B;  4EO5 B;  3LEL D;  3B0B A;  4ZUX A;  2BYK B;  3AZH D;  4DRB A;  2LY8 A;  4ZUX C;  4J8U A;  3WTP D;  3O62 B;  4WU9 B;  5GT3 A;  4J8U C;  1ID3 A;  5B0Z B;  3B6F C;  2CV5 C;  3MGR B;  3O62 D;  1P3M D;  5B32 A;  4WU9 D;  3AYW B;  1ZLA A;  4Z2M G;  3AZE B;  1B67 A;  4G92 B;  1KX5 A;  5AVC A;  3AN2 B;  2F8N K;  4X23 C;  1TZY B;  4M6B A;  3MNN A;  4H9Q A;  5B31 B;  3REH B;  5AVC C;  3A6N B;  4Z66 B;  4AWL B;  1KX3 C;  5B40 C;  3R45 A;  1P3O B;  3W96 C;  2F8N G;  2NQB A;  5B0Y A;  1P3O D;  4Z5T A;  3X1V B;  4KUD B;  4WNN A;  3WA9 A;  5G49 B;  3LJA C;  3X1U B;  5B0Y C;  3X1V D;  5AY8 D;  3MGP B;  4KUD D;  1BFM A;  3X1U D;  3MGS A;  3V9R A;  1F66 C;  3AZG B;  3WA9 C;  3MGP D;  4J8V B;  2BYM B;  4WU8 B;  3MGS C;  4YS3 B;  5JA4 A;  4WU8 D;  3UTB D;  1P3L A;  1U35 B;  4JJN D;  1P3F B;  1KX4 B;  3KXB A;  3AFA C;  1P3L C;  1P3P C;  3AV2 D;  5CP6 B;  3LZ0 A;  4Z2M H;  3KXB C;  5F99 D;  4YM6 A;  5GXQ B;  1M1A B;  3LZ0 C;  5AVB B;  3AYW A;  2ARO C;  2YFV B;  5AVB D;  4H9R B;  4HGA B;  5GT0 A;  5AV9 A;  4NE5 A;  5B2I B;  3KWQ B;  3WAA C;  2F8N H;  4CSR B;  1P3I B;  5B2I D;  4H9O A;  5GT0 C;  3REK A;  5DNM D;  5B31 A;  4J8X C;  1WWS A;  1AOI A;  1BH8 A; 
#chains in the Genus database with same CATH topology
 2Y2O A;  3REJ A;  1AOI C;  4ZUX B;  1M19 C;  4NFT A;  3X1T C;  1S32 C;  4ZUX D;  5B33 D;  3FDD A;  5AV8 A;  3AZI D;  1P3B D;  3REJ C;  3UTA C;  4J8U B;  1P3G C;  3AZG A;  1HQ3 C;  2L5A A;  3IP4 C;  5GT3 B;  3AZN A;  3WKJ A;  2XD5 A;  1P3K A;  5B32 B;  5DNN A;  5GT3 D;  5B24 C;  5FUG B;  1ID3 D;  4X23 B;  3AZN C;  5B32 D;  5CPK D;  3AZL A;  1P3K C;  5DNN C;  2Y2M A;  1ZLA D;  5AVC B;  1U35 A;  2CWE A;  1P3F A;  1KX3 B;  3B0D C;  1KX5 D;  5AVC D;  2ZY5 A;  5AV5 A;  3LZ1 A;  4J8W C;  3AZF D;  5CP6 A;  4G91 C;  3MNN D;  4LD9 A;  3R45 B;  5B1M D;  3AZJ D;  2HIO D;  5GXQ A;  2NQB B;  5B0Y B;  3LZ1 C;  4XZQ A;  4LD9 C;  1F66 B;  4WNN B;  2NQB D;  5B0Y D;  3WA9 B;  4XUJ A;  4Z5T D;  4H9R A;  5E5A C;  5BT1 C;  5CPJ C;  3MGS B;  1TAF A;  3V9R B;  4XUJ C;  3UT9 A;  5BNX A;  2PYO C;  4WV4 B;  3H0L C;  4KHA A;  3UT9 C;  2FJ7 C;  2VQR A;  1H3O A;  3W99 A;  2FFF B;  3AFA B;  1P3L B;  1BH9 A;  1P3P B;  3W99 C;  3KXB B;  3KSY A;  1Q9C A;  3VH6 W;  3B6F A;  5B1L C;  2CV5 A;  5BO0 A;  3LZ0 B;  2NZD C;  4YM6 B;  4ZBJ B;  1Z2C B;  2ARO B;  5C3I B;  3MVD A;  2BG1 A;  4YM6 D;  3VH6 T;  5FUG A;  5B0Z D;  3MVD C;  4X23 A;  3MGR D;  3AYW D;  5GT0 B;  3AZK C;  5AV9 B;  4H9P A;  3AZE D;  1KX3 A;  5B40 A;  2Y2J A;  5AV9 D;  4H9O B;  3REK B;  3AN2 D;  3W96 A;  5CPI A;  2XD1 A;  1TZY D;  3REK D;  1AOI B;  5B31 D;  1BH8 B;  3REH D;  1M18 C;  3A6N D;  3LJA A;  5CPI C;  4Z66 D;  1S32 B;  2JCH A;  3B6G C;  1A7W A;  3TU4 C;  3REJ B;  3UTA B;  4QLC C;  1F66 A;  1P3G B;  1HQ3 B;  3W98 A;  5AV8 B;  3REL C;  1W2E A;  5AV8 D;  3W98 C;  5B24 B;  3AZG D;  5BS7 C;  3AZN B;  3WKJ B;  4J8V D;  1P3K B;  1EQZ A;  5DNN B;  3WKJ D;  4YS3 D;  5AV6 C;  1P3A A;  1P3K D;  3B0D B;  3AZL B;  3AFA A;  1EQZ C;  3C1B C;  4J8W B;  1P3A C;  1P3P A;  1KU5 A;  5JRG A;  3AZL D;  2F8N A;  3AZM C;  3REI C;  3AV1 A;  1U35 D;  1P3F D;  1KX4 D;  5AV5 B;  3LZ1 B;  5JRG C;  3MGQ C;  4LD9 B;  5AV5 D;  2ZY3 A;  3LZ1 D;  4R8P C;  3AV1 C;  5CP6 D;  2ARO A;  3NQJ B;  5GSU A;  4XZQ B;  3W97 C;  4H9N A;  3X1S C;  4KGC C;  5CPJ B;  5GXQ D;  1M1A D;  1WWI A;  4XZQ D;  3WAA A;  1R4V A;  2G5I C;  2RVQ D;  2Y2K A;  5BT1 D;  5GSU C;  4XUJ B;  1TAF B;  2YFW A;  4XUJ D;  4J8X A;  3VH5 W;  2PYO B;  3UT9 B;  2FJ7 B;  5BNX B;  3KWQ D;  1P3I D;  2Y2I A;  4KHA B;  3VH5 T;  1M19 A;  4H9S A;  3AZH C;  3X1T A;  1H3O B;  2W8S A;  1S32 A;  3W99 B;  2Y2N A;  3UTA A;  1P3M A;  1BH9 B;  4H9S C;  5B1L B;  3WTP C;  1HQ3 A;  1P3G A;  2NZD B;  1P3M C;  3B6F B;  4CAY A;  2CV5 B;  5BO0 B;  5B24 A;  4J8U D;  3B6F D;  2CV5 D;  3MVD B;  3EPJ A;  4H9P B;  4X23 D;  4J8W A;  4E44 A;  5B40 B;  1M18 B;  3W96 B;  5CPI B;  1KX3 D;  5B40 D;  3TU4 B;  3W96 D;  4QLC B;  5CPI D;  3X1V C;  5AY8 C;  4KUD C;  3LJA B;  5BNV A;  3NQJ A;  3X1U C;  3MGP C;  5E5A A;  3LJA D;  5CPJ A;  3W98 B;  1F66 D;  3WA9 D;  3W98 D;  4WJ3 C;  3UTB C;  2PYO A;  4JJN A;  2FJ7 A;  3AL0 C;  3MGS D;  3KUY A;  2ZY2 A;  2HUE C;  4JJN C;  3AV2 A;  1EQZ B;  3NQU B;  3KUY C;  3C1B B;  5F99 A;  1P3A B;  1EQZ D;  5KDM A;  3AZM B;  3REI B;  3AV2 C;  5F99 C;  2UWX A;  5B1L A;  5JRG B;  3AFA D;  1P3L D;  2F8N B;  2NZD A;  3AV1 B;  4R8P B;  1P3P D;  3H0M C;  2F8N D;  3W97 B;  3KXB D;  3X1S B;  1N1J A;  3P5J B;  5AVB C;  4NE6 A;  3LZ0 D;  5GSU B;  4DRA A;  5B32 G;  4H9N B;  4UPK A;  3AZK A;  2ARO D;  5B2I C;  2ZY4 A;  3WAA B;  4UUZ B;  5DNM C;  1PZR A;  1P34 A;  3WAA D;  2YFW B;  4J8X B;  5GT0 D;  4NE3 A;  1P34 C;  5B33 A;  4J8X D;  3AZH B;  3AZI A;  1P3B A;  1M18 A;  1JFI A;  3B6G A;  3TU4 A;  5B2J A;  1M19 B;  4QLC A;  4WZS B;  5B33 C;  3AZI C;  3WTP B;  3X1T B;  1P3B C;  1AOI D;  1M19 D;  3X1T D;  1P3M B;  5B2J C;  3REL A;  1S32 D;  2IO5 C;  3REJ D;  3UTA D;  5CPK A;  1P3G D;  1HQ3 D;  5BS7 A;  5GT3 C;  4CAY B;  1ID3 C;  5B32 C;  3C1C A;  5AV6 A;  5CPK C;  5B24 D;  1ZLA C;  3AZF A;  3C1C C;  3NQU A;  5B1M A;  3AZJ A;  3C1B A;  3AZN D;  2Y2P A;  2HIO A;  1KX5 C;  3EPH A;  5DNN D;  3AZF C;  3AZM A;  3REI A;  3MNN C;  3AZJ C;  1B6W A;  5B1M C;  2HIO C;  4G91 B;  3MGQ A;  5AY8 B;  4J8W D;  4R8P A;  2NQB C;  3W97 A;  3X1S A;  4KGC A;  4Z5T C;  5BNV B;  4LD9 D;  5E5A B;  3UTB B;  4UUZ A;  5E5A D;  5CPJ D;  3LEL A;  5CHL B;  2HUE B;  4JJN B;  1F1E A;  5B31 G;  3LEL C;  3KUY B;  3AZH A;  2PYO D;  2BYK A;  4EO5 C;  3UT9 D;  2FJ7 D;  3AV2 B;  3KUY D;  2JE5 A;  5F99 B;  3WTP A;  5KDM B;  3O62 A;  4WU9 A;  3W99 D;  3VH6 A;  5B0Z A;  2DF4 C;  3MGR A;  5B1L D;  4YM6 C;  3O62 C;  4WU9 C;  4ZBJ C;  5C3I C;  2NZD D;  1N1J B;  5B0Z C;  3AZE A;  3MGR C;  3AYW C;  5DNM B;  3AN2 A;  1TZY A;  3AZK B;  3AZE C;  5AV9 C;  3MVD D;  3A1K A;  4G92 C;  3REH A;  3A6N A;  3AZK D;  3AN2 C;  4Z66 A;  1P34 B;  1TZY C;  1P3O A;  3REK C;  5B31 C;  3REH C;  1P34 D;  3A6N C;  4Z66 C;  4AWL C;  5B33 B;  3AZI B;  3X1V A;  5AY8 A;  1P3B B;  1P3O C;  1JFI B;  2Y2L A;  3B6G B;  5G49 A;  4KUD A;  3X1U A;  3MGP A;  1M18 D;  5B2J B;  3WTP E;  3B6G D;  2IO5 B;  3TU4 D;  5B2J D;  4QLC D;  5AV8 C;  4J8V A;  1ULY A;  2BYM A;  4E45 A;  4WU8 A;  3REL B;  2Y2H A;  3UTB A;  4YS3 A;  1ID3 B;  3AZG C;  3REL D;  4J8V C;  5CPK B;  4WU8 C;  1ZLA B;  3WKJ C;  2J8P A;  4YS3 C;  2ZM5 A;  3KFU G;  3C1C B;  5AV6 B;  3A1I A;  1KX5 B;  1KX4 A;  3B0C W;  3C1C D;  3AZF B;  5AV6 D;  3MNN B;  4H9Q B;  3AZL C;  3AZJ B;  5B1M B;  2HIO B;  1U35 C;  2JSS A;  1P3F C;  1KX4 C;  3C1B D;  3B0C T;  1P3A D;  5AV5 C;  1M1A A;  3AZM D;  5CP6 C;  1HTA A;  3MGQ B;  3REI D;  4Z5T B;  5AVB A;  5JRG D;  3MGQ D;  5GXQ C;  2YFV A;  4XZQ C;  1M1A C;  3AV1 D;  4R8P D;  4KGC B;  2RVQ C;  2DQN C;  5B2I A;  3W97 D;  3KWQ A;  3X1S D;  5DNM A;  4KGC D;  4CSR A;  4DQY B;  3F6T A;  1P3I A;  4HGA C;  5GSU D;  1T3U A;  3VH5 A;  3KWQ C;  5JA4 B;  1P3I C;  3LEL B;  3EPL A;  4EO5 B;  3LEL D;  3B0B A;  4ZUX A;  2BYK B;  3EPK A;  3AZH D;  4DRB A;  2LY8 A;  4ZUX C;  4J8U A;  3WTP D;  3O62 B;  4WU9 B;  5GT3 A;  4J8U C;  1ID3 A;  5B0Z B;  3B6F C;  2CV5 C;  3EG5 B;  3O62 D;  3MGR B;  5B32 A;  4WU9 D;  3AYW B;  1P3M D;  1ZLA A;  4Z2M G;  3AZE B;  1B67 A;  4G92 B;  1KX5 A;  5AVC A;  3AN2 B;  2F8N K;  4X23 C;  1TZY B;  4M6B A;  3MNN A;  4H9Q A;  5B31 B;  3REH B;  5AVC C;  3A6N B;  2Y2G A;  2G5H C;  4Z66 B;  4AWL B;  5B40 C;  1KX3 C;  3R45 A;  1P3O B;  3W96 C;  2F8N G;  2NQB A;  5B0Y A;  1P3O D;  4Z5T A;  3X1V B;  4KUD B;  4WNN A;  3WA9 A;  5G49 B;  3LJA C;  3X1U B;  5B0Y C;  3X1V D;  5AY8 D;  3MGP B;  4KUD D;  1BFM A;  3X1U D;  3MGS A;  3V9R A;  1F66 C;  3AZG B;  3WA9 C;  3MGP D;  4J8V B;  2BYM B;  4WU8 B;  3MGS C;  4YS3 B;  5JA4 A;  4WU8 D;  3UTB D;  1P3L A;  1U35 B;  4JJN D;  1P3F B;  1KX4 B;  3KXB A;  3AFA C;  1P3L C;  2F2A C;  1P3P C;  3AV2 D;  5CP6 B;  3LZ0 A;  4Z2M H;  3KXB C;  5F99 D;  2Y2Q A;  4YM6 A;  5GXQ B;  3H0R C;  1M1A B;  3LZ0 C;  5AVB B;  3AYW A;  2ARO C;  2YFV B;  5AVB D;  4H9R B;  4HGA B;  5GT0 A;  5AV9 A;  4NE5 A;  5B2I B;  3KWQ B;  3WAA C;  2F8N H;  4CSR B;  1P3I B;  5B2I D;  4H9O A;  5GT0 C;  3REK A;  5DNM D;  5B31 A;  4J8X C;  1WWS A;  1AOI A;  2RIQ A;  1BH8 A; 
#chains in the Genus database with same CATH homology
 2Y2O A;  3REJ A;  1AOI C;  4ZUX B;  1M19 C;  4NFT A;  3X1T C;  1S32 C;  4ZUX D;  5B33 D;  3FDD A;  5AV8 A;  3AZI D;  1P3B D;  3REJ C;  3UTA C;  4J8U B;  1P3G C;  3AZG A;  1HQ3 C;  2L5A A;  3IP4 C;  5GT3 B;  3AZN A;  3WKJ A;  2XD5 A;  1P3K A;  5B32 B;  5DNN A;  5GT3 D;  5B24 C;  5FUG B;  1ID3 D;  4X23 B;  3AZN C;  5B32 D;  5CPK D;  3AZL A;  1P3K C;  5DNN C;  2Y2M A;  1ZLA D;  5AVC B;  1U35 A;  2CWE A;  1P3F A;  1KX3 B;  3B0D C;  1KX5 D;  5AVC D;  2ZY5 A;  5AV5 A;  3LZ1 A;  4J8W C;  3AZF D;  5CP6 A;  4G91 C;  3MNN D;  4LD9 A;  3R45 B;  5B1M D;  3AZJ D;  2HIO D;  5GXQ A;  2NQB B;  5B0Y B;  3LZ1 C;  4XZQ A;  4LD9 C;  1F66 B;  4WNN B;  2NQB D;  5B0Y D;  3WA9 B;  4XUJ A;  4Z5T D;  4H9R A;  5E5A C;  5BT1 C;  5CPJ C;  3MGS B;  1TAF A;  3V9R B;  4XUJ C;  3UT9 A;  5BNX A;  2PYO C;  4WV4 B;  3H0L C;  4KHA A;  3UT9 C;  2FJ7 C;  2VQR A;  1H3O A;  3W99 A;  2FFF B;  3AFA B;  1P3L B;  1BH9 A;  1P3P B;  3W99 C;  3KXB B;  3KSY A;  1Q9C A;  3VH6 W;  3B6F A;  5B1L C;  2CV5 A;  5BO0 A;  3LZ0 B;  2NZD C;  4YM6 B;  4ZBJ B;  1Z2C B;  2ARO B;  5C3I B;  3MVD A;  2BG1 A;  4YM6 D;  3VH6 T;  5FUG A;  5B0Z D;  3MVD C;  4X23 A;  3MGR D;  3AYW D;  5GT0 B;  3AZK C;  5AV9 B;  4H9P A;  3AZE D;  1KX3 A;  5B40 A;  2Y2J A;  5AV9 D;  4H9O B;  3REK B;  3AN2 D;  3W96 A;  5CPI A;  2XD1 A;  1TZY D;  3REK D;  1AOI B;  5B31 D;  1BH8 B;  3REH D;  1M18 C;  3A6N D;  3LJA A;  5CPI C;  4Z66 D;  1S32 B;  2JCH A;  3B6G C;  1A7W A;  3TU4 C;  3REJ B;  3UTA B;  4QLC C;  1F66 A;  1P3G B;  1HQ3 B;  3W98 A;  5AV8 B;  3REL C;  1W2E A;  5AV8 D;  3W98 C;  5B24 B;  3AZG D;  5BS7 C;  3AZN B;  3WKJ B;  4J8V D;  1P3K B;  1EQZ A;  5DNN B;  3WKJ D;  4YS3 D;  5AV6 C;  1P3A A;  1P3K D;  3B0D B;  3AZL B;  3AFA A;  1EQZ C;  3C1B C;  4J8W B;  1P3A C;  1P3P A;  1KU5 A;  5JRG A;  3AZL D;  2F8N A;  3AZM C;  3REI C;  3AV1 A;  1U35 D;  1P3F D;  1KX4 D;  5AV5 B;  3LZ1 B;  5JRG C;  3MGQ C;  4LD9 B;  5AV5 D;  2ZY3 A;  3LZ1 D;  4R8P C;  3AV1 C;  5CP6 D;  2ARO A;  3NQJ B;  5GSU A;  4XZQ B;  3W97 C;  4H9N A;  3X1S C;  4KGC C;  5CPJ B;  5GXQ D;  1M1A D;  1WWI A;  4XZQ D;  3WAA A;  1R4V A;  2G5I C;  2RVQ D;  2Y2K A;  5BT1 D;  5GSU C;  4XUJ B;  1TAF B;  2YFW A;  4XUJ D;  4J8X A;  3VH5 W;  2PYO B;  3UT9 B;  2FJ7 B;  5BNX B;  3KWQ D;  1P3I D;  2Y2I A;  4KHA B;  3VH5 T;  1M19 A;  4H9S A;  3AZH C;  3X1T A;  1H3O B;  2W8S A;  1S32 A;  3W99 B;  2Y2N A;  3UTA A;  1P3M A;  1BH9 B;  4H9S C;  5B1L B;  3WTP C;  1HQ3 A;  1P3G A;  2NZD B;  1P3M C;  3B6F B;  4CAY A;  2CV5 B;  5BO0 B;  5B24 A;  4J8U D;  3B6F D;  2CV5 D;  3MVD B;  3EPJ A;  4H9P B;  4X23 D;  4J8W A;  4E44 A;  5B40 B;  1M18 B;  3W96 B;  5CPI B;  1KX3 D;  5B40 D;  3TU4 B;  3W96 D;  4QLC B;  5CPI D;  3X1V C;  5AY8 C;  4KUD C;  3LJA B;  5BNV A;  3NQJ A;  3X1U C;  3MGP C;  5E5A A;  3LJA D;  5CPJ A;  3W98 B;  1F66 D;  3WA9 D;  3W98 D;  4WJ3 C;  3UTB C;  2PYO A;  4JJN A;  2FJ7 A;  3AL0 C;  3MGS D;  3KUY A;  2ZY2 A;  2HUE C;  4JJN C;  3AV2 A;  1EQZ B;  3NQU B;  3KUY C;  3C1B B;  5F99 A;  1P3A B;  1EQZ D;  5KDM A;  3AZM B;  3REI B;  3AV2 C;  5F99 C;  2UWX A;  5B1L A;  5JRG B;  3AFA D;  1P3L D;  2F8N B;  2NZD A;  3AV1 B;  4R8P B;  1P3P D;  3H0M C;  2F8N D;  3W97 B;  3KXB D;  3X1S B;  1N1J A;  3P5J B;  5AVB C;  4NE6 A;  3LZ0 D;  5GSU B;  4DRA A;  5B32 G;  4H9N B;  4UPK A;  3AZK A;  2ARO D;  5B2I C;  2ZY4 A;  3WAA B;  4UUZ B;  5DNM C;  1PZR A;  1P34 A;  3WAA D;  2YFW B;  4J8X B;  5GT0 D;  4NE3 A;  1P34 C;  5B33 A;  4J8X D;  3AZH B;  3AZI A;  1P3B A;  1M18 A;  1JFI A;  3B6G A;  3TU4 A;  5B2J A;  1M19 B;  4QLC A;  4WZS B;  5B33 C;  3AZI C;  3WTP B;  3X1T B;  1P3B C;  1AOI D;  1M19 D;  3X1T D;  1P3M B;  5B2J C;  3REL A;  1S32 D;  2IO5 C;  3REJ D;  3UTA D;  5CPK A;  1P3G D;  1HQ3 D;  5BS7 A;  5GT3 C;  4CAY B;  1ID3 C;  5B32 C;  3C1C A;  5AV6 A;  5CPK C;  5B24 D;  1ZLA C;  3AZF A;  3C1C C;  3NQU A;  5B1M A;  3AZJ A;  3C1B A;  3AZN D;  2Y2P A;  2HIO A;  1KX5 C;  3EPH A;  5DNN D;  3AZF C;  3AZM A;  3REI A;  3MNN C;  3AZJ C;  1B6W A;  5B1M C;  2HIO C;  4G91 B;  3MGQ A;  5AY8 B;  4J8W D;  4R8P A;  2NQB C;  3W97 A;  3X1S A;  4KGC A;  4Z5T C;  5BNV B;  4LD9 D;  5E5A B;  3UTB B;  4UUZ A;  5E5A D;  5CPJ D;  3LEL A;  5CHL B;  2HUE B;  4JJN B;  1F1E A;  5B31 G;  3LEL C;  3KUY B;  3AZH A;  2PYO D;  2BYK A;  4EO5 C;  3UT9 D;  2FJ7 D;  3AV2 B;  3KUY D;  2JE5 A;  5F99 B;  3WTP A;  5KDM B;  3O62 A;  4WU9 A;  3W99 D;  3VH6 A;  5B0Z A;  2DF4 C;  3MGR A;  5B1L D;  4YM6 C;  3O62 C;  4WU9 C;  4ZBJ C;  5C3I C;  2NZD D;  1N1J B;  5B0Z C;  3AZE A;  3MGR C;  3AYW C;  5DNM B;  3AN2 A;  1TZY A;  3AZK B;  3AZE C;  5AV9 C;  3MVD D;  3A1K A;  4G92 C;  3REH A;  3A6N A;  3AZK D;  3AN2 C;  4Z66 A;  1P34 B;  1TZY C;  1P3O A;  3REK C;  5B31 C;  3REH C;  1P34 D;  3A6N C;  4Z66 C;  4AWL C;  5B33 B;  3AZI B;  3X1V A;  5AY8 A;  1P3B B;  1P3O C;  1JFI B;  2Y2L A;  3B6G B;  5G49 A;  4KUD A;  3X1U A;  3MGP A;  1M18 D;  5B2J B;  3WTP E;  3B6G D;  2IO5 B;  3TU4 D;  5B2J D;  4QLC D;  5AV8 C;  4J8V A;  1ULY A;  2BYM A;  4E45 A;  4WU8 A;  3REL B;  2Y2H A;  3UTB A;  4YS3 A;  1ID3 B;  3AZG C;  3REL D;  4J8V C;  5CPK B;  4WU8 C;  1ZLA B;  3WKJ C;  2J8P A;  4YS3 C;  2ZM5 A;  3KFU G;  3C1C B;  5AV6 B;  3A1I A;  1KX5 B;  1KX4 A;  3B0C W;  3C1C D;  3AZF B;  5AV6 D;  3MNN B;  4H9Q B;  3AZL C;  3AZJ B;  5B1M B;  2HIO B;  1U35 C;  2JSS A;  1P3F C;  1KX4 C;  3C1B D;  3B0C T;  1P3A D;  5AV5 C;  1M1A A;  3AZM D;  5CP6 C;  1HTA A;  3MGQ B;  3REI D;  4Z5T B;  5AVB A;  5JRG D;  3MGQ D;  5GXQ C;  2YFV A;  4XZQ C;  1M1A C;  3AV1 D;  4R8P D;  4KGC B;  2RVQ C;  2DQN C;  5B2I A;  3W97 D;  3KWQ A;  3X1S D;  5DNM A;  4KGC D;  4CSR A;  4DQY B;  3F6T A;  1P3I A;  4HGA C;  5GSU D;  1T3U A;  3VH5 A;  3KWQ C;  5JA4 B;  1P3I C;  3LEL B;  3EPL A;  4EO5 B;  3LEL D;  3B0B A;  4ZUX A;  2BYK B;  3EPK A;  3AZH D;  4DRB A;  2LY8 A;  4ZUX C;  4J8U A;  3WTP D;  3O62 B;  4WU9 B;  5GT3 A;  4J8U C;  1ID3 A;  5B0Z B;  3B6F C;  2CV5 C;  3EG5 B;  3O62 D;  3MGR B;  5B32 A;  4WU9 D;  3AYW B;  1P3M D;  1ZLA A;  4Z2M G;  3AZE B;  1B67 A;  4G92 B;  1KX5 A;  5AVC A;  3AN2 B;  2F8N K;  4X23 C;  1TZY B;  4M6B A;  3MNN A;  4H9Q A;  5B31 B;  3REH B;  5AVC C;  3A6N B;  2Y2G A;  2G5H C;  4Z66 B;  4AWL B;  5B40 C;  1KX3 C;  3R45 A;  1P3O B;  3W96 C;  2F8N G;  2NQB A;  5B0Y A;  1P3O D;  4Z5T A;  3X1V B;  4KUD B;  4WNN A;  3WA9 A;  5G49 B;  3LJA C;  3X1U B;  5B0Y C;  3X1V D;  5AY8 D;  3MGP B;  4KUD D;  1BFM A;  3X1U D;  3MGS A;  3V9R A;  1F66 C;  3AZG B;  3WA9 C;  3MGP D;  4J8V B;  2BYM B;  4WU8 B;  3MGS C;  4YS3 B;  5JA4 A;  4WU8 D;  3UTB D;  1P3L A;  1U35 B;  4JJN D;  1P3F B;  1KX4 B;  3KXB A;  3AFA C;  1P3L C;  2F2A C;  1P3P C;  3AV2 D;  5CP6 B;  3LZ0 A;  4Z2M H;  3KXB C;  5F99 D;  2Y2Q A;  4YM6 A;  5GXQ B;  3H0R C;  1M1A B;  3LZ0 C;  5AVB B;  3AYW A;  2ARO C;  2YFV B;  5AVB D;  4H9R B;  4HGA B;  5GT0 A;  5AV9 A;  4NE5 A;  5B2I B;  3KWQ B;  3WAA C;  2F8N H;  4CSR B;  1P3I B;  5B2I D;  4H9O A;  5GT0 C;  3REK A;  5DNM D;  5B31 A;  4J8X C;  1WWS A;  1AOI A;  2RIQ A;  1BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...