3KXBA

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
RPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 32
structure length 92
sequence length 92
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbA00
5B1MD 3MVDC 1P3MB 3RELB 5B31G 3AZLC 3KUYB 1KX4A 2F8NK 3LELB 5DNNB 5GT0A 1P3OC 1H3OB 3MGRA 1EQZD 2NZDA 5B1LA 4H9RA 3KWQD 3X1UC 3A6NB 3REHC 5BNXA 1ZLAC 3B6GD 1M19B 5AV8B 5AV6C 1U35B 5KDMB 2PYOB 2YFWB 3KXBD 5B0YA 1M1AC 4LD9A 1P3AD 5BNVB 4J8WB 2HIOD 3C1CD 1P3ID 3MVDD 4H9SC 5FUGA 4NE5A 1N1JB 1P3OD 3WKJC 4YS3D 5CPKB 4KUDC 1F66B 3W96B 3LZ0B 1Q9CA 4X23B 3REHD 5GXQD 5CPJA 4E45A 5GSUA 3X1VA 3X1TA 3B0CW 4H9PA 3LZ1A 3VH6T 5B2IC 3B6FC 3MGSC 2AROA 3TU4C 5B0ZD 4WU8B 4G92B 5GT3A 4H9QA 1P3FB 4YM6A 3R45A 3W99B 3WAAC 4EO5B 5B24D 3AZFB 3X1SD 3WKJD 1HQ3C 3B0DB 5F99B 1P3GB 1TZYC 4R8PA 1P3LC 1KX3C 3KSYA 1AOIC 5B33A 2CV5B 1P3PA 3MNNA 3AZJC 5CPIC 3AV1C 5B40B 4Z2MG 4WU9A 4DRBA 3C1BA 4G91B 3AZHA 3REJA 4XUJA 5C3IB 3LJAA 4UUZB 3MGQD 3MGRB 1P3MA 3RELA 3KUYA 3LELA 4ZUXA 5DNNA 5CP6C 4ZBJB 1TAFB 1P34C 5AV9C 4NE3A 3W98D 5DNMB 3UTAC 3AN2B 2RVQD 5BNXB 3A6NA 3AZND 1HQ3D 1P3BA 4Z5TD 4J8UC 1P3KC 1P3LD 5B1LD 5B0YB 4LD9B 1M19A 5AV8A 3AZJD 2PYOA 3WTPA 3WA9A 3MGPB 3AZKD 5JRGB 2IO5B 4Z2MH 1S32C 3REKC 4NE6A 2NQBD 1N1JA 3W97C 5CP6D 4J8VA 5CPKA 2F8NG 3UT9C 5CPJB 3W96A 5GSUB 3UTAD 3X1VB 2F8ND 1KX5C 4AWLC 3LZ1B 5B32B 3AFAB 3VH5A 4CSRB 3AZLA 2AROB 3VH5W 3AZGB 3UTBD 4JJNC 5GT3B 4H9QB 5B31C 5AV5B 4J8XC 3X1UA 3AZEB 3KWQC 1ID3C 4HGAB 3AZFA 1ZLAA 4YM6D 5AV6A 3B6GC 1P3PB 1M18D 1M1AA 3REID 5BO0A 5B2JD 2CV5A 1P3AC 2FJ7D 3AV2D 2HIOC 3C1CC 1P3IC 5E5AD 4JJND 4ZUXB 4KUDA 4UUZA 4YS3C 5B31D 3AYWD 4J8XD 4XUJD 3LJAD 4QLCD 1TAFA 1ID3D 1P3MD 5GXQC 3VH6A 3KUYD 1P3BB 5DNMA 3AN2A 1BH9A 3O62C 3VH6W 5B2IA 3B6FA 5AY8B 3TU4A 1EQZB 2YFVB 3WTPB 3AZIB 4H9NB 4X23C 5AVBB 5B0ZC 3A6ND 3WA9B 5BS7C 5B24C 4H9OB 4KGCC 5AVCB 3MGPA 1U35D 3X1SC 3AZMC 5JRGA 2PYOD 4J8VB 3KXBB 1TZYA 4WU8C 1AOIA 4CAYA 4J8WD 1P3FC 4XZQB 5CPIA 3AV1A 3AZLB 3O62D 2BYMB 5CPKD 1P3OB 5B32A 3AFAA 1P3GC 4CSRA 1F66D 3MGQC 3LZ0D 4X23D 3AZGA 4Z66C 3X1UB 1P34A 3REHB 4KGCD 1KX4C 1ZLAB 3W98C 5AV5A 2RVQC 5GT0C 3AZMD 3AZEA 5AV6B 2NZDC 4J8UA 3AZNC 1P3KA 4Z5TC 4WU8D 1M1AB 1P3FD 5B1LC 3W99D 4DRAA 5BO0B 3WKJB 3AZKC 3REKA 5F99D 1P3GD 4KUDB 4LD9C 3W97A 2NQBC 4Z66D 3UT9A 5B40D 1KX4D 1BH9B 5GT0D 5B2IB 3B6FB 5B1MA 3MGRD 4WNNA 3MGSB 2NZDD 3TU4B 3V9RA 4KHAB 3UTBC 5AY8A 3WAAB 1EQZA 2YFVA 3X1VC 5GSUC 3AZIA 3X1TC 3B0CT 4H9NA 5AVBA 3KWQA 1HQ3B 2L5AA 4H9OA 5B0YD 4LD9D 1TZYB 1KX3B 1AOIB 4CAYB 5AVCA 4YM6C 3AZJB 1BH8A 5CPIB 3AV1B 3KXBA 1M18C 3MGPD 4XZQA 3REIC 5B2JC 3C1CA 2FJ7C 3AV2C 1P3IA 3MVDA 4R8PC 2BYMA 5B33C 5CP6B 5E5AC 4YS3A 3MNNC 1P3OA 1P34B 3AYWC 5CPJD 2HUEC 5GSUD 5B32G 5AV9B 3X1TD 3X1VD 4WU9C 3C1BC 3UTAB 3LZ1D 3AZHC 3REJC 5B32D 3AFAD 4XUJC 3LJAC 4QLCC 3REHA 5GXQA 2AROD 4WV4B 1P3MC 4J8UB 3RELC 1P3KB 3KUYC 3AZGD 3LELC 5GT3D 5DNNC 2BYKB 1R4VA 5AV5D 5B0ZA 1KU5A 2F8NH 1S32B 3A6NC 5B24A 3REKB 4H9SA 4R8PD 3X1SA 1M19C 5B33D 5AV8C 3W97B 1P3PD 3WKJA 3MNND 1U35C 2PYOC 3UT9B 5BT1D 4WU9D 3C1BD 4J8WC 3AZHD 1KX5B 3REJD 4AWLB 5B1MB 4WNNB 3RELD 3LELD 4ZUXD 5DNND 4JJNB 3V9RB 5CPKC 3MGQA 5B31B 3MGSA 1F66C 3W96C 3LZ0C 4KHAA 3KWQB 1ID3B 1P3BD 3WAAA 3VH5T 3W98A 1M19D 5AV8D 3B6GB 5AY8D 3WTPD 1HQ3A 3AZID 4Z5TA 1BH8B 3AZNA 1P3LA 5AVBD 1KX3A 4G92C 3WA9D 1P3AB 3W99C 3AZJA 2HIOB 4EO5C 3C1CB 3AZFC 1P3IB 1B6WA 3MVDB 5AVCD 3B0BA 4J8VD 3AZKA 4YS3B 3B0DC 5F99C 4XZQD 2NQBA 3W96D 2CV5C 5CP6A 3NQUA 5B40C 5AV9A 5GXQB 3AZLD 3UTAA 2F8NA 3O62B 4G91C 5C3IC 3MGRC 5B0ZB 3X1UD 2BYKA 3UTBA 4ZBJC 1A7WA 3AZFD 1ZLAD 5B24B 4KGCB 5DNMC 3AN2C 3NQJB 2CWEA 5AV6D 3X1SB 3AZMB 1S32A 5G49B 1M1AD 5JA4B 1JFIA 5B0YC 2CV5D 1M18A 3REIA 3MGPC 1KX5A 5JRGC 5B2JA 2IO5C 2FJ7A 3AV2A 4KUDD 3MGQB 1HTAA 4M6BA 5E5AA 4Z66B 4JJNA 1WWSA 3AYWA 5B31A 4NFTA 5CPJC 5DNMD 3AN2D 1KX4B 3W98B 4J8XA 5B2ID 3B6FD 5GT0B 4QLCA 3LZ1C 5B32C 3AFAC 3MGSD 1ID3A 3TU4D 2NZDB 3AZNB 4Z5TB 2AROC 1P3LB 1H3OA 3AZGC 5B1LB 4H9RB 5GT3C 3B6GA 3WAAD 5AV5C 5JRGD 1P3AA 3AZEC 3AZKB 4HGAC 2HIOA 1TZYD 1KX3D 1AOID 2NQBB 1U35A 5KDMA 5CPID 3AV1D 2YFWA 1P3PC 3NQUB 5FUGB 5BT1C 5BNVA 4J8WA 1F1EA 1B67A 2F8NB 2LY8A 3O62A 4ZUXC 3UTBB 1P34D 5AV9D 1F66A 3X1TB 3LZ0A 4X23A 4H9PB 3AZED 5B1MC 5BS7A 4J8UD 1P3KD 1P3BC 4KGCA 3NQJA 5CHLB 1JFIB 4YM6B 3AZMA 3R45B 2JSSA 5AY8C 5G49A 1EQZC 3WTPC 5JA4A 3AZIC 4WU8A 1M18B 1ULYA 1P3FA 3REIB 5AVBC 1S32D 3W99A 1WWIA 3WA9C 3REKD 5B2JB 2FJ7B 3AV2B 4WZSB 4R8PB 3W97D 5AVCC 4E44A 5B33B 5E5AB 1BFMA 3MNNB 4J8VC 3UT9D 5F99A 1P3GA 3WTPE 3KXBC 3AYWB 2HUEB 4WU9B 3C1BB 1KX5D 4XZQC 3AZHB 4Z66A 3REJB 4J8XB 4XUJB 3LJAB 4QLCB 5B40A
chains in the Genus database with same CATH superfamily
5B1MD 3MVDC 1P3MB 3RELB 5B31G 3AZLC 3KUYB 1KX4A 2F8NK 3LELB 5DNNB 5GT0A 1P3OC 1H3OB 3H0MC 3MGRA 1EQZD 2NZDA 3IP4C 2J8PA 5B1LA 4H9RA 3KWQD 3X1UC 3A6NB 3REHC 5BNXA 1ZLAC 3B6GD 1M19B 5AV8B 5AV6C 1U35B 5KDMB 2PYOB 2YFWB 3KXBD 5B0YA 1M1AC 4LD9A 1P3AD 5BNVB 4J8WB 2HIOD 3C1CD 4UPKA 1P3ID 3MVDD 2VQRA 4H9SC 5FUGA 4NE5A 1N1JB 1P3OD 3WKJC 4YS3D 5CPKB 4KUDC 1F66B 3W96B 3LZ0B 1Q9CA 4X23B 3REHD 5GXQD 5CPJA 4E45A 5GSUA 3X1VA 3X1TA 3B0CW 4H9PA 3LZ1A 3VH6T 5B2IC 3B6FC 3MGSC 2AROA 3TU4C 5B0ZD 4WU8B 4G92B 5GT3A 4H9QA 1P3FB 4YM6A 3R45A 3W99B 3WAAC 4EO5B 5B24D 3AZFB 3X1SD 4DQYB 3WKJD 1HQ3C 3B0DB 5F99B 1P3GB 3P5JB 1TZYC 4R8PA 1P3LC 1KX3C 3KSYA 1AOIC 1T3UA 5B33A 2CV5B 1P3PA 3MNNA 3AZJC 5CPIC 3AV1C 5B40B 4Z2MG 3EPLA 4WU9A 4DRBA 3C1BA 4G91B 3AZHA 3REJA 4XUJA 5C3IB 3LJAA 4UUZB 3MGQD 3MGRB 1P3MA 2BG1A 3RELA 3KUYA 3LELA 4ZUXA 5DNNA 5CP6C 4ZBJB 1TAFB 1P34C 5AV9C 4NE3A 3A1IA 3W98D 5DNMB 3UTAC 3AN2B 2RVQD 5BNXB 2Y2KA 3A6NA 3AZND 1HQ3D 1P3BA 4Z5TD 4J8UC 1P3KC 1P3LD 5B1LD 5B0YB 4LD9B 1M19A 5AV8A 2Y2IA 3AZJD 2PYOA 1Z2CB 3WTPA 3EPHA 3WA9A 3MGPB 3AZKD 5JRGB 2IO5B 4Z2MH 1S32C 3REKC 4NE6A 2NQBD 1N1JA 3W97C 5CP6D 4J8VA 5CPKA 2F8NG 3UT9C 5CPJB 3W96A 5GSUB 2Y2MA 3UTAD 3X1VB 2F8ND 1KX5C 3H0LC 4AWLC 3LZ1B 5B32B 3AFAB 3VH5A 4CSRB 3AZLA 2AROB 3VH5W 3AZGB 3UTBD 4JJNC 5GT3B 4H9QB 5B31C 5AV5B 4J8XC 3X1UA 3AZEB 3KWQC 1ID3C 4HGAB 3AZFA 1ZLAA 4YM6D 5AV6A 3B6GC 1P3PB 1M18D 1M1AA 3REID 5BO0A 5B2JD 2CV5A 1P3AC 2FJ7D 3AV2D 2HIOC 3C1CC 1P3IC 1PZRA 5E5AD 4JJND 4ZUXB 4KUDA 4UUZA 4YS3C 5B31D 3AYWD 2Y2PA 4J8XD 4XUJD 3LJAD 4QLCD 1TAFA 1ID3D 1P3MD 5GXQC 3VH6A 3KUYD 1P3BB 5DNMA 2Y2GA 1BH9A 3AN2A 3O62C 3VH6W 5B2IA 3B6FA 5AY8B 2RIQA 3TU4A 1EQZB 2YFVB 3WTPB 3AZIB 4H9NB 4X23C 5AVBB 5B0ZC 3A6ND 3WA9B 5BS7C 5B24C 4H9OB 4KGCC 5AVCB 3MGPA 1U35D 3X1SC 3AZMC 5JRGA 2PYOD 4J8VB 3KXBB 1TZYA 4WU8C 1AOIA 4CAYA 4J8WD 1P3FC 4XZQB 2ZY3A 5CPIA 3AV1A 3AZLB 3O62D 2BYMB 5CPKD 1P3OB 5B32A 3AFAA 1P3GC 4CSRA 1F66D 2Y2HA 3MGQC 3KFUG 3LZ0D 4X23D 3AZGA 4Z66C 3EPKA 3X1UB 1P34A 3REHB 4KGCD 1KX4C 1ZLAB 3W98C 5AV5A 2RVQC 5GT0C 3AZMD 3AZEA 5AV6B 3EG5B 2NZDC 4J8UA 3AZNC 1P3KA 4Z5TC 4WU8D 1M1AB 1P3FD 5B1LC 3W99D 4DRAA 5BO0B 3WKJB 3AZKC 3REKA 5F99D 1P3GD 4KUDB 4LD9C 3W97A 2NQBC 4Z66D 2DF4C 3UT9A 5B40D 1KX4D 1BH9B 5GT0D 5B2IB 3B6FB 5B1MA 3MGRD 4WNNA 3MGSB 2NZDD 3TU4B 3V9RA 4KHAB 3UTBC 2Y2OA 5AY8A 3WAAB 1EQZA 2YFVA 3X1VC 5GSUC 3AZIA 3X1TC 3B0CT 4H9NA 5AVBA 3KWQA 1HQ3B 2L5AA 4H9OA 5B0YD 4LD9D 1TZYB 1KX3B 1AOIB 4CAYB 5AVCA 4YM6C 2DQNC 3AZJB 1BH8A 5CPIB 3AV1B 3KXBA 1M18C 3MGPD 2F2AC 4XZQA 3REIC 5B2JC 3C1CA 2FJ7C 3AV2C 1P3IA 3MVDA 1W2EA 4R8PC 2BYMA 5B33C 5CP6B 5E5AC 4YS3A 3MNNC 1P3OA 1P34B 3AYWC 5CPJD 2HUEC 5GSUD 5B32G 5AV9B 3X1TD 2JE5A 3X1VD 3C1BC 3UTAB 4WU9C 3LZ1D 3AZHC 3REJC 5B32D 3AFAD 4XUJC 3LJAC 4QLCC 3REHA 5GXQA 2AROD 4WV4B 1P3MC 4J8UB 3RELC 1P3KB 3KUYC 3AZGD 3LELC 5GT3D 5DNNC 2BYKB 2FFFB 2Y2QA 2G5HC 1R4VA 5AV5D 5B0ZA 2ZY4A 1KU5A 2F8NH 1S32B 3A6NC 5B24A 3REKB 4H9SA 4R8PD 2JCHA 3X1SA 1M19C 2XD1A 5B33D 5AV8C 1P3PD 3W97B 3MNND 3H0RC 1U35C 3F6TA 2PYOC 3WKJA 3UT9B 5BT1D 4WU9D 3C1BD 3AL0C 4J8WC 3AZHD 1KX5B 3REJD 4AWLB 5B1MB 4WNNB 3RELD 3LELD 4ZUXD 5DNND 4JJNB 3V9RB 5CPKC 3MGQA 5B31B 3MGSA 1F66C 3W96C 3LZ0C 4KHAA 3KWQB 1ID3B 1P3BD 3WAAA 3VH5T 3W98A 1M19D 5AV8D 3B6GB 2ZY5A 5AY8D 2G5IC 3WTPD 1HQ3A 3AZID 4Z5TA 1BH8B 3AZNA 1P3LA 5AVBD 1KX3A 4G92C 3WA9D 1P3AB 3W99C 3AZJA 2HIOB 4EO5C 3C1CB 3AZFC 1P3IB 4WJ3C 1B6WA 3MVDB 5AVCD 3B0BA 4J8VD 3AZKA 4YS3B 2Y2NA 3B0DC 5F99C 4XZQD 2NQBA 3W96D 2CV5C 5CP6A 2XD5A 3NQUA 5B40C 5GXQB 5AV9A 3AZLD 3UTAA 2F8NA 3O62B 4G91C 5C3IC 3MGRC 5B0ZB 3X1UD 2BYKA 3UTBA 4ZBJC 1A7WA 3A1KA 3AZFD 1ZLAD 5B24B 4KGCB 5DNMC 3AN2C 3NQJB 2CWEA 5AV6D 3X1SB 3AZMB 1S32A 5G49B 1M1AD 5JA4B 1JFIA 5B0YC 2CV5D 1M18A 3REIA 2UWXA 3MGPC 1KX5A 5JRGC 5B2JA 2IO5C 2FJ7A 3AV2A 4KUDD 3MGQB 1HTAA 4M6BA 5E5AA 4Z66B 4JJNA 1WWSA 3AYWA 5B31A 4NFTA 5CPJC 5DNMD 3AN2D 1KX4B 3W98B 4J8XA 5B2ID 3B6FD 5GT0B 4QLCA 3LZ1C 5B32C 3AFAC 3MGSD 1ID3A 3TU4D 2NZDB 3AZNB 4Z5TB 2AROC 1P3LB 1H3OA 3AZGC 5B1LB 4H9RB 5GT3C 3B6GA 3WAAD 3EPJA 5AV5C 5JRGD 1P3AA 3AZEC 3AZKB 2Y2JA 2HIOA 4HGAC 1TZYD 2Y2LA 1KX3D 1AOID 2W8SA 2NQBB 1U35A 5KDMA 5CPID 3AV1D 2YFWA 1P3PC 3NQUB 5FUGB 5BT1C 5BNVA 4J8WA 1F1EA 1B67A 2F8NB 2LY8A 3O62A 4ZUXC 3UTBB 1P34D 3FDDA 5AV9D 1F66A 3X1TB 3LZ0A 4X23A 4H9PB 3AZED 2ZY2A 5B1MC 5BS7A 4J8UD 1P3KD 1P3BC 4KGCA 3NQJA 5CHLB 1JFIB 4YM6B 3AZMA 3R45B 2JSSA 5AY8C 5G49A 1EQZC 3WTPC 5JA4A 3AZIC 4WU8A 1M18B 1ULYA 1P3FA 3REIB 5AVBC 1S32D 3W99A 1WWIA 3WA9C 3REKD 5B2JB 2FJ7B 3AV2B 4WZSB 4R8PB 3W97D 5AVCC 4E44A 5B33B 5E5AB 1BFMA 3MNNB 4J8VC 3UT9D 5F99A 1P3GA 3WTPE 3KXBC 3AYWB 2HUEB 4WU9B 3C1BB 1KX5D 4XZQC 3AZHB 4Z66A 3REJB 4J8XB 4XUJB 3LJAB 2ZM5A 4QLCB 5B40A
chains in the Genus database with same CATH topology
5B1MD 3MVDC 1P3MB 3RELB 5B31G 3AZLC 3KUYB 1KX4A 2F8NK 3LELB 5DNNB 5GT0A 1P3OC 1H3OB 3H0MC 3MGRA 1EQZD 2NZDA 3IP4C 2J8PA 5B1LA 4H9RA 3KWQD 3X1UC 3A6NB 3REHC 5BNXA 1ZLAC 3B6GD 1M19B 5AV8B 5AV6C 1U35B 5KDMB 2PYOB 2YFWB 3KXBD 5B0YA 1M1AC 4LD9A 1P3AD 5BNVB 4J8WB 2HIOD 3C1CD 4UPKA 1P3ID 3MVDD 2VQRA 4H9SC 5FUGA 4NE5A 1N1JB 1P3OD 3WKJC 4YS3D 5CPKB 4KUDC 1F66B 3W96B 3LZ0B 1Q9CA 4X23B 3REHD 5GXQD 5CPJA 4E45A 5GSUA 3X1VA 3X1TA 3B0CW 4H9PA 3LZ1A 3VH6T 5B2IC 3B6FC 3MGSC 2AROA 3TU4C 5B0ZD 4WU8B 4G92B 5GT3A 4H9QA 1P3FB 4YM6A 3R45A 3W99B 3WAAC 4EO5B 5B24D 3AZFB 3X1SD 4DQYB 3WKJD 1HQ3C 3B0DB 5F99B 1P3GB 3P5JB 1TZYC 4R8PA 1P3LC 1KX3C 3KSYA 1AOIC 1T3UA 5B33A 2CV5B 1P3PA 3MNNA 3AZJC 5CPIC 3AV1C 5B40B 4Z2MG 3EPLA 4WU9A 4DRBA 3C1BA 4G91B 3AZHA 3REJA 4XUJA 5C3IB 3LJAA 4UUZB 3MGQD 3MGRB 1P3MA 2BG1A 3RELA 3KUYA 3LELA 4ZUXA 5DNNA 5CP6C 4ZBJB 1TAFB 1P34C 5AV9C 4NE3A 3A1IA 3W98D 5DNMB 3UTAC 3AN2B 2RVQD 5BNXB 2Y2KA 3A6NA 3AZND 1HQ3D 1P3BA 4Z5TD 4J8UC 1P3KC 1P3LD 5B1LD 5B0YB 4LD9B 1M19A 5AV8A 2Y2IA 3AZJD 2PYOA 1Z2CB 3WTPA 3EPHA 3WA9A 3MGPB 3AZKD 5JRGB 2IO5B 4Z2MH 1S32C 3REKC 4NE6A 2NQBD 1N1JA 3W97C 5CP6D 4J8VA 5CPKA 2F8NG 3UT9C 5CPJB 3W96A 5GSUB 2Y2MA 3UTAD 3X1VB 2F8ND 1KX5C 3H0LC 4AWLC 3LZ1B 5B32B 3AFAB 3VH5A 4CSRB 3AZLA 2AROB 3VH5W 3AZGB 3UTBD 4JJNC 5GT3B 4H9QB 5B31C 5AV5B 4J8XC 3X1UA 3AZEB 3KWQC 1ID3C 4HGAB 3AZFA 1ZLAA 4YM6D 5AV6A 3B6GC 1P3PB 1M18D 1M1AA 3REID 5BO0A 5B2JD 2CV5A 1P3AC 2FJ7D 3AV2D 2HIOC 3C1CC 1P3IC 1PZRA 5E5AD 4JJND 4ZUXB 4KUDA 4UUZA 4YS3C 5B31D 3AYWD 2Y2PA 4J8XD 4XUJD 3LJAD 4QLCD 1TAFA 1ID3D 1P3MD 5GXQC 3VH6A 3KUYD 1P3BB 5DNMA 2Y2GA 1BH9A 3AN2A 3O62C 3VH6W 5B2IA 3B6FA 5AY8B 2RIQA 3TU4A 1EQZB 2YFVB 3WTPB 3AZIB 4H9NB 4X23C 5AVBB 5B0ZC 3A6ND 3WA9B 5BS7C 5B24C 4H9OB 4KGCC 5AVCB 3MGPA 1U35D 3X1SC 3AZMC 5JRGA 2PYOD 4J8VB 3KXBB 1TZYA 4WU8C 1AOIA 4CAYA 4J8WD 1P3FC 4XZQB 2ZY3A 5CPIA 3AV1A 3AZLB 3O62D 2BYMB 5CPKD 1P3OB 5B32A 3AFAA 1P3GC 4CSRA 1F66D 2Y2HA 3MGQC 3KFUG 3LZ0D 4X23D 3AZGA 4Z66C 3EPKA 3X1UB 1P34A 3REHB 4KGCD 1KX4C 1ZLAB 3W98C 5AV5A 2RVQC 5GT0C 3AZMD 3AZEA 5AV6B 3EG5B 2NZDC 4J8UA 3AZNC 1P3KA 4Z5TC 4WU8D 1M1AB 1P3FD 5B1LC 3W99D 4DRAA 5BO0B 3WKJB 3AZKC 3REKA 5F99D 1P3GD 4KUDB 4LD9C 3W97A 2NQBC 4Z66D 2DF4C 3UT9A 5B40D 1KX4D 1BH9B 5GT0D 5B2IB 3B6FB 5B1MA 3MGRD 4WNNA 3MGSB 2NZDD 3TU4B 3V9RA 4KHAB 3UTBC 2Y2OA 5AY8A 3WAAB 1EQZA 2YFVA 3X1VC 5GSUC 3AZIA 3X1TC 3B0CT 4H9NA 5AVBA 3KWQA 1HQ3B 2L5AA 4H9OA 5B0YD 4LD9D 1TZYB 1KX3B 1AOIB 4CAYB 5AVCA 4YM6C 2DQNC 3AZJB 1BH8A 5CPIB 3AV1B 3KXBA 1M18C 3MGPD 2F2AC 4XZQA 3REIC 5B2JC 3C1CA 2FJ7C 3AV2C 1P3IA 3MVDA 1W2EA 4R8PC 2BYMA 5B33C 5CP6B 5E5AC 4YS3A 3MNNC 1P3OA 1P34B 3AYWC 5CPJD 2HUEC 5GSUD 5B32G 5AV9B 3X1TD 2JE5A 3X1VD 3C1BC 3UTAB 4WU9C 3LZ1D 3AZHC 3REJC 5B32D 3AFAD 4XUJC 3LJAC 4QLCC 3REHA 5GXQA 2AROD 4WV4B 1P3MC 4J8UB 3RELC 1P3KB 3KUYC 3AZGD 3LELC 5GT3D 5DNNC 2BYKB 2FFFB 2Y2QA 2G5HC 1R4VA 5AV5D 5B0ZA 2ZY4A 1KU5A 2F8NH 1S32B 3A6NC 5B24A 3REKB 4H9SA 4R8PD 2JCHA 3X1SA 1M19C 2XD1A 5B33D 5AV8C 1P3PD 3W97B 3MNND 3H0RC 1U35C 3F6TA 2PYOC 3WKJA 3UT9B 5BT1D 4WU9D 3C1BD 3AL0C 4J8WC 3AZHD 1KX5B 3REJD 4AWLB 5B1MB 4WNNB 3RELD 3LELD 4ZUXD 5DNND 4JJNB 3V9RB 5CPKC 3MGQA 5B31B 3MGSA 1F66C 3W96C 3LZ0C 4KHAA 3KWQB 1ID3B 1P3BD 3WAAA 3VH5T 3W98A 1M19D 5AV8D 3B6GB 2ZY5A 5AY8D 2G5IC 3WTPD 1HQ3A 3AZID 4Z5TA 1BH8B 3AZNA 1P3LA 5AVBD 1KX3A 4G92C 3WA9D 1P3AB 3W99C 3AZJA 2HIOB 4EO5C 3C1CB 3AZFC 1P3IB 4WJ3C 1B6WA 3MVDB 5AVCD 3B0BA 4J8VD 3AZKA 4YS3B 2Y2NA 3B0DC 5F99C 4XZQD 2NQBA 3W96D 2CV5C 5CP6A 2XD5A 3NQUA 5B40C 5GXQB 5AV9A 3AZLD 3UTAA 2F8NA 3O62B 4G91C 5C3IC 3MGRC 5B0ZB 3X1UD 2BYKA 3UTBA 4ZBJC 1A7WA 3A1KA 3AZFD 1ZLAD 5B24B 4KGCB 5DNMC 3AN2C 3NQJB 2CWEA 5AV6D 3X1SB 3AZMB 1S32A 5G49B 1M1AD 5JA4B 1JFIA 5B0YC 2CV5D 1M18A 3REIA 2UWXA 3MGPC 1KX5A 5JRGC 5B2JA 2IO5C 2FJ7A 3AV2A 4KUDD 3MGQB 1HTAA 4M6BA 5E5AA 4Z66B 4JJNA 1WWSA 3AYWA 5B31A 4NFTA 5CPJC 5DNMD 3AN2D 1KX4B 3W98B 4J8XA 5B2ID 3B6FD 5GT0B 4QLCA 3LZ1C 5B32C 3AFAC 3MGSD 1ID3A 3TU4D 2NZDB 3AZNB 4Z5TB 2AROC 1P3LB 1H3OA 3AZGC 5B1LB 4H9RB 5GT3C 3B6GA 3WAAD 3EPJA 5AV5C 5JRGD 1P3AA 3AZEC 3AZKB 2Y2JA 2HIOA 4HGAC 1TZYD 2Y2LA 1KX3D 1AOID 2W8SA 2NQBB 1U35A 5KDMA 5CPID 3AV1D 2YFWA 1P3PC 3NQUB 5FUGB 5BT1C 5BNVA 4J8WA 1F1EA 1B67A 2F8NB 2LY8A 3O62A 4ZUXC 3UTBB 1P34D 3FDDA 5AV9D 1F66A 3X1TB 3LZ0A 4X23A 4H9PB 3AZED 2ZY2A 5B1MC 5BS7A 4J8UD 1P3KD 1P3BC 4KGCA 3NQJA 5CHLB 1JFIB 4YM6B 3AZMA 3R45B 2JSSA 5AY8C 5G49A 1EQZC 3WTPC 5JA4A 3AZIC 4WU8A 1M18B 1ULYA 1P3FA 3REIB 5AVBC 1S32D 3W99A 1WWIA 3WA9C 3REKD 5B2JB 2FJ7B 3AV2B 4WZSB 4R8PB 3W97D 5AVCC 4E44A 5B33B 5E5AB 1BFMA 3MNNB 4J8VC 3UT9D 5F99A 1P3GA 3WTPE 3KXBC 3AYWB 2HUEB 4WU9B 3C1BB 1KX5D 4XZQC 3AZHB 4Z66A 3REJB 4J8XB 4XUJB 3LJAB 2ZM5A 4QLCB 5B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M D;  3MVD C;  1P3M B;  3REL B;  5B31 G;  3AZL C;  3KUY B;  1KX4 A;  2F8N K;  3LEL B;  5DNN B;  5GT0 A;  1P3O C;  1H3O B;  3MGR A;  1EQZ D;  2NZD A;  5B1L A;  4H9R A;  3KWQ D;  3X1U C;  3A6N B;  3REH C;  5BNX A;  1ZLA C;  3B6G D;  1M19 B;  5AV8 B;  5AV6 C;  1U35 B;  5KDM B;  2PYO B;  2YFW B;  3KXB D;  5B0Y A;  1M1A C;  4LD9 A;  1P3A D;  5BNV B;  4J8W B;  2HIO D;  3C1C D;  1P3I D;  3MVD D;  4H9S C;  5FUG A;  4NE5 A;  1N1J B;  1P3O D;  3WKJ C;  4YS3 D;  5CPK B;  4KUD C;  1F66 B;  3W96 B;  3LZ0 B;  1Q9C A;  4X23 B;  3REH D;  5GXQ D;  5CPJ A;  4E45 A;  5GSU A;  3X1V A;  3X1T A;  3B0C W;  4H9P A;  3LZ1 A;  3VH6 T;  5B2I C;  3B6F C;  3MGS C;  2ARO A;  3TU4 C;  5B0Z D;  4WU8 B;  4G92 B;  5GT3 A;  4H9Q A;  1P3F B;  4YM6 A;  3R45 A;  3W99 B;  3WAA C;  4EO5 B;  5B24 D;  3AZF B;  3X1S D;  3WKJ D;  1HQ3 C;  3B0D B;  5F99 B;  1P3G B;  1TZY C;  4R8P A;  1P3L C;  1KX3 C;  3KSY A;  1AOI C;  5B33 A;  2CV5 B;  1P3P A;  3MNN A;  3AZJ C;  5CPI C;  3AV1 C;  5B40 B;  4Z2M G;  4WU9 A;  4DRB A;  3C1B A;  4G91 B;  3AZH A;  3REJ A;  4XUJ A;  5C3I B;  3LJA A;  4UUZ B;  3MGQ D;  3MGR B;  1P3M A;  3REL A;  3KUY A;  3LEL A;  4ZUX A;  5DNN A;  5CP6 C;  4ZBJ B;  1TAF B;  1P34 C;  5AV9 C;  4NE3 A;  3W98 D;  5DNM B;  3UTA C;  3AN2 B;  2RVQ D;  5BNX B;  3A6N A;  3AZN D;  1HQ3 D;  1P3B A;  4Z5T D;  4J8U C;  1P3K C;  1P3L D;  5B1L D;  5B0Y B;  4LD9 B;  1M19 A;  5AV8 A;  3AZJ D;  2PYO A;  3WTP A;  3WA9 A;  3MGP B;  3AZK D;  5JRG B;  2IO5 B;  4Z2M H;  1S32 C;  3REK C;  4NE6 A;  2NQB D;  1N1J A;  3W97 C;  5CP6 D;  4J8V A;  5CPK A;  2F8N G;  3UT9 C;  5CPJ B;  3W96 A;  5GSU B;  3UTA D;  3X1V B;  2F8N D;  1KX5 C;  4AWL C;  3LZ1 B;  5B32 B;  3AFA B;  3VH5 A;  4CSR B;  3AZL A;  2ARO B;  3VH5 W;  3AZG B;  3UTB D;  4JJN C;  5GT3 B;  4H9Q B;  5B31 C;  5AV5 B;  4J8X C;  3X1U A;  3AZE B;  3KWQ C;  1ID3 C;  4HGA B;  3AZF A;  1ZLA A;  4YM6 D;  5AV6 A;  3B6G C;  1P3P B;  1M18 D;  1M1A A;  3REI D;  5BO0 A;  5B2J D;  2CV5 A;  1P3A C;  2FJ7 D;  3AV2 D;  2HIO C;  3C1C C;  1P3I C;  5E5A D;  4JJN D;  4ZUX B;  4KUD A;  4UUZ A;  4YS3 C;  5B31 D;  3AYW D;  4J8X D;  4XUJ D;  3LJA D;  4QLC D;  1TAF A;  1ID3 D;  1P3M D;  5GXQ C;  3VH6 A;  3KUY D;  1P3B B;  5DNM A;  3AN2 A;  1BH9 A;  3O62 C;  3VH6 W;  5B2I A;  3B6F A;  5AY8 B;  3TU4 A;  1EQZ B;  2YFV B;  3WTP B;  3AZI B;  4H9N B;  4X23 C;  5AVB B;  5B0Z C;  3A6N D;  3WA9 B;  5BS7 C;  5B24 C;  4H9O B;  4KGC C;  5AVC B;  3MGP A;  1U35 D;  3X1S C;  3AZM C;  5JRG A;  2PYO D;  4J8V B;  3KXB B;  1TZY A;  4WU8 C;  1AOI A;  4CAY A;  4J8W D;  1P3F C;  4XZQ B;  5CPI A;  3AV1 A;  3AZL B;  3O62 D;  2BYM B;  5CPK D;  1P3O B;  5B32 A;  3AFA A;  1P3G C;  4CSR A;  1F66 D;  3MGQ C;  3LZ0 D;  4X23 D;  3AZG A;  4Z66 C;  3X1U B;  1P34 A;  3REH B;  4KGC D;  1KX4 C;  1ZLA B;  3W98 C;  5AV5 A;  2RVQ C;  5GT0 C;  3AZM D;  3AZE A;  5AV6 B;  2NZD C;  4J8U A;  3AZN C;  1P3K A;  4Z5T C;  4WU8 D;  1M1A B;  1P3F D;  5B1L C;  3W99 D;  4DRA A;  5BO0 B;  3WKJ B;  3AZK C;  3REK A;  5F99 D;  1P3G D;  4KUD B;  4LD9 C;  3W97 A;  2NQB C;  4Z66 D;  3UT9 A;  5B40 D;  1KX4 D;  1BH9 B;  5GT0 D;  5B2I B;  3B6F B;  5B1M A;  3MGR D;  4WNN A;  3MGS B;  2NZD D;  3TU4 B;  3V9R A;  4KHA B;  3UTB C;  5AY8 A;  3WAA B;  1EQZ A;  2YFV A;  3X1V C;  5GSU C;  3AZI A;  3X1T C;  3B0C T;  4H9N A;  5AVB A;  3KWQ A;  1HQ3 B;  2L5A A;  4H9O A;  5B0Y D;  4LD9 D;  1TZY B;  1KX3 B;  1AOI B;  4CAY B;  5AVC A;  4YM6 C;  3AZJ B;  1BH8 A;  5CPI B;  3AV1 B;  3KXB A;  1M18 C;  3MGP D;  4XZQ A;  3REI C;  5B2J C;  3C1C A;  2FJ7 C;  3AV2 C;  1P3I A;  3MVD A;  4R8P C;  2BYM A;  5B33 C;  5CP6 B;  5E5A C;  4YS3 A;  3MNN C;  1P3O A;  1P34 B;  3AYW C;  5CPJ D;  2HUE C;  5GSU D;  5B32 G;  5AV9 B;  3X1T D;  3X1V D;  4WU9 C;  3C1B C;  3UTA B;  3LZ1 D;  3AZH C;  3REJ C;  5B32 D;  3AFA D;  4XUJ C;  3LJA C;  4QLC C;  3REH A;  5GXQ A;  2ARO D;  4WV4 B;  1P3M C;  4J8U B;  3REL C;  1P3K B;  3KUY C;  3AZG D;  3LEL C;  5GT3 D;  5DNN C;  2BYK B;  1R4V A;  5AV5 D;  5B0Z A;  1KU5 A;  2F8N H;  1S32 B;  3A6N C;  5B24 A;  3REK B;  4H9S A;  4R8P D;  3X1S A;  1M19 C;  5B33 D;  5AV8 C;  3W97 B;  1P3P D;  3WKJ A;  3MNN D;  1U35 C;  2PYO C;  3UT9 B;  5BT1 D;  4WU9 D;  3C1B D;  4J8W C;  3AZH D;  1KX5 B;  3REJ D;  4AWL B;  5B1M B;  4WNN B;  3REL D;  3LEL D;  4ZUX D;  5DNN D;  4JJN B;  3V9R B;  5CPK C;  3MGQ A;  5B31 B;  3MGS A;  1F66 C;  3W96 C;  3LZ0 C;  4KHA A;  3KWQ B;  1ID3 B;  1P3B D;  3WAA A;  3VH5 T;  3W98 A;  1M19 D;  5AV8 D;  3B6G B;  5AY8 D;  3WTP D;  1HQ3 A;  3AZI D;  4Z5T A;  1BH8 B;  3AZN A;  1P3L A;  5AVB D;  1KX3 A;  4G92 C;  3WA9 D;  1P3A B;  3W99 C;  3AZJ A;  2HIO B;  4EO5 C;  3C1C B;  3AZF C;  1P3I B;  1B6W A;  3MVD B;  5AVC D;  3B0B A;  4J8V D;  3AZK A;  4YS3 B;  3B0D C;  5F99 C;  4XZQ D;  2NQB A;  3W96 D;  2CV5 C;  5CP6 A;  3NQU A;  5B40 C;  5AV9 A;  5GXQ B;  3AZL D;  3UTA A;  2F8N A;  3O62 B;  4G91 C;  5C3I C;  3MGR C;  5B0Z B;  3X1U D;  2BYK A;  3UTB A;  4ZBJ C;  1A7W A;  3AZF D;  1ZLA D;  5B24 B;  4KGC B;  5DNM C;  3AN2 C;  3NQJ B;  2CWE A;  5AV6 D;  3X1S B;  3AZM B;  1S32 A;  5G49 B;  1M1A D;  5JA4 B;  1JFI A;  5B0Y C;  2CV5 D;  1M18 A;  3REI A;  3MGP C;  1KX5 A;  5JRG C;  5B2J A;  2IO5 C;  2FJ7 A;  3AV2 A;  4KUD D;  3MGQ B;  1HTA A;  4M6B A;  5E5A A;  4Z66 B;  4JJN A;  1WWS A;  3AYW A;  5B31 A;  4NFT A;  5CPJ C;  5DNM D;  3AN2 D;  1KX4 B;  3W98 B;  4J8X A;  5B2I D;  3B6F D;  5GT0 B;  4QLC A;  3LZ1 C;  5B32 C;  3AFA C;  3MGS D;  1ID3 A;  3TU4 D;  2NZD B;  3AZN B;  4Z5T B;  2ARO C;  1P3L B;  1H3O A;  3AZG C;  5B1L B;  4H9R B;  5GT3 C;  3B6G A;  3WAA D;  5AV5 C;  5JRG D;  1P3A A;  3AZE C;  3AZK B;  4HGA C;  2HIO A;  1TZY D;  1KX3 D;  1AOI D;  2NQB B;  1U35 A;  5KDM A;  5CPI D;  3AV1 D;  2YFW A;  1P3P C;  3NQU B;  5FUG B;  5BT1 C;  5BNV A;  4J8W A;  1F1E A;  1B67 A;  2F8N B;  2LY8 A;  3O62 A;  4ZUX C;  3UTB B;  1P34 D;  5AV9 D;  1F66 A;  3X1T B;  3LZ0 A;  4X23 A;  4H9P B;  3AZE D;  5B1M C;  5BS7 A;  4J8U D;  1P3K D;  1P3B C;  4KGC A;  3NQJ A;  5CHL B;  1JFI B;  4YM6 B;  3AZM A;  3R45 B;  2JSS A;  5AY8 C;  5G49 A;  1EQZ C;  3WTP C;  5JA4 A;  3AZI C;  4WU8 A;  1M18 B;  1ULY A;  1P3F A;  3REI B;  5AVB C;  1S32 D;  3W99 A;  1WWI A;  3WA9 C;  3REK D;  5B2J B;  2FJ7 B;  3AV2 B;  4WZS B;  4R8P B;  3W97 D;  5AVC C;  4E44 A;  5B33 B;  5E5A B;  1BFM A;  3MNN B;  4J8V C;  3UT9 D;  5F99 A;  1P3G A;  3WTP E;  3KXB C;  3AYW B;  2HUE B;  4WU9 B;  3C1B B;  1KX5 D;  4XZQ C;  3AZH B;  4Z66 A;  3REJ B;  4J8X B;  4XUJ B;  3LJA B;  4QLC B;  5B40 A; 
#chains in the Genus database with same CATH topology
 5B1M D;  3MVD C;  1P3M B;  3REL B;  5B31 G;  3AZL C;  3KUY B;  1KX4 A;  2F8N K;  3LEL B;  5DNN B;  5GT0 A;  1P3O C;  1H3O B;  3H0M C;  3MGR A;  1EQZ D;  2NZD A;  3IP4 C;  2J8P A;  5B1L A;  4H9R A;  3KWQ D;  3X1U C;  3A6N B;  3REH C;  5BNX A;  1ZLA C;  3B6G D;  1M19 B;  5AV8 B;  5AV6 C;  1U35 B;  5KDM B;  2PYO B;  2YFW B;  3KXB D;  5B0Y A;  1M1A C;  4LD9 A;  1P3A D;  5BNV B;  4J8W B;  2HIO D;  3C1C D;  4UPK A;  1P3I D;  3MVD D;  2VQR A;  4H9S C;  5FUG A;  4NE5 A;  1N1J B;  1P3O D;  3WKJ C;  4YS3 D;  5CPK B;  4KUD C;  1F66 B;  3W96 B;  3LZ0 B;  1Q9C A;  4X23 B;  3REH D;  5GXQ D;  5CPJ A;  4E45 A;  5GSU A;  3X1V A;  3X1T A;  3B0C W;  4H9P A;  3LZ1 A;  3VH6 T;  5B2I C;  3B6F C;  3MGS C;  2ARO A;  3TU4 C;  5B0Z D;  4WU8 B;  4G92 B;  5GT3 A;  4H9Q A;  1P3F B;  4YM6 A;  3R45 A;  3W99 B;  3WAA C;  4EO5 B;  5B24 D;  3AZF B;  3X1S D;  4DQY B;  3WKJ D;  1HQ3 C;  3B0D B;  5F99 B;  1P3G B;  3P5J B;  1TZY C;  4R8P A;  1P3L C;  1KX3 C;  3KSY A;  1AOI C;  1T3U A;  5B33 A;  2CV5 B;  1P3P A;  3MNN A;  3AZJ C;  5CPI C;  3AV1 C;  5B40 B;  4Z2M G;  3EPL A;  4WU9 A;  4DRB A;  3C1B A;  4G91 B;  3AZH A;  3REJ A;  4XUJ A;  5C3I B;  3LJA A;  4UUZ B;  3MGQ D;  3MGR B;  1P3M A;  2BG1 A;  3REL A;  3KUY A;  3LEL A;  4ZUX A;  5DNN A;  5CP6 C;  4ZBJ B;  1TAF B;  1P34 C;  5AV9 C;  4NE3 A;  3A1I A;  3W98 D;  5DNM B;  3UTA C;  3AN2 B;  2RVQ D;  5BNX B;  2Y2K A;  3A6N A;  3AZN D;  1HQ3 D;  1P3B A;  4Z5T D;  4J8U C;  1P3K C;  1P3L D;  5B1L D;  5B0Y B;  4LD9 B;  1M19 A;  5AV8 A;  2Y2I A;  3AZJ D;  2PYO A;  1Z2C B;  3WTP A;  3EPH A;  3WA9 A;  3MGP B;  3AZK D;  5JRG B;  2IO5 B;  4Z2M H;  1S32 C;  3REK C;  4NE6 A;  2NQB D;  1N1J A;  3W97 C;  5CP6 D;  4J8V A;  5CPK A;  2F8N G;  3UT9 C;  5CPJ B;  3W96 A;  5GSU B;  2Y2M A;  3UTA D;  3X1V B;  2F8N D;  1KX5 C;  3H0L C;  4AWL C;  3LZ1 B;  5B32 B;  3AFA B;  3VH5 A;  4CSR B;  3AZL A;  2ARO B;  3VH5 W;  3AZG B;  3UTB D;  4JJN C;  5GT3 B;  4H9Q B;  5B31 C;  5AV5 B;  4J8X C;  3X1U A;  3AZE B;  3KWQ C;  1ID3 C;  4HGA B;  3AZF A;  1ZLA A;  4YM6 D;  5AV6 A;  3B6G C;  1P3P B;  1M18 D;  1M1A A;  3REI D;  5BO0 A;  5B2J D;  2CV5 A;  1P3A C;  2FJ7 D;  3AV2 D;  2HIO C;  3C1C C;  1P3I C;  1PZR A;  5E5A D;  4JJN D;  4ZUX B;  4KUD A;  4UUZ A;  4YS3 C;  5B31 D;  3AYW D;  2Y2P A;  4J8X D;  4XUJ D;  3LJA D;  4QLC D;  1TAF A;  1ID3 D;  1P3M D;  5GXQ C;  3VH6 A;  3KUY D;  1P3B B;  5DNM A;  2Y2G A;  1BH9 A;  3AN2 A;  3O62 C;  3VH6 W;  5B2I A;  3B6F A;  5AY8 B;  2RIQ A;  3TU4 A;  1EQZ B;  2YFV B;  3WTP B;  3AZI B;  4H9N B;  4X23 C;  5AVB B;  5B0Z C;  3A6N D;  3WA9 B;  5BS7 C;  5B24 C;  4H9O B;  4KGC C;  5AVC B;  3MGP A;  1U35 D;  3X1S C;  3AZM C;  5JRG A;  2PYO D;  4J8V B;  3KXB B;  1TZY A;  4WU8 C;  1AOI A;  4CAY A;  4J8W D;  1P3F C;  4XZQ B;  2ZY3 A;  5CPI A;  3AV1 A;  3AZL B;  3O62 D;  2BYM B;  5CPK D;  1P3O B;  5B32 A;  3AFA A;  1P3G C;  4CSR A;  1F66 D;  2Y2H A;  3MGQ C;  3KFU G;  3LZ0 D;  4X23 D;  3AZG A;  4Z66 C;  3EPK A;  3X1U B;  1P34 A;  3REH B;  4KGC D;  1KX4 C;  1ZLA B;  3W98 C;  5AV5 A;  2RVQ C;  5GT0 C;  3AZM D;  3AZE A;  5AV6 B;  3EG5 B;  2NZD C;  4J8U A;  3AZN C;  1P3K A;  4Z5T C;  4WU8 D;  1M1A B;  1P3F D;  5B1L C;  3W99 D;  4DRA A;  5BO0 B;  3WKJ B;  3AZK C;  3REK A;  5F99 D;  1P3G D;  4KUD B;  4LD9 C;  3W97 A;  2NQB C;  4Z66 D;  2DF4 C;  3UT9 A;  5B40 D;  1KX4 D;  1BH9 B;  5GT0 D;  5B2I B;  3B6F B;  5B1M A;  3MGR D;  4WNN A;  3MGS B;  2NZD D;  3TU4 B;  3V9R A;  4KHA B;  3UTB C;  2Y2O A;  5AY8 A;  3WAA B;  1EQZ A;  2YFV A;  3X1V C;  5GSU C;  3AZI A;  3X1T C;  3B0C T;  4H9N A;  5AVB A;  3KWQ A;  1HQ3 B;  2L5A A;  4H9O A;  5B0Y D;  4LD9 D;  1TZY B;  1KX3 B;  1AOI B;  4CAY B;  5AVC A;  4YM6 C;  2DQN C;  3AZJ B;  1BH8 A;  5CPI B;  3AV1 B;  3KXB A;  1M18 C;  3MGP D;  2F2A C;  4XZQ A;  3REI C;  5B2J C;  3C1C A;  2FJ7 C;  3AV2 C;  1P3I A;  3MVD A;  1W2E A;  4R8P C;  2BYM A;  5B33 C;  5CP6 B;  5E5A C;  4YS3 A;  3MNN C;  1P3O A;  1P34 B;  3AYW C;  5CPJ D;  2HUE C;  5GSU D;  5B32 G;  5AV9 B;  3X1T D;  2JE5 A;  3X1V D;  3C1B C;  3UTA B;  4WU9 C;  3LZ1 D;  3AZH C;  3REJ C;  5B32 D;  3AFA D;  4XUJ C;  3LJA C;  4QLC C;  3REH A;  5GXQ A;  2ARO D;  4WV4 B;  1P3M C;  4J8U B;  3REL C;  1P3K B;  3KUY C;  3AZG D;  3LEL C;  5GT3 D;  5DNN C;  2BYK B;  2FFF B;  2Y2Q A;  2G5H C;  1R4V A;  5AV5 D;  5B0Z A;  2ZY4 A;  1KU5 A;  2F8N H;  1S32 B;  3A6N C;  5B24 A;  3REK B;  4H9S A;  4R8P D;  2JCH A;  3X1S A;  1M19 C;  2XD1 A;  5B33 D;  5AV8 C;  1P3P D;  3W97 B;  3MNN D;  3H0R C;  1U35 C;  3F6T A;  2PYO C;  3WKJ A;  3UT9 B;  5BT1 D;  4WU9 D;  3C1B D;  3AL0 C;  4J8W C;  3AZH D;  1KX5 B;  3REJ D;  4AWL B;  5B1M B;  4WNN B;  3REL D;  3LEL D;  4ZUX D;  5DNN D;  4JJN B;  3V9R B;  5CPK C;  3MGQ A;  5B31 B;  3MGS A;  1F66 C;  3W96 C;  3LZ0 C;  4KHA A;  3KWQ B;  1ID3 B;  1P3B D;  3WAA A;  3VH5 T;  3W98 A;  1M19 D;  5AV8 D;  3B6G B;  2ZY5 A;  5AY8 D;  2G5I C;  3WTP D;  1HQ3 A;  3AZI D;  4Z5T A;  1BH8 B;  3AZN A;  1P3L A;  5AVB D;  1KX3 A;  4G92 C;  3WA9 D;  1P3A B;  3W99 C;  3AZJ A;  2HIO B;  4EO5 C;  3C1C B;  3AZF C;  1P3I B;  4WJ3 C;  1B6W A;  3MVD B;  5AVC D;  3B0B A;  4J8V D;  3AZK A;  4YS3 B;  2Y2N A;  3B0D C;  5F99 C;  4XZQ D;  2NQB A;  3W96 D;  2CV5 C;  5CP6 A;  2XD5 A;  3NQU A;  5B40 C;  5GXQ B;  5AV9 A;  3AZL D;  3UTA A;  2F8N A;  3O62 B;  4G91 C;  5C3I C;  3MGR C;  5B0Z B;  3X1U D;  2BYK A;  3UTB A;  4ZBJ C;  1A7W A;  3A1K A;  3AZF D;  1ZLA D;  5B24 B;  4KGC B;  5DNM C;  3AN2 C;  3NQJ B;  2CWE A;  5AV6 D;  3X1S B;  3AZM B;  1S32 A;  5G49 B;  1M1A D;  5JA4 B;  1JFI A;  5B0Y C;  2CV5 D;  1M18 A;  3REI A;  2UWX A;  3MGP C;  1KX5 A;  5JRG C;  5B2J A;  2IO5 C;  2FJ7 A;  3AV2 A;  4KUD D;  3MGQ B;  1HTA A;  4M6B A;  5E5A A;  4Z66 B;  4JJN A;  1WWS A;  3AYW A;  5B31 A;  4NFT A;  5CPJ C;  5DNM D;  3AN2 D;  1KX4 B;  3W98 B;  4J8X A;  5B2I D;  3B6F D;  5GT0 B;  4QLC A;  3LZ1 C;  5B32 C;  3AFA C;  3MGS D;  1ID3 A;  3TU4 D;  2NZD B;  3AZN B;  4Z5T B;  2ARO C;  1P3L B;  1H3O A;  3AZG C;  5B1L B;  4H9R B;  5GT3 C;  3B6G A;  3WAA D;  3EPJ A;  5AV5 C;  5JRG D;  1P3A A;  3AZE C;  3AZK B;  2Y2J A;  2HIO A;  4HGA C;  1TZY D;  2Y2L A;  1KX3 D;  1AOI D;  2W8S A;  2NQB B;  1U35 A;  5KDM A;  5CPI D;  3AV1 D;  2YFW A;  1P3P C;  3NQU B;  5FUG B;  5BT1 C;  5BNV A;  4J8W A;  1F1E A;  1B67 A;  2F8N B;  2LY8 A;  3O62 A;  4ZUX C;  3UTB B;  1P34 D;  3FDD A;  5AV9 D;  1F66 A;  3X1T B;  3LZ0 A;  4X23 A;  4H9P B;  3AZE D;  2ZY2 A;  5B1M C;  5BS7 A;  4J8U D;  1P3K D;  1P3B C;  4KGC A;  3NQJ A;  5CHL B;  1JFI B;  4YM6 B;  3AZM A;  3R45 B;  2JSS A;  5AY8 C;  5G49 A;  1EQZ C;  3WTP C;  5JA4 A;  3AZI C;  4WU8 A;  1M18 B;  1ULY A;  1P3F A;  3REI B;  5AVB C;  1S32 D;  3W99 A;  1WWI A;  3WA9 C;  3REK D;  5B2J B;  2FJ7 B;  3AV2 B;  4WZS B;  4R8P B;  3W97 D;  5AVC C;  4E44 A;  5B33 B;  5E5A B;  1BFM A;  3MNN B;  4J8V C;  3UT9 D;  5F99 A;  1P3G A;  3WTP E;  3KXB C;  3AYW B;  2HUE B;  4WU9 B;  3C1B B;  1KX5 D;  4XZQ C;  3AZH B;  4Z66 A;  3REJ B;  4J8X B;  4XUJ B;  3LJA B;  2ZM5 A;  4QLC B;  5B40 A; 
#chains in the Genus database with same CATH homology
 5B1M D;  3MVD C;  1P3M B;  3REL B;  5B31 G;  3AZL C;  3KUY B;  1KX4 A;  2F8N K;  3LEL B;  5DNN B;  5GT0 A;  1P3O C;  1H3O B;  3H0M C;  3MGR A;  1EQZ D;  2NZD A;  3IP4 C;  2J8P A;  5B1L A;  4H9R A;  3KWQ D;  3X1U C;  3A6N B;  3REH C;  5BNX A;  1ZLA C;  3B6G D;  1M19 B;  5AV8 B;  5AV6 C;  1U35 B;  5KDM B;  2PYO B;  2YFW B;  3KXB D;  5B0Y A;  1M1A C;  4LD9 A;  1P3A D;  5BNV B;  4J8W B;  2HIO D;  3C1C D;  4UPK A;  1P3I D;  3MVD D;  2VQR A;  4H9S C;  5FUG A;  4NE5 A;  1N1J B;  1P3O D;  3WKJ C;  4YS3 D;  5CPK B;  4KUD C;  1F66 B;  3W96 B;  3LZ0 B;  1Q9C A;  4X23 B;  3REH D;  5GXQ D;  5CPJ A;  4E45 A;  5GSU A;  3X1V A;  3X1T A;  3B0C W;  4H9P A;  3LZ1 A;  3VH6 T;  5B2I C;  3B6F C;  3MGS C;  2ARO A;  3TU4 C;  5B0Z D;  4WU8 B;  4G92 B;  5GT3 A;  4H9Q A;  1P3F B;  4YM6 A;  3R45 A;  3W99 B;  3WAA C;  4EO5 B;  5B24 D;  3AZF B;  3X1S D;  4DQY B;  3WKJ D;  1HQ3 C;  3B0D B;  5F99 B;  1P3G B;  3P5J B;  1TZY C;  4R8P A;  1P3L C;  1KX3 C;  3KSY A;  1AOI C;  1T3U A;  5B33 A;  2CV5 B;  1P3P A;  3MNN A;  3AZJ C;  5CPI C;  3AV1 C;  5B40 B;  4Z2M G;  3EPL A;  4WU9 A;  4DRB A;  3C1B A;  4G91 B;  3AZH A;  3REJ A;  4XUJ A;  5C3I B;  3LJA A;  4UUZ B;  3MGQ D;  3MGR B;  1P3M A;  2BG1 A;  3REL A;  3KUY A;  3LEL A;  4ZUX A;  5DNN A;  5CP6 C;  4ZBJ B;  1TAF B;  1P34 C;  5AV9 C;  4NE3 A;  3A1I A;  3W98 D;  5DNM B;  3UTA C;  3AN2 B;  2RVQ D;  5BNX B;  2Y2K A;  3A6N A;  3AZN D;  1HQ3 D;  1P3B A;  4Z5T D;  4J8U C;  1P3K C;  1P3L D;  5B1L D;  5B0Y B;  4LD9 B;  1M19 A;  5AV8 A;  2Y2I A;  3AZJ D;  2PYO A;  1Z2C B;  3WTP A;  3EPH A;  3WA9 A;  3MGP B;  3AZK D;  5JRG B;  2IO5 B;  4Z2M H;  1S32 C;  3REK C;  4NE6 A;  2NQB D;  1N1J A;  3W97 C;  5CP6 D;  4J8V A;  5CPK A;  2F8N G;  3UT9 C;  5CPJ B;  3W96 A;  5GSU B;  2Y2M A;  3UTA D;  3X1V B;  2F8N D;  1KX5 C;  3H0L C;  4AWL C;  3LZ1 B;  5B32 B;  3AFA B;  3VH5 A;  4CSR B;  3AZL A;  2ARO B;  3VH5 W;  3AZG B;  3UTB D;  4JJN C;  5GT3 B;  4H9Q B;  5B31 C;  5AV5 B;  4J8X C;  3X1U A;  3AZE B;  3KWQ C;  1ID3 C;  4HGA B;  3AZF A;  1ZLA A;  4YM6 D;  5AV6 A;  3B6G C;  1P3P B;  1M18 D;  1M1A A;  3REI D;  5BO0 A;  5B2J D;  2CV5 A;  1P3A C;  2FJ7 D;  3AV2 D;  2HIO C;  3C1C C;  1P3I C;  1PZR A;  5E5A D;  4JJN D;  4ZUX B;  4KUD A;  4UUZ A;  4YS3 C;  5B31 D;  3AYW D;  2Y2P A;  4J8X D;  4XUJ D;  3LJA D;  4QLC D;  1TAF A;  1ID3 D;  1P3M D;  5GXQ C;  3VH6 A;  3KUY D;  1P3B B;  5DNM A;  2Y2G A;  1BH9 A;  3AN2 A;  3O62 C;  3VH6 W;  5B2I A;  3B6F A;  5AY8 B;  2RIQ A;  3TU4 A;  1EQZ B;  2YFV B;  3WTP B;  3AZI B;  4H9N B;  4X23 C;  5AVB B;  5B0Z C;  3A6N D;  3WA9 B;  5BS7 C;  5B24 C;  4H9O B;  4KGC C;  5AVC B;  3MGP A;  1U35 D;  3X1S C;  3AZM C;  5JRG A;  2PYO D;  4J8V B;  3KXB B;  1TZY A;  4WU8 C;  1AOI A;  4CAY A;  4J8W D;  1P3F C;  4XZQ B;  2ZY3 A;  5CPI A;  3AV1 A;  3AZL B;  3O62 D;  2BYM B;  5CPK D;  1P3O B;  5B32 A;  3AFA A;  1P3G C;  4CSR A;  1F66 D;  2Y2H A;  3MGQ C;  3KFU G;  3LZ0 D;  4X23 D;  3AZG A;  4Z66 C;  3EPK A;  3X1U B;  1P34 A;  3REH B;  4KGC D;  1KX4 C;  1ZLA B;  3W98 C;  5AV5 A;  2RVQ C;  5GT0 C;  3AZM D;  3AZE A;  5AV6 B;  3EG5 B;  2NZD C;  4J8U A;  3AZN C;  1P3K A;  4Z5T C;  4WU8 D;  1M1A B;  1P3F D;  5B1L C;  3W99 D;  4DRA A;  5BO0 B;  3WKJ B;  3AZK C;  3REK A;  5F99 D;  1P3G D;  4KUD B;  4LD9 C;  3W97 A;  2NQB C;  4Z66 D;  2DF4 C;  3UT9 A;  5B40 D;  1KX4 D;  1BH9 B;  5GT0 D;  5B2I B;  3B6F B;  5B1M A;  3MGR D;  4WNN A;  3MGS B;  2NZD D;  3TU4 B;  3V9R A;  4KHA B;  3UTB C;  2Y2O A;  5AY8 A;  3WAA B;  1EQZ A;  2YFV A;  3X1V C;  5GSU C;  3AZI A;  3X1T C;  3B0C T;  4H9N A;  5AVB A;  3KWQ A;  1HQ3 B;  2L5A A;  4H9O A;  5B0Y D;  4LD9 D;  1TZY B;  1KX3 B;  1AOI B;  4CAY B;  5AVC A;  4YM6 C;  2DQN C;  3AZJ B;  1BH8 A;  5CPI B;  3AV1 B;  3KXB A;  1M18 C;  3MGP D;  2F2A C;  4XZQ A;  3REI C;  5B2J C;  3C1C A;  2FJ7 C;  3AV2 C;  1P3I A;  3MVD A;  1W2E A;  4R8P C;  2BYM A;  5B33 C;  5CP6 B;  5E5A C;  4YS3 A;  3MNN C;  1P3O A;  1P34 B;  3AYW C;  5CPJ D;  2HUE C;  5GSU D;  5B32 G;  5AV9 B;  3X1T D;  2JE5 A;  3X1V D;  3C1B C;  3UTA B;  4WU9 C;  3LZ1 D;  3AZH C;  3REJ C;  5B32 D;  3AFA D;  4XUJ C;  3LJA C;  4QLC C;  3REH A;  5GXQ A;  2ARO D;  4WV4 B;  1P3M C;  4J8U B;  3REL C;  1P3K B;  3KUY C;  3AZG D;  3LEL C;  5GT3 D;  5DNN C;  2BYK B;  2FFF B;  2Y2Q A;  2G5H C;  1R4V A;  5AV5 D;  5B0Z A;  2ZY4 A;  1KU5 A;  2F8N H;  1S32 B;  3A6N C;  5B24 A;  3REK B;  4H9S A;  4R8P D;  2JCH A;  3X1S A;  1M19 C;  2XD1 A;  5B33 D;  5AV8 C;  1P3P D;  3W97 B;  3MNN D;  3H0R C;  1U35 C;  3F6T A;  2PYO C;  3WKJ A;  3UT9 B;  5BT1 D;  4WU9 D;  3C1B D;  3AL0 C;  4J8W C;  3AZH D;  1KX5 B;  3REJ D;  4AWL B;  5B1M B;  4WNN B;  3REL D;  3LEL D;  4ZUX D;  5DNN D;  4JJN B;  3V9R B;  5CPK C;  3MGQ A;  5B31 B;  3MGS A;  1F66 C;  3W96 C;  3LZ0 C;  4KHA A;  3KWQ B;  1ID3 B;  1P3B D;  3WAA A;  3VH5 T;  3W98 A;  1M19 D;  5AV8 D;  3B6G B;  2ZY5 A;  5AY8 D;  2G5I C;  3WTP D;  1HQ3 A;  3AZI D;  4Z5T A;  1BH8 B;  3AZN A;  1P3L A;  5AVB D;  1KX3 A;  4G92 C;  3WA9 D;  1P3A B;  3W99 C;  3AZJ A;  2HIO B;  4EO5 C;  3C1C B;  3AZF C;  1P3I B;  4WJ3 C;  1B6W A;  3MVD B;  5AVC D;  3B0B A;  4J8V D;  3AZK A;  4YS3 B;  2Y2N A;  3B0D C;  5F99 C;  4XZQ D;  2NQB A;  3W96 D;  2CV5 C;  5CP6 A;  2XD5 A;  3NQU A;  5B40 C;  5GXQ B;  5AV9 A;  3AZL D;  3UTA A;  2F8N A;  3O62 B;  4G91 C;  5C3I C;  3MGR C;  5B0Z B;  3X1U D;  2BYK A;  3UTB A;  4ZBJ C;  1A7W A;  3A1K A;  3AZF D;  1ZLA D;  5B24 B;  4KGC B;  5DNM C;  3AN2 C;  3NQJ B;  2CWE A;  5AV6 D;  3X1S B;  3AZM B;  1S32 A;  5G49 B;  1M1A D;  5JA4 B;  1JFI A;  5B0Y C;  2CV5 D;  1M18 A;  3REI A;  2UWX A;  3MGP C;  1KX5 A;  5JRG C;  5B2J A;  2IO5 C;  2FJ7 A;  3AV2 A;  4KUD D;  3MGQ B;  1HTA A;  4M6B A;  5E5A A;  4Z66 B;  4JJN A;  1WWS A;  3AYW A;  5B31 A;  4NFT A;  5CPJ C;  5DNM D;  3AN2 D;  1KX4 B;  3W98 B;  4J8X A;  5B2I D;  3B6F D;  5GT0 B;  4QLC A;  3LZ1 C;  5B32 C;  3AFA C;  3MGS D;  1ID3 A;  3TU4 D;  2NZD B;  3AZN B;  4Z5T B;  2ARO C;  1P3L B;  1H3O A;  3AZG C;  5B1L B;  4H9R B;  5GT3 C;  3B6G A;  3WAA D;  3EPJ A;  5AV5 C;  5JRG D;  1P3A A;  3AZE C;  3AZK B;  2Y2J A;  2HIO A;  4HGA C;  1TZY D;  2Y2L A;  1KX3 D;  1AOI D;  2W8S A;  2NQB B;  1U35 A;  5KDM A;  5CPI D;  3AV1 D;  2YFW A;  1P3P C;  3NQU B;  5FUG B;  5BT1 C;  5BNV A;  4J8W A;  1F1E A;  1B67 A;  2F8N B;  2LY8 A;  3O62 A;  4ZUX C;  3UTB B;  1P34 D;  3FDD A;  5AV9 D;  1F66 A;  3X1T B;  3LZ0 A;  4X23 A;  4H9P B;  3AZE D;  2ZY2 A;  5B1M C;  5BS7 A;  4J8U D;  1P3K D;  1P3B C;  4KGC A;  3NQJ A;  5CHL B;  1JFI B;  4YM6 B;  3AZM A;  3R45 B;  2JSS A;  5AY8 C;  5G49 A;  1EQZ C;  3WTP C;  5JA4 A;  3AZI C;  4WU8 A;  1M18 B;  1ULY A;  1P3F A;  3REI B;  5AVB C;  1S32 D;  3W99 A;  1WWI A;  3WA9 C;  3REK D;  5B2J B;  2FJ7 B;  3AV2 B;  4WZS B;  4R8P B;  3W97 D;  5AVC C;  4E44 A;  5B33 B;  5E5A B;  1BFM A;  3MNN B;  4J8V C;  3UT9 D;  5F99 A;  1P3G A;  3WTP E;  3KXB C;  3AYW B;  2HUE B;  4WU9 B;  3C1B B;  1KX5 D;  4XZQ C;  3AZH B;  4Z66 A;  3REJ B;  4J8X B;  4XUJ B;  3LJA B;  2ZM5 A;  4QLC B;  5B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...