3KXBA

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
RPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 32
structure length 92
sequence length 92
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbA00
3AZHD 3AZNC 3X1UD 5KDMA 4CSRA 4R8PC 4Z2MG 3MGRD 5B2IC 3REKD 3AZKA 5B32D 4HGAB 1TZYA 1P3LA 4NFTA 3NQJB 4QLCB 1TZYC 3MGSB 4YS3A 3X1VD 5DNNA 2F8NA 1S32B 4J8WD 4WU9C 3AZHB 1P3OD 2PYOA 1U35A 1JFIB 1TAFB 4ZUXC 1U35C 2AROC 3REKB 5B32B 3WTPA 5B32G 5AV8D 1R4VA 4KUDD 2FJ7A 3AZJB 4J8UA 1P3AA 2NZDD 4Z5TC 2FJ7C 2BYKB 4J8UC 1P3OB 5GT0D 3REJA 5GXQD 1P3AC 1KX5D 5F99A 3MGQD 4XUJD 5AV8B 5BO0B 3AV2D 4HGAC 4KUDB 1ZLAA 3MGPC 5B1LA 4QLCC 2NZDB 3KXBD 4JJND 2YFWB 1S32C 3B0CT 5B1LC 5E5AA 5GT0B 4G91B 5GXQB 4WU8B 3AZHC 1M19A 3W96B 1KX5B 3C1BB 3X1UC 5E5AC 1M19C 3A6NA 2L5AA 3KUYD 5AY8D 1EQZB 1ID3D 1B6WA 3MGRC 1WWSA 5CHLB 3REKC 4XZQA 1P3FB 3AV1A 3KWQA 3B6GD 1KX4D 3KXBB 3AV1C 3X1VC 4J8WC 1M18A 4J8VD 5B24D 5AV6D 1P3MA 3AZLB 4J8XD 3V9RA 5AY8B 4LD9A 1ID3B 3VH5W 4LD9C 5B1MA 3REHA 3B6GB 5JRGD 4ZBJC 1KX4B 5CPIB 1P3BD 4WNNA 5AVCD 4Z66D 1P3ID 2NZDC 5AV6B 3UT9D 5CPJD 4WV4B 5B33D 4G91C 5GXQC 4X23A 1KX5C 3AYWB 3AZFD 4KGCA 4KHAA 3MGQA 4XUJA 3WA9A 4KGCC 3MGQC 4XUJC 4EO5B 4G92B 3AV2C 4NE5A 5JRGB 5B0ZD 5B0YD 1P3KD 1M1AA 3B0BA 5CPKA 5AVCB 3TU4A 1P3IB 3KXBC 4JJNC 5FUGB 5CPJB 5CPKC 5B33B 3C1CD 4UUZB 3VH5A 3KUYA 3AZMA 5BNVB 5AV5D 3WKJB 1BH9B 3NQUB 5G49B 5AY8C 3MVDB 3KUYC 1ID3C 1P34A 3AZMC 1P3PD 1KX3B 5DNMB 5GSUB 1P34C 3X1TB 1N1JB 5B0ZB 5B0YB 1P3KB 3B6GC 1KX4C 3LZ1B 5B31D 5B24A 4J8VA 3REID 3W97A 4J8XA 4J8VC 5B24C 5AV6C 3C1CB 5AV5B 4J8XC 2YFVA 1A7WA 4YM6D 5AVBA 3AZGB 1P3GD 1P3PB 3AFAA 4H9OB 4EO5C 4G92C 3AN2D 3LJAA 3UTBA 5B31G 1P3BC 3MGSD 5AVCC 4Z66C 5CP6A 1ULYA 3UTBC 3UT9C 3AZKB 3AZNA 4Z2MH 5B33C 3AZFA 4H9RB 5CP6C 4H9NA 4YM6B 4R8PA 3AZFC 5B2IA 1AOIA 2HUEC 3AZID 1P3GB 5DNNB 2F8NB 1AOIC 5GT3D 5B40B 3B0DB 4CAYA 5B0ZC 3AN2B 5B0YC 1P3KC 5BT1D 4WU9A 3AZJD 3X1SB 3C1CC 4ZUXA 3MNND 4AWLB 2AROA 3AZIB 5B2JA 4DRBA 1BFMA 1HTAA 5GT3B 5JA4A 5B2JC 3UTAB 1BH8A 5B31A 3REJB 3VH5T 4Z5TA 5B31C 3REIC 1F66B 5F99B 2CV5D 3LELD 4WU8D 3MNNB 3LZ0D 3W96D 3R45B 2NQBB 3C1BD 4YM6C 1ZLAB 1EQZD 1P3GC 2JSSA 1P3FD 3MGPA 3NQJA 4QLCA 3A6NB 1S32A 3MGSC 3AZHA 2CV5B 3X1UA 3LELB 3AZLD 3LZ0B 1JFIA 1TAFA 3AZED 3W99D 3MGRA 3RELD 1H3OA 3AZIC 3REKA 4DRAA 5B32A 2HIOD 1M18B 1P3MB 1F1EA 5B32C 2BYMA 3X1VA 4J8WA 5BT1C 2BYKA 3AZJC 5CPID 1P3OA 3VH6A 1P3OC 3MNNC 3AZEB 3W99B 3RELB 3AYWD 2CWEA 2HIOB 4WNNB 5AV8A 5BO0A 4KUDA 5AV8C 3O62D 2RVQD 2NZDA 2YFWA 4KUDC 5GT0A 5GXQA 1KX5A 2CV5C 3LELC 5GT0C 4WU8C 4NE3A 3LZ0C 3W96C 3C1BC 3WKJD 3MVDD 5AV9D 1EQZC 3AV2A 1KX3D 5BS7C 5DNMD 1P3FC 5GSUD 3X1TD 3O62B 3KXBA 4JJNA 3LZ1D 3AZLA 1B67A 1HQ3D 1Q9CA 3B6FD 5AY8A 3AZLC 1ID3A 3AZEC 4H9PB 3RELC 5AV9B 3AZGD 3W97B 2IO5B 3WAAD 3B6GA 1KX4A 5CPIA 5AVBB 4H9QB 5AV6A 5BNXA 3W98B 5CPIC 1HQ3B 3AFAB 3B6FB 4H9SA 3AYWA 3AZKD 4E45A 1P3LD 4H9SC 3LJAB 3AYWC 4YS3D 3WAAB 5DNND 2F8ND 5JRGA 3AZNB 5B40D 2F8NK 3O62C 3VH6T 1P3BA 5AVCA 4Z66A 2RVQC 5JRGC 1P3IA 5KDMB 2PYOD 5B2IB 3WTPE 3UT9A 5CPJA 1U35D 4CSRB 5B33A 1P3IC 5BNVA 5CPJC 1BH9A 3X1SD 3NQUA 5G49A 4E44A 3WTPD 2F8NH 1TZYB 1P3LB 3WKJC 5DNMA 3MVDC 5AV9C 4WU9B 4YS3B 4J8UD 1N1JA 1KX3C 1P3AD 5DNMC 5B0ZA 5B0YA 2F8NG 1P3KA 5GSUC 3UTAD 3X1TC 4ZUXB 3REJD 2PYOB 1U35B 3LZ1C 3C1CA 1F66D 5AV5A 1HQ3C 5JA4B 5F99D 3WTPB 3AZGA 5AV5C 1P3PA 2NQBD 4Z5TB 2FJ7B 1ZLAD 3AZGC 4J8UB 1P3PC 1P3AB 3WAAC 5E5AD 1M19D 3REIA 3A6ND 4H9RA 4YM6A 3AZKC 4XZQD 3MGPB 1P3GA 4NE6A 1P3LC 3AV1D 3KWQD 5B1LB 4YS3C 5B40A 5DNNC 3VH6W 3AN2A 1M18D 3X1UB 5E5AB 1M19B 1P3MD 5B40C 3MGSA 3B0DC 3AN2C 2PYOC 3MGRB 1H3OB 4LD9D 3X1SA 5B1MD 4XZQB 3X1SC 3REHD 3WTPC 3AZIA 2BYMB 3AV1B 3X1VB 3KWQB 4AWLC 4J8WB 5GT3A 3UTAA 5GT3C 3UTAC 3REJC 1F66A 1KU5A 3AZJA 3V9RB 4X23D 4LD9B 4KGCD 1F66C 3MNNA 3WA9D 5B1MB 2NQBA 5F99C 3R45A 3REHB 4ZBJB 2NQBC 1M1AD 1ZLAC 5CPKD 3TU4D 4X23B 3AZMD 4KGCB 3A6NC 4KHAB 3MGQB 4XUJB 2CV5A 3LELA 4WU8A 1P34D 3AV2B 3WA9B 3LZ0A 3W96A 3C1BA 4XZQC 1EQZA 4JJNB 3KWQC 5C3IB 5BS7A 1M1AB 5CPKB 1P3FA 3TU4B 3W97D 1M18C 1P3MC 3KUYB 1WWIA 3AZMB 5AVBD 1P34B 3W98D 3AZEA 5B1MC 3W99A 3AFAD 3REHC 3RELA 2HIOA 3W99C 4J8VB 5B24B 3LJAD 5BNXB 3UTBD 2HIOC 4J8XB 5CP6D 3AZND 2YFVB 4X23C 4R8PD 2LY8A 5B2ID 1AOID 3WA9C 1P3BB 3B0CW 1TZYD 4Z66B 1M1AC 5C3IC 3UTBB 3UT9B 4WU9D 3TU4C 3O62A 5CP6B 3AZFB 4WZSB 2HUEB 4ZUXD 4H9NB 4R8PB 1AOIB 5FUGA 2AROD 5B2JD 4UUZA 3WKJA 4H9PA 3MVDA 5AV9A 4CAYB 1KX3A 3KSYA 4Z5TD 2FJ7D 5GSUA 3X1TA 3W97C 2IO5C 3LZ1A 4H9QA 3W98A 1HQ3A 2AROB 5AVBC 5B2JB 3B6FA 3W98C 4M6BA 3AFAC 1BH8B 3B6FC 5B31B 3REIB 3MGPD 4QLCD 3WAAA 3LJAC 1S32D 5B1LD 4H9OA
chains in the Genus database with same CATH superfamily
3AZHD 3AZNC 3X1UD 5KDMA 4CSRA 4R8PC 4Z2MG 3MGRD 5B2IC 3REKD 3AZKA 5B32D 4HGAB 1TZYA 1P3LA 4NFTA 3NQJB 4QLCB 1TZYC 3MGSB 4YS3A 3X1VD 5DNNA 2F8NA 3A1IA 1S32B 4J8WD 4WU9C 2ZY2A 3AZHB 1P3OD 2PYOA 1U35A 3H0LC 1TAFB 4ZUXC 1JFIB 3EPKA 1U35C 2AROC 3REKB 5B32B 3WTPA 5B32G 5AV8D 1R4VA 4KUDD 2FJ7A 3AZJB 4J8UA 1P3AA 2NZDD 4Z5TC 2FJ7C 2BYKB 4J8UC 1P3OB 5GT0D 3REJA 5GXQD 1P3AC 1KX5D 5F99A 3MGQD 4XUJD 5AV8B 5BO0B 3AV2D 4HGAC 2DF4C 4KUDB 1ZLAA 3MGPC 5B1LA 4QLCC 2NZDB 3KXBD 4JJND 2YFWB 1S32C 3B0CT 5B1LC 5E5AA 5GT0B 4G91B 5GXQB 4WU8B 3AZHC 1M19A 3W96B 1KX5B 3C1BB 3X1UC 5E5AC 1M19C 3A6NA 2L5AA 3KUYD 5AY8D 1EQZB 1ID3D 1B6WA 2G5IC 3MGRC 1WWSA 5CHLB 3REKC 4XZQA 1P3FB 3AV1A 3KWQA 3B6GD 1KX4D 3KXBB 3AV1C 3X1VC 2Y2KA 4J8WC 1M18A 4J8VD 5B24D 5AV6D 4DQYB 1P3MA 3AZLB 4J8XD 3V9RA 5AY8B 4LD9A 1ID3B 3VH5W 4LD9C 5B1MA 3REHA 2JCHA 3B6GB 5JRGD 4ZBJC 1KX4B 5CPIB 1P3BD 4WNNA 5AVCD 4Z66D 1P3ID 2NZDC 5AV6B 3UT9D 5CPJD 4WV4B 5B33D 4G91C 5GXQC 4X23A 1KX5C 3AYWB 3AZFD 4KGCA 4KHAA 3MGQA 1PZRA 4XUJA 3WA9A 4KGCC 3MGQC 4XUJC 4EO5B 4G92B 3AV2C 4NE5A 5JRGB 5B0ZD 5B0YD 1P3KD 1M1AA 3B0BA 5CPKA 5AVCB 3TU4A 1P3IB 3KXBC 4JJNC 5FUGB 5CPJB 5CPKC 5B33B 3C1CD 4UUZB 3VH5A 3KUYA 2ZY3A 3AZMA 5BNVB 5AV5D 3WKJB 1BH9B 3NQUB 5G49B 5AY8C 3MVDB 3KUYC 1ID3C 1P34A 3AZMC 1P3PD 1KX3B 5DNMB 5GSUB 1P34C 3X1TB 1N1JB 5B0ZB 5B0YB 1P3KB 3B6GC 1KX4C 3LZ1B 5B31D 5B24A 4J8VA 3REID 2DQNC 3W97A 4J8XA 4WJ3C 4J8VC 5B24C 5AV6C 3C1CB 2Y2GA 5AV5B 4J8XC 2YFVA 1A7WA 4YM6D 5AVBA 3AZGB 1P3GD 1P3PB 3AFAA 3F6TA 4H9OB 4EO5C 4G92C 3AN2D 3LJAA 3UTBA 5B31G 1P3BC 3MGSD 5AVCC 4Z66C 5CP6A 1ULYA 3A1KA 3UTBC 3UT9C 3AZKB 4Z2MH 5B33C 3AZNA 3AZFA 4H9RB 5CP6C 4H9NA 4YM6B 4R8PA 3AZFC 5B2IA 1AOIA 2HUEC 3AZID 1P3GB 5DNNB 2F8NB 2Y2MA 1AOIC 5GT3D 5B40B 3B0DB 4CAYA 5B0ZC 3AN2B 5B0YC 1P3KC 5BT1D 4WU9A 3AZJD 3X1SB 3C1CC 4ZUXA 3MNND 4AWLB 2AROA 3AZIB 5B2JA 4DRBA 1BFMA 1HTAA 5GT3B 5JA4A 5B2JC 2XD5A 3UTAB 1BH8A 5B31A 3REJB 3VH5T 4Z5TA 5B31C 3REIC 1F66B 5F99B 2CV5D 3LELD 4WU8D 3MNNB 3LZ0D 3W96D 3R45B 2NQBB 3C1BD 4YM6C 1ZLAB 1EQZD 1P3GC 2F2AC 2JSSA 1P3FD 3MGPA 3NQJA 2BG1A 4QLCA 3A6NB 1S32A 3MGSC 3AZHA 2CV5B 3X1UA 3EG5B 3LELB 3AZLD 3LZ0B 1JFIA 1TAFA 3AZED 3W99D 3MGRA 3RELD 1H3OA 3KFUG 3AZIC 3REKA 4DRAA 5B32A 2HIOD 1M18B 1P3MB 1F1EA 5B32C 2BYMA 3X1VA 4J8WA 5BT1C 2BYKA 3AZJC 5CPID 1P3OA 2Y2PA 3VH6A 1P3OC 3MNNC 3AZEB 3W99B 3RELB 3AYWD 2CWEA 2HIOB 4WNNB 5AV8A 5BO0A 4KUDA 5AV8C 3O62D 2RVQD 2NZDA 2YFWA 4KUDC 5GT0A 5GXQA 1KX5A 2CV5C 3LELC 5GT0C 4WU8C 2Y2LA 4NE3A 2XD1A 3W96C 3LZ0C 3C1BC 3WKJD 2UWXA 1Z2CB 3MVDD 5AV9D 1EQZC 3AV2A 1KX3D 5BS7C 5DNMD 1P3FC 5GSUD 3X1TD 3O62B 3KXBA 4JJNA 3LZ1D 3P5JB 2J8PA 3AZLA 1B67A 1HQ3D 1Q9CA 3B6FD 5AY8A 3AZLC 1ID3A 3AZEC 4H9PB 3RELC 5AV9B 3AZGD 3W97B 2IO5B 3WAAD 3B6GA 1KX4A 5CPIA 5AVBB 4H9QB 5AV6A 5BNXA 3W98B 5CPIC 2ZY4A 1HQ3B 3AFAB 3B6FB 4H9SA 3AYWA 3AZKD 4E45A 1P3LD 4H9SC 3LJAB 3AYWC 4YS3D 3WAAB 5DNND 2F8ND 5JRGA 3AZNB 5B40D 2F8NK 3O62C 3VH6T 1P3BA 5AVCA 5JRGC 2RVQC 4Z66A 1P3IA 5KDMB 2PYOD 5B2IB 3WTPE 3UT9A 5CPJA 1U35D 5B33A 4CSRB 1P3IC 5BNVA 5CPJC 1BH9A 3X1SD 3NQUA 5G49A 4E44A 3WTPD 2F8NH 1TZYB 1P3LB 3WKJC 5DNMA 3MVDC 5AV9C 4WU9B 4YS3B 4J8UD 1N1JA 1KX3C 1P3AD 5DNMC 5B0ZA 5B0YA 2F8NG 1P3KA 5GSUC 3UTAD 3X1TC 4ZUXB 3REJD 2PYOB 1U35B 3LZ1C 3C1CA 1F66D 5AV5A 1HQ3C 5JA4B 5F99D 3WTPB 3AZGA 5AV5C 1P3PA 2NQBD 4Z5TB 2FJ7B 1ZLAD 3AZGC 4J8UB 1P3PC 1P3AB 3WAAC 2JE5A 5E5AD 1M19D 3REIA 3A6ND 2Y2OA 4H9RA 2Y2IA 4YM6A 4XZQD 3AZKC 3MGPB 1P3GA 4NE6A 1P3LC 3AV1D 3KWQD 5B1LB 4YS3C 5B40A 1T3UA 5DNNC 3VH6W 3AN2A 1M18D 3X1UB 5E5AB 1M19B 1P3MD 5B40C 3MGSA 3B0DC 3AN2C 2PYOC 3MGRB 1H3OB 4LD9D 3X1SA 3H0MC 5B1MD 2Y2JA 4XZQB 3X1SC 3REHD 3WTPC 3AZIA 2BYMB 3AV1B 3X1VB 3KWQB 3AL0C 4AWLC 4J8WB 5GT3A 3UTAA 5GT3C 3UTAC 3REJC 1F66A 1KU5A 3AZJA 3V9RB 3EPLA 4X23D 4LD9B 4KGCD 2RIQA 1F66C 3MNNA 3WA9D 5B1MB 2NQBA 5F99C 3R45A 3REHB 4ZBJB 2NQBC 1M1AD 1ZLAC 5CPKD 3TU4D 4X23B 3AZMD 4KGCB 3A6NC 4KHAB 3MGQB 4XUJB 2CV5A 3LELA 4WU8A 1P34D 3AV2B 3WA9B 3LZ0A 3W96A 1W2EA 2G5HC 3C1BA 4XZQC 1EQZA 4JJNB 3KWQC 5C3IB 5BS7A 1M1AB 5CPKB 1P3FA 3TU4B 2Y2HA 3EPJA 3H0RC 3W97D 1M18C 1P3MC 3KUYB 1WWIA 3AZMB 2VQRA 5AVBD 1P34B 3W98D 3AZEA 5B1MC 3W99A 3AFAD 3REHC 3RELA 2HIOA 3W99C 4UPKA 3IP4C 5B24B 3LJAD 5BNXB 4J8VB 3UTBD 2HIOC 2Y2NA 4J8XB 5CP6D 3AZND 2Y2QA 2YFVB 4X23C 4R8PD 2LY8A 5B2ID 1AOID 3WA9C 1P3BB 3B0CW 1TZYD 4Z66B 1M1AC 5C3IC 3UTBB 3UT9B 4WU9D 3TU4C 3O62A 5CP6B 3AZFB 4WZSB 2HUEB 4ZUXD 4H9NB 4R8PB 3FDDA 1AOIB 5FUGA 2AROD 5B2JD 4UUZA 3WKJA 4H9PA 3MVDA 5AV9A 4CAYB 1KX3A 3KSYA 4Z5TD 2FJ7D 5GSUA 3X1TA 2FFFB 3W97C 2IO5C 3LZ1A 4H9QA 3W98A 1HQ3A 2AROB 5AVBC 5B2JB 3EPHA 3B6FA 3W98C 2W8SA 4M6BA 3AFAC 1BH8B 3B6FC 5B31B 3REIB 2ZY5A 3MGPD 4QLCD 3WAAA 3LJAC 1S32D 2ZM5A 5B1LD 4H9OA
chains in the Genus database with same CATH topology
3AZHD 3AZNC 3X1UD 5KDMA 4CSRA 4R8PC 4Z2MG 3MGRD 5B2IC 3REKD 3AZKA 5B32D 4HGAB 1TZYA 1P3LA 4NFTA 3NQJB 4QLCB 1TZYC 3MGSB 4YS3A 3X1VD 5DNNA 2F8NA 3A1IA 1S32B 4J8WD 4WU9C 2ZY2A 3AZHB 1P3OD 2PYOA 1U35A 3H0LC 1TAFB 4ZUXC 1JFIB 3EPKA 1U35C 2AROC 3REKB 5B32B 3WTPA 5B32G 5AV8D 1R4VA 4KUDD 2FJ7A 3AZJB 4J8UA 1P3AA 2NZDD 4Z5TC 2FJ7C 2BYKB 4J8UC 1P3OB 5GT0D 3REJA 5GXQD 1P3AC 1KX5D 5F99A 3MGQD 4XUJD 5AV8B 5BO0B 3AV2D 4HGAC 2DF4C 4KUDB 1ZLAA 3MGPC 5B1LA 4QLCC 2NZDB 3KXBD 4JJND 2YFWB 1S32C 3B0CT 5B1LC 5E5AA 5GT0B 4G91B 5GXQB 4WU8B 3AZHC 1M19A 3W96B 1KX5B 3C1BB 3X1UC 5E5AC 1M19C 3A6NA 2L5AA 3KUYD 5AY8D 1EQZB 1ID3D 1B6WA 2G5IC 3MGRC 1WWSA 5CHLB 3REKC 4XZQA 1P3FB 3AV1A 3KWQA 3B6GD 1KX4D 3KXBB 3AV1C 3X1VC 2Y2KA 4J8WC 1M18A 4J8VD 5B24D 5AV6D 4DQYB 1P3MA 3AZLB 4J8XD 3V9RA 5AY8B 4LD9A 1ID3B 3VH5W 4LD9C 5B1MA 3REHA 2JCHA 3B6GB 5JRGD 4ZBJC 1KX4B 5CPIB 1P3BD 4WNNA 5AVCD 4Z66D 1P3ID 2NZDC 5AV6B 3UT9D 5CPJD 4WV4B 5B33D 4G91C 5GXQC 4X23A 1KX5C 3AYWB 3AZFD 4KGCA 4KHAA 3MGQA 1PZRA 4XUJA 3WA9A 4KGCC 3MGQC 4XUJC 4EO5B 4G92B 3AV2C 4NE5A 5JRGB 5B0ZD 5B0YD 1P3KD 1M1AA 3B0BA 5CPKA 5AVCB 3TU4A 1P3IB 3KXBC 4JJNC 5FUGB 5CPJB 5CPKC 5B33B 3C1CD 4UUZB 3VH5A 3KUYA 2ZY3A 3AZMA 5BNVB 5AV5D 3WKJB 1BH9B 3NQUB 5G49B 5AY8C 3MVDB 3KUYC 1ID3C 1P34A 3AZMC 1P3PD 1KX3B 5DNMB 5GSUB 1P34C 3X1TB 1N1JB 5B0ZB 5B0YB 1P3KB 3B6GC 1KX4C 3LZ1B 5B31D 5B24A 4J8VA 3REID 2DQNC 3W97A 4J8XA 4WJ3C 4J8VC 5B24C 5AV6C 3C1CB 2Y2GA 5AV5B 4J8XC 2YFVA 1A7WA 4YM6D 5AVBA 3AZGB 1P3GD 1P3PB 3AFAA 3F6TA 4H9OB 4EO5C 4G92C 3AN2D 3LJAA 3UTBA 5B31G 1P3BC 3MGSD 5AVCC 4Z66C 5CP6A 1ULYA 3A1KA 3UTBC 3UT9C 3AZKB 4Z2MH 5B33C 3AZNA 3AZFA 4H9RB 5CP6C 4H9NA 4YM6B 4R8PA 3AZFC 5B2IA 1AOIA 2HUEC 3AZID 1P3GB 5DNNB 2F8NB 2Y2MA 1AOIC 5GT3D 5B40B 3B0DB 4CAYA 5B0ZC 3AN2B 5B0YC 1P3KC 5BT1D 4WU9A 3AZJD 3X1SB 3C1CC 4ZUXA 3MNND 4AWLB 2AROA 3AZIB 5B2JA 4DRBA 1BFMA 1HTAA 5GT3B 5JA4A 5B2JC 2XD5A 3UTAB 1BH8A 5B31A 3REJB 3VH5T 4Z5TA 5B31C 3REIC 1F66B 5F99B 2CV5D 3LELD 4WU8D 3MNNB 3LZ0D 3W96D 3R45B 2NQBB 3C1BD 4YM6C 1ZLAB 1EQZD 1P3GC 2F2AC 2JSSA 1P3FD 3MGPA 3NQJA 2BG1A 4QLCA 3A6NB 1S32A 3MGSC 3AZHA 2CV5B 3X1UA 3EG5B 3LELB 3AZLD 3LZ0B 1JFIA 1TAFA 3AZED 3W99D 3MGRA 3RELD 1H3OA 3KFUG 3AZIC 3REKA 4DRAA 5B32A 2HIOD 1M18B 1P3MB 1F1EA 5B32C 2BYMA 3X1VA 4J8WA 5BT1C 2BYKA 3AZJC 5CPID 1P3OA 2Y2PA 3VH6A 1P3OC 3MNNC 3AZEB 3W99B 3RELB 3AYWD 2CWEA 2HIOB 4WNNB 5AV8A 5BO0A 4KUDA 5AV8C 3O62D 2RVQD 2NZDA 2YFWA 4KUDC 5GT0A 5GXQA 1KX5A 2CV5C 3LELC 5GT0C 4WU8C 2Y2LA 4NE3A 2XD1A 3W96C 3LZ0C 3C1BC 3WKJD 2UWXA 1Z2CB 3MVDD 5AV9D 1EQZC 3AV2A 1KX3D 5BS7C 5DNMD 1P3FC 5GSUD 3X1TD 3O62B 3KXBA 4JJNA 3LZ1D 3P5JB 2J8PA 3AZLA 1B67A 1HQ3D 1Q9CA 3B6FD 5AY8A 3AZLC 1ID3A 3AZEC 4H9PB 3RELC 5AV9B 3AZGD 3W97B 2IO5B 3WAAD 3B6GA 1KX4A 5CPIA 5AVBB 4H9QB 5AV6A 5BNXA 3W98B 5CPIC 2ZY4A 1HQ3B 3AFAB 3B6FB 4H9SA 3AYWA 3AZKD 4E45A 1P3LD 4H9SC 3LJAB 3AYWC 4YS3D 3WAAB 5DNND 2F8ND 5JRGA 3AZNB 5B40D 2F8NK 3O62C 3VH6T 1P3BA 5AVCA 5JRGC 2RVQC 4Z66A 1P3IA 5KDMB 2PYOD 5B2IB 3WTPE 3UT9A 5CPJA 1U35D 5B33A 4CSRB 1P3IC 5BNVA 5CPJC 1BH9A 3X1SD 3NQUA 5G49A 4E44A 3WTPD 2F8NH 1TZYB 1P3LB 3WKJC 5DNMA 3MVDC 5AV9C 4WU9B 4YS3B 4J8UD 1N1JA 1KX3C 1P3AD 5DNMC 5B0ZA 5B0YA 2F8NG 1P3KA 5GSUC 3UTAD 3X1TC 4ZUXB 3REJD 2PYOB 1U35B 3LZ1C 3C1CA 1F66D 5AV5A 1HQ3C 5JA4B 5F99D 3WTPB 3AZGA 5AV5C 1P3PA 2NQBD 4Z5TB 2FJ7B 1ZLAD 3AZGC 4J8UB 1P3PC 1P3AB 3WAAC 2JE5A 5E5AD 1M19D 3REIA 3A6ND 2Y2OA 4H9RA 2Y2IA 4YM6A 4XZQD 3AZKC 3MGPB 1P3GA 4NE6A 1P3LC 3AV1D 3KWQD 5B1LB 4YS3C 5B40A 1T3UA 5DNNC 3VH6W 3AN2A 1M18D 3X1UB 5E5AB 1M19B 1P3MD 5B40C 3MGSA 3B0DC 3AN2C 2PYOC 3MGRB 1H3OB 4LD9D 3X1SA 3H0MC 5B1MD 2Y2JA 4XZQB 3X1SC 3REHD 3WTPC 3AZIA 2BYMB 3AV1B 3X1VB 3KWQB 3AL0C 4AWLC 4J8WB 5GT3A 3UTAA 5GT3C 3UTAC 3REJC 1F66A 1KU5A 3AZJA 3V9RB 3EPLA 4X23D 4LD9B 4KGCD 2RIQA 1F66C 3MNNA 3WA9D 5B1MB 2NQBA 5F99C 3R45A 3REHB 4ZBJB 2NQBC 1M1AD 1ZLAC 5CPKD 3TU4D 4X23B 3AZMD 4KGCB 3A6NC 4KHAB 3MGQB 4XUJB 2CV5A 3LELA 4WU8A 1P34D 3AV2B 3WA9B 3LZ0A 3W96A 1W2EA 2G5HC 3C1BA 4XZQC 1EQZA 4JJNB 3KWQC 5C3IB 5BS7A 1M1AB 5CPKB 1P3FA 3TU4B 2Y2HA 3EPJA 3H0RC 3W97D 1M18C 1P3MC 3KUYB 1WWIA 3AZMB 2VQRA 5AVBD 1P34B 3W98D 3AZEA 5B1MC 3W99A 3AFAD 3REHC 3RELA 2HIOA 3W99C 4UPKA 3IP4C 5B24B 3LJAD 5BNXB 4J8VB 3UTBD 2HIOC 2Y2NA 4J8XB 5CP6D 3AZND 2Y2QA 2YFVB 4X23C 4R8PD 2LY8A 5B2ID 1AOID 3WA9C 1P3BB 3B0CW 1TZYD 4Z66B 1M1AC 5C3IC 3UTBB 3UT9B 4WU9D 3TU4C 3O62A 5CP6B 3AZFB 4WZSB 2HUEB 4ZUXD 4H9NB 4R8PB 3FDDA 1AOIB 5FUGA 2AROD 5B2JD 4UUZA 3WKJA 4H9PA 3MVDA 5AV9A 4CAYB 1KX3A 3KSYA 4Z5TD 2FJ7D 5GSUA 3X1TA 2FFFB 3W97C 2IO5C 3LZ1A 4H9QA 3W98A 1HQ3A 2AROB 5AVBC 5B2JB 3EPHA 3B6FA 3W98C 2W8SA 4M6BA 3AFAC 1BH8B 3B6FC 5B31B 3REIB 2ZY5A 3MGPD 4QLCD 3WAAA 3LJAC 1S32D 2ZM5A 5B1LD 4H9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZH D;  3AZN C;  3X1U D;  5KDM A;  4CSR A;  4R8P C;  4Z2M G;  3MGR D;  5B2I C;  3REK D;  3AZK A;  5B32 D;  4HGA B;  1TZY A;  1P3L A;  4NFT A;  3NQJ B;  4QLC B;  1TZY C;  3MGS B;  4YS3 A;  3X1V D;  5DNN A;  2F8N A;  1S32 B;  4J8W D;  4WU9 C;  3AZH B;  1P3O D;  2PYO A;  1U35 A;  1JFI B;  1TAF B;  4ZUX C;  1U35 C;  2ARO C;  3REK B;  5B32 B;  3WTP A;  5B32 G;  5AV8 D;  1R4V A;  4KUD D;  2FJ7 A;  3AZJ B;  4J8U A;  1P3A A;  2NZD D;  4Z5T C;  2FJ7 C;  2BYK B;  4J8U C;  1P3O B;  5GT0 D;  3REJ A;  5GXQ D;  1P3A C;  1KX5 D;  5F99 A;  3MGQ D;  4XUJ D;  5AV8 B;  5BO0 B;  3AV2 D;  4HGA C;  4KUD B;  1ZLA A;  3MGP C;  5B1L A;  4QLC C;  2NZD B;  3KXB D;  4JJN D;  2YFW B;  1S32 C;  3B0C T;  5B1L C;  5E5A A;  5GT0 B;  4G91 B;  5GXQ B;  4WU8 B;  3AZH C;  1M19 A;  3W96 B;  1KX5 B;  3C1B B;  3X1U C;  5E5A C;  1M19 C;  3A6N A;  2L5A A;  3KUY D;  5AY8 D;  1EQZ B;  1ID3 D;  1B6W A;  3MGR C;  1WWS A;  5CHL B;  3REK C;  4XZQ A;  1P3F B;  3AV1 A;  3KWQ A;  3B6G D;  1KX4 D;  3KXB B;  3AV1 C;  3X1V C;  4J8W C;  1M18 A;  4J8V D;  5B24 D;  5AV6 D;  1P3M A;  3AZL B;  4J8X D;  3V9R A;  5AY8 B;  4LD9 A;  1ID3 B;  3VH5 W;  4LD9 C;  5B1M A;  3REH A;  3B6G B;  5JRG D;  4ZBJ C;  1KX4 B;  5CPI B;  1P3B D;  4WNN A;  5AVC D;  4Z66 D;  1P3I D;  2NZD C;  5AV6 B;  3UT9 D;  5CPJ D;  4WV4 B;  5B33 D;  4G91 C;  5GXQ C;  4X23 A;  1KX5 C;  3AYW B;  3AZF D;  4KGC A;  4KHA A;  3MGQ A;  4XUJ A;  3WA9 A;  4KGC C;  3MGQ C;  4XUJ C;  4EO5 B;  4G92 B;  3AV2 C;  4NE5 A;  5JRG B;  5B0Z D;  5B0Y D;  1P3K D;  1M1A A;  3B0B A;  5CPK A;  5AVC B;  3TU4 A;  1P3I B;  3KXB C;  4JJN C;  5FUG B;  5CPJ B;  5CPK C;  5B33 B;  3C1C D;  4UUZ B;  3VH5 A;  3KUY A;  3AZM A;  5BNV B;  5AV5 D;  3WKJ B;  1BH9 B;  3NQU B;  5G49 B;  5AY8 C;  3MVD B;  3KUY C;  1ID3 C;  1P34 A;  3AZM C;  1P3P D;  1KX3 B;  5DNM B;  5GSU B;  1P34 C;  3X1T B;  1N1J B;  5B0Z B;  5B0Y B;  1P3K B;  3B6G C;  1KX4 C;  3LZ1 B;  5B31 D;  5B24 A;  4J8V A;  3REI D;  3W97 A;  4J8X A;  4J8V C;  5B24 C;  5AV6 C;  3C1C B;  5AV5 B;  4J8X C;  2YFV A;  1A7W A;  4YM6 D;  5AVB A;  3AZG B;  1P3G D;  1P3P B;  3AFA A;  4H9O B;  4EO5 C;  4G92 C;  3AN2 D;  3LJA A;  3UTB A;  5B31 G;  1P3B C;  3MGS D;  5AVC C;  4Z66 C;  5CP6 A;  1ULY A;  3UTB C;  3UT9 C;  3AZK B;  3AZN A;  4Z2M H;  5B33 C;  3AZF A;  4H9R B;  5CP6 C;  4H9N A;  4YM6 B;  4R8P A;  3AZF C;  5B2I A;  1AOI A;  2HUE C;  3AZI D;  1P3G B;  5DNN B;  2F8N B;  1AOI C;  5GT3 D;  5B40 B;  3B0D B;  4CAY A;  5B0Z C;  3AN2 B;  5B0Y C;  1P3K C;  5BT1 D;  4WU9 A;  3AZJ D;  3X1S B;  3C1C C;  4ZUX A;  3MNN D;  4AWL B;  2ARO A;  3AZI B;  5B2J A;  4DRB A;  1BFM A;  1HTA A;  5GT3 B;  5JA4 A;  5B2J C;  3UTA B;  1BH8 A;  5B31 A;  3REJ B;  3VH5 T;  4Z5T A;  5B31 C;  3REI C;  1F66 B;  5F99 B;  2CV5 D;  3LEL D;  4WU8 D;  3MNN B;  3LZ0 D;  3W96 D;  3R45 B;  2NQB B;  3C1B D;  4YM6 C;  1ZLA B;  1EQZ D;  1P3G C;  2JSS A;  1P3F D;  3MGP A;  3NQJ A;  4QLC A;  3A6N B;  1S32 A;  3MGS C;  3AZH A;  2CV5 B;  3X1U A;  3LEL B;  3AZL D;  3LZ0 B;  1JFI A;  1TAF A;  3AZE D;  3W99 D;  3MGR A;  3REL D;  1H3O A;  3AZI C;  3REK A;  4DRA A;  5B32 A;  2HIO D;  1M18 B;  1P3M B;  1F1E A;  5B32 C;  2BYM A;  3X1V A;  4J8W A;  5BT1 C;  2BYK A;  3AZJ C;  5CPI D;  1P3O A;  3VH6 A;  1P3O C;  3MNN C;  3AZE B;  3W99 B;  3REL B;  3AYW D;  2CWE A;  2HIO B;  4WNN B;  5AV8 A;  5BO0 A;  4KUD A;  5AV8 C;  3O62 D;  2RVQ D;  2NZD A;  2YFW A;  4KUD C;  5GT0 A;  5GXQ A;  1KX5 A;  2CV5 C;  3LEL C;  5GT0 C;  4WU8 C;  4NE3 A;  3LZ0 C;  3W96 C;  3C1B C;  3WKJ D;  3MVD D;  5AV9 D;  1EQZ C;  3AV2 A;  1KX3 D;  5BS7 C;  5DNM D;  1P3F C;  5GSU D;  3X1T D;  3O62 B;  3KXB A;  4JJN A;  3LZ1 D;  3AZL A;  1B67 A;  1HQ3 D;  1Q9C A;  3B6F D;  5AY8 A;  3AZL C;  1ID3 A;  3AZE C;  4H9P B;  3REL C;  5AV9 B;  3AZG D;  3W97 B;  2IO5 B;  3WAA D;  3B6G A;  1KX4 A;  5CPI A;  5AVB B;  4H9Q B;  5AV6 A;  5BNX A;  3W98 B;  5CPI C;  1HQ3 B;  3AFA B;  3B6F B;  4H9S A;  3AYW A;  3AZK D;  4E45 A;  1P3L D;  4H9S C;  3LJA B;  3AYW C;  4YS3 D;  3WAA B;  5DNN D;  2F8N D;  5JRG A;  3AZN B;  5B40 D;  2F8N K;  3O62 C;  3VH6 T;  1P3B A;  5AVC A;  4Z66 A;  2RVQ C;  5JRG C;  1P3I A;  5KDM B;  2PYO D;  5B2I B;  3WTP E;  3UT9 A;  5CPJ A;  1U35 D;  4CSR B;  5B33 A;  1P3I C;  5BNV A;  5CPJ C;  1BH9 A;  3X1S D;  3NQU A;  5G49 A;  4E44 A;  3WTP D;  2F8N H;  1TZY B;  1P3L B;  3WKJ C;  5DNM A;  3MVD C;  5AV9 C;  4WU9 B;  4YS3 B;  4J8U D;  1N1J A;  1KX3 C;  1P3A D;  5DNM C;  5B0Z A;  5B0Y A;  2F8N G;  1P3K A;  5GSU C;  3UTA D;  3X1T C;  4ZUX B;  3REJ D;  2PYO B;  1U35 B;  3LZ1 C;  3C1C A;  1F66 D;  5AV5 A;  1HQ3 C;  5JA4 B;  5F99 D;  3WTP B;  3AZG A;  5AV5 C;  1P3P A;  2NQB D;  4Z5T B;  2FJ7 B;  1ZLA D;  3AZG C;  4J8U B;  1P3P C;  1P3A B;  3WAA C;  5E5A D;  1M19 D;  3REI A;  3A6N D;  4H9R A;  4YM6 A;  3AZK C;  4XZQ D;  3MGP B;  1P3G A;  4NE6 A;  1P3L C;  3AV1 D;  3KWQ D;  5B1L B;  4YS3 C;  5B40 A;  5DNN C;  3VH6 W;  3AN2 A;  1M18 D;  3X1U B;  5E5A B;  1M19 B;  1P3M D;  5B40 C;  3MGS A;  3B0D C;  3AN2 C;  2PYO C;  3MGR B;  1H3O B;  4LD9 D;  3X1S A;  5B1M D;  4XZQ B;  3X1S C;  3REH D;  3WTP C;  3AZI A;  2BYM B;  3AV1 B;  3X1V B;  3KWQ B;  4AWL C;  4J8W B;  5GT3 A;  3UTA A;  5GT3 C;  3UTA C;  3REJ C;  1F66 A;  1KU5 A;  3AZJ A;  3V9R B;  4X23 D;  4LD9 B;  4KGC D;  1F66 C;  3MNN A;  3WA9 D;  5B1M B;  2NQB A;  5F99 C;  3R45 A;  3REH B;  4ZBJ B;  2NQB C;  1M1A D;  1ZLA C;  5CPK D;  3TU4 D;  4X23 B;  3AZM D;  4KGC B;  3A6N C;  4KHA B;  3MGQ B;  4XUJ B;  2CV5 A;  3LEL A;  4WU8 A;  1P34 D;  3AV2 B;  3WA9 B;  3LZ0 A;  3W96 A;  3C1B A;  4XZQ C;  1EQZ A;  4JJN B;  3KWQ C;  5C3I B;  5BS7 A;  1M1A B;  5CPK B;  1P3F A;  3TU4 B;  3W97 D;  1M18 C;  1P3M C;  3KUY B;  1WWI A;  3AZM B;  5AVB D;  1P34 B;  3W98 D;  3AZE A;  5B1M C;  3W99 A;  3AFA D;  3REH C;  3REL A;  2HIO A;  3W99 C;  4J8V B;  5B24 B;  3LJA D;  5BNX B;  3UTB D;  2HIO C;  4J8X B;  5CP6 D;  3AZN D;  2YFV B;  4X23 C;  4R8P D;  2LY8 A;  5B2I D;  1AOI D;  3WA9 C;  1P3B B;  3B0C W;  1TZY D;  4Z66 B;  1M1A C;  5C3I C;  3UTB B;  3UT9 B;  4WU9 D;  3TU4 C;  3O62 A;  5CP6 B;  3AZF B;  4WZS B;  2HUE B;  4ZUX D;  4H9N B;  4R8P B;  1AOI B;  5FUG A;  2ARO D;  5B2J D;  4UUZ A;  3WKJ A;  4H9P A;  3MVD A;  5AV9 A;  4CAY B;  1KX3 A;  3KSY A;  4Z5T D;  2FJ7 D;  5GSU A;  3X1T A;  3W97 C;  2IO5 C;  3LZ1 A;  4H9Q A;  3W98 A;  1HQ3 A;  2ARO B;  5AVB C;  5B2J B;  3B6F A;  3W98 C;  4M6B A;  3AFA C;  1BH8 B;  3B6F C;  5B31 B;  3REI B;  3MGP D;  4QLC D;  3WAA A;  3LJA C;  1S32 D;  5B1L D;  4H9O A; 
#chains in the Genus database with same CATH topology
 3AZH D;  3AZN C;  3X1U D;  5KDM A;  4CSR A;  4R8P C;  4Z2M G;  3MGR D;  5B2I C;  3REK D;  3AZK A;  5B32 D;  4HGA B;  1TZY A;  1P3L A;  4NFT A;  3NQJ B;  4QLC B;  1TZY C;  3MGS B;  4YS3 A;  3X1V D;  5DNN A;  2F8N A;  3A1I A;  1S32 B;  4J8W D;  4WU9 C;  2ZY2 A;  3AZH B;  1P3O D;  2PYO A;  1U35 A;  3H0L C;  1TAF B;  4ZUX C;  1JFI B;  3EPK A;  1U35 C;  2ARO C;  3REK B;  5B32 B;  3WTP A;  5B32 G;  5AV8 D;  1R4V A;  4KUD D;  2FJ7 A;  3AZJ B;  4J8U A;  1P3A A;  2NZD D;  4Z5T C;  2FJ7 C;  2BYK B;  4J8U C;  1P3O B;  5GT0 D;  3REJ A;  5GXQ D;  1P3A C;  1KX5 D;  5F99 A;  3MGQ D;  4XUJ D;  5AV8 B;  5BO0 B;  3AV2 D;  4HGA C;  2DF4 C;  4KUD B;  1ZLA A;  3MGP C;  5B1L A;  4QLC C;  2NZD B;  3KXB D;  4JJN D;  2YFW B;  1S32 C;  3B0C T;  5B1L C;  5E5A A;  5GT0 B;  4G91 B;  5GXQ B;  4WU8 B;  3AZH C;  1M19 A;  3W96 B;  1KX5 B;  3C1B B;  3X1U C;  5E5A C;  1M19 C;  3A6N A;  2L5A A;  3KUY D;  5AY8 D;  1EQZ B;  1ID3 D;  1B6W A;  2G5I C;  3MGR C;  1WWS A;  5CHL B;  3REK C;  4XZQ A;  1P3F B;  3AV1 A;  3KWQ A;  3B6G D;  1KX4 D;  3KXB B;  3AV1 C;  3X1V C;  2Y2K A;  4J8W C;  1M18 A;  4J8V D;  5B24 D;  5AV6 D;  4DQY B;  1P3M A;  3AZL B;  4J8X D;  3V9R A;  5AY8 B;  4LD9 A;  1ID3 B;  3VH5 W;  4LD9 C;  5B1M A;  3REH A;  2JCH A;  3B6G B;  5JRG D;  4ZBJ C;  1KX4 B;  5CPI B;  1P3B D;  4WNN A;  5AVC D;  4Z66 D;  1P3I D;  2NZD C;  5AV6 B;  3UT9 D;  5CPJ D;  4WV4 B;  5B33 D;  4G91 C;  5GXQ C;  4X23 A;  1KX5 C;  3AYW B;  3AZF D;  4KGC A;  4KHA A;  3MGQ A;  1PZR A;  4XUJ A;  3WA9 A;  4KGC C;  3MGQ C;  4XUJ C;  4EO5 B;  4G92 B;  3AV2 C;  4NE5 A;  5JRG B;  5B0Z D;  5B0Y D;  1P3K D;  1M1A A;  3B0B A;  5CPK A;  5AVC B;  3TU4 A;  1P3I B;  3KXB C;  4JJN C;  5FUG B;  5CPJ B;  5CPK C;  5B33 B;  3C1C D;  4UUZ B;  3VH5 A;  3KUY A;  2ZY3 A;  3AZM A;  5BNV B;  5AV5 D;  3WKJ B;  1BH9 B;  3NQU B;  5G49 B;  5AY8 C;  3MVD B;  3KUY C;  1ID3 C;  1P34 A;  3AZM C;  1P3P D;  1KX3 B;  5DNM B;  5GSU B;  1P34 C;  3X1T B;  1N1J B;  5B0Z B;  5B0Y B;  1P3K B;  3B6G C;  1KX4 C;  3LZ1 B;  5B31 D;  5B24 A;  4J8V A;  3REI D;  2DQN C;  3W97 A;  4J8X A;  4WJ3 C;  4J8V C;  5B24 C;  5AV6 C;  3C1C B;  2Y2G A;  5AV5 B;  4J8X C;  2YFV A;  1A7W A;  4YM6 D;  5AVB A;  3AZG B;  1P3G D;  1P3P B;  3AFA A;  3F6T A;  4H9O B;  4EO5 C;  4G92 C;  3AN2 D;  3LJA A;  3UTB A;  5B31 G;  1P3B C;  3MGS D;  5AVC C;  4Z66 C;  5CP6 A;  1ULY A;  3A1K A;  3UTB C;  3UT9 C;  3AZK B;  4Z2M H;  5B33 C;  3AZN A;  3AZF A;  4H9R B;  5CP6 C;  4H9N A;  4YM6 B;  4R8P A;  3AZF C;  5B2I A;  1AOI A;  2HUE C;  3AZI D;  1P3G B;  5DNN B;  2F8N B;  2Y2M A;  1AOI C;  5GT3 D;  5B40 B;  3B0D B;  4CAY A;  5B0Z C;  3AN2 B;  5B0Y C;  1P3K C;  5BT1 D;  4WU9 A;  3AZJ D;  3X1S B;  3C1C C;  4ZUX A;  3MNN D;  4AWL B;  2ARO A;  3AZI B;  5B2J A;  4DRB A;  1BFM A;  1HTA A;  5GT3 B;  5JA4 A;  5B2J C;  2XD5 A;  3UTA B;  1BH8 A;  5B31 A;  3REJ B;  3VH5 T;  4Z5T A;  5B31 C;  3REI C;  1F66 B;  5F99 B;  2CV5 D;  3LEL D;  4WU8 D;  3MNN B;  3LZ0 D;  3W96 D;  3R45 B;  2NQB B;  3C1B D;  4YM6 C;  1ZLA B;  1EQZ D;  1P3G C;  2F2A C;  2JSS A;  1P3F D;  3MGP A;  3NQJ A;  2BG1 A;  4QLC A;  3A6N B;  1S32 A;  3MGS C;  3AZH A;  2CV5 B;  3X1U A;  3EG5 B;  3LEL B;  3AZL D;  3LZ0 B;  1JFI A;  1TAF A;  3AZE D;  3W99 D;  3MGR A;  3REL D;  1H3O A;  3KFU G;  3AZI C;  3REK A;  4DRA A;  5B32 A;  2HIO D;  1M18 B;  1P3M B;  1F1E A;  5B32 C;  2BYM A;  3X1V A;  4J8W A;  5BT1 C;  2BYK A;  3AZJ C;  5CPI D;  1P3O A;  2Y2P A;  3VH6 A;  1P3O C;  3MNN C;  3AZE B;  3W99 B;  3REL B;  3AYW D;  2CWE A;  2HIO B;  4WNN B;  5AV8 A;  5BO0 A;  4KUD A;  5AV8 C;  3O62 D;  2RVQ D;  2NZD A;  2YFW A;  4KUD C;  5GT0 A;  5GXQ A;  1KX5 A;  2CV5 C;  3LEL C;  5GT0 C;  4WU8 C;  2Y2L A;  4NE3 A;  2XD1 A;  3W96 C;  3LZ0 C;  3C1B C;  3WKJ D;  2UWX A;  1Z2C B;  3MVD D;  5AV9 D;  1EQZ C;  3AV2 A;  1KX3 D;  5BS7 C;  5DNM D;  1P3F C;  5GSU D;  3X1T D;  3O62 B;  3KXB A;  4JJN A;  3LZ1 D;  3P5J B;  2J8P A;  3AZL A;  1B67 A;  1HQ3 D;  1Q9C A;  3B6F D;  5AY8 A;  3AZL C;  1ID3 A;  3AZE C;  4H9P B;  3REL C;  5AV9 B;  3AZG D;  3W97 B;  2IO5 B;  3WAA D;  3B6G A;  1KX4 A;  5CPI A;  5AVB B;  4H9Q B;  5AV6 A;  5BNX A;  3W98 B;  5CPI C;  2ZY4 A;  1HQ3 B;  3AFA B;  3B6F B;  4H9S A;  3AYW A;  3AZK D;  4E45 A;  1P3L D;  4H9S C;  3LJA B;  3AYW C;  4YS3 D;  3WAA B;  5DNN D;  2F8N D;  5JRG A;  3AZN B;  5B40 D;  2F8N K;  3O62 C;  3VH6 T;  1P3B A;  5AVC A;  5JRG C;  2RVQ C;  4Z66 A;  1P3I A;  5KDM B;  2PYO D;  5B2I B;  3WTP E;  3UT9 A;  5CPJ A;  1U35 D;  5B33 A;  4CSR B;  1P3I C;  5BNV A;  5CPJ C;  1BH9 A;  3X1S D;  3NQU A;  5G49 A;  4E44 A;  3WTP D;  2F8N H;  1TZY B;  1P3L B;  3WKJ C;  5DNM A;  3MVD C;  5AV9 C;  4WU9 B;  4YS3 B;  4J8U D;  1N1J A;  1KX3 C;  1P3A D;  5DNM C;  5B0Z A;  5B0Y A;  2F8N G;  1P3K A;  5GSU C;  3UTA D;  3X1T C;  4ZUX B;  3REJ D;  2PYO B;  1U35 B;  3LZ1 C;  3C1C A;  1F66 D;  5AV5 A;  1HQ3 C;  5JA4 B;  5F99 D;  3WTP B;  3AZG A;  5AV5 C;  1P3P A;  2NQB D;  4Z5T B;  2FJ7 B;  1ZLA D;  3AZG C;  4J8U B;  1P3P C;  1P3A B;  3WAA C;  2JE5 A;  5E5A D;  1M19 D;  3REI A;  3A6N D;  2Y2O A;  4H9R A;  2Y2I A;  4YM6 A;  4XZQ D;  3AZK C;  3MGP B;  1P3G A;  4NE6 A;  1P3L C;  3AV1 D;  3KWQ D;  5B1L B;  4YS3 C;  5B40 A;  1T3U A;  5DNN C;  3VH6 W;  3AN2 A;  1M18 D;  3X1U B;  5E5A B;  1M19 B;  1P3M D;  5B40 C;  3MGS A;  3B0D C;  3AN2 C;  2PYO C;  3MGR B;  1H3O B;  4LD9 D;  3X1S A;  3H0M C;  5B1M D;  2Y2J A;  4XZQ B;  3X1S C;  3REH D;  3WTP C;  3AZI A;  2BYM B;  3AV1 B;  3X1V B;  3KWQ B;  3AL0 C;  4AWL C;  4J8W B;  5GT3 A;  3UTA A;  5GT3 C;  3UTA C;  3REJ C;  1F66 A;  1KU5 A;  3AZJ A;  3V9R B;  3EPL A;  4X23 D;  4LD9 B;  4KGC D;  2RIQ A;  1F66 C;  3MNN A;  3WA9 D;  5B1M B;  2NQB A;  5F99 C;  3R45 A;  3REH B;  4ZBJ B;  2NQB C;  1M1A D;  1ZLA C;  5CPK D;  3TU4 D;  4X23 B;  3AZM D;  4KGC B;  3A6N C;  4KHA B;  3MGQ B;  4XUJ B;  2CV5 A;  3LEL A;  4WU8 A;  1P34 D;  3AV2 B;  3WA9 B;  3LZ0 A;  3W96 A;  1W2E A;  2G5H C;  3C1B A;  4XZQ C;  1EQZ A;  4JJN B;  3KWQ C;  5C3I B;  5BS7 A;  1M1A B;  5CPK B;  1P3F A;  3TU4 B;  2Y2H A;  3EPJ A;  3H0R C;  3W97 D;  1M18 C;  1P3M C;  3KUY B;  1WWI A;  3AZM B;  2VQR A;  5AVB D;  1P34 B;  3W98 D;  3AZE A;  5B1M C;  3W99 A;  3AFA D;  3REH C;  3REL A;  2HIO A;  3W99 C;  4UPK A;  3IP4 C;  5B24 B;  3LJA D;  5BNX B;  4J8V B;  3UTB D;  2HIO C;  2Y2N A;  4J8X B;  5CP6 D;  3AZN D;  2Y2Q A;  2YFV B;  4X23 C;  4R8P D;  2LY8 A;  5B2I D;  1AOI D;  3WA9 C;  1P3B B;  3B0C W;  1TZY D;  4Z66 B;  1M1A C;  5C3I C;  3UTB B;  3UT9 B;  4WU9 D;  3TU4 C;  3O62 A;  5CP6 B;  3AZF B;  4WZS B;  2HUE B;  4ZUX D;  4H9N B;  4R8P B;  3FDD A;  1AOI B;  5FUG A;  2ARO D;  5B2J D;  4UUZ A;  3WKJ A;  4H9P A;  3MVD A;  5AV9 A;  4CAY B;  1KX3 A;  3KSY A;  4Z5T D;  2FJ7 D;  5GSU A;  3X1T A;  2FFF B;  3W97 C;  2IO5 C;  3LZ1 A;  4H9Q A;  3W98 A;  1HQ3 A;  2ARO B;  5AVB C;  5B2J B;  3EPH A;  3B6F A;  3W98 C;  2W8S A;  4M6B A;  3AFA C;  1BH8 B;  3B6F C;  5B31 B;  3REI B;  2ZY5 A;  3MGP D;  4QLC D;  3WAA A;  3LJA C;  1S32 D;  2ZM5 A;  5B1L D;  4H9O A; 
#chains in the Genus database with same CATH homology
 3AZH D;  3AZN C;  3X1U D;  5KDM A;  4CSR A;  4R8P C;  4Z2M G;  3MGR D;  5B2I C;  3REK D;  3AZK A;  5B32 D;  4HGA B;  1TZY A;  1P3L A;  4NFT A;  3NQJ B;  4QLC B;  1TZY C;  3MGS B;  4YS3 A;  3X1V D;  5DNN A;  2F8N A;  3A1I A;  1S32 B;  4J8W D;  4WU9 C;  2ZY2 A;  3AZH B;  1P3O D;  2PYO A;  1U35 A;  3H0L C;  1TAF B;  4ZUX C;  1JFI B;  3EPK A;  1U35 C;  2ARO C;  3REK B;  5B32 B;  3WTP A;  5B32 G;  5AV8 D;  1R4V A;  4KUD D;  2FJ7 A;  3AZJ B;  4J8U A;  1P3A A;  2NZD D;  4Z5T C;  2FJ7 C;  2BYK B;  4J8U C;  1P3O B;  5GT0 D;  3REJ A;  5GXQ D;  1P3A C;  1KX5 D;  5F99 A;  3MGQ D;  4XUJ D;  5AV8 B;  5BO0 B;  3AV2 D;  4HGA C;  2DF4 C;  4KUD B;  1ZLA A;  3MGP C;  5B1L A;  4QLC C;  2NZD B;  3KXB D;  4JJN D;  2YFW B;  1S32 C;  3B0C T;  5B1L C;  5E5A A;  5GT0 B;  4G91 B;  5GXQ B;  4WU8 B;  3AZH C;  1M19 A;  3W96 B;  1KX5 B;  3C1B B;  3X1U C;  5E5A C;  1M19 C;  3A6N A;  2L5A A;  3KUY D;  5AY8 D;  1EQZ B;  1ID3 D;  1B6W A;  2G5I C;  3MGR C;  1WWS A;  5CHL B;  3REK C;  4XZQ A;  1P3F B;  3AV1 A;  3KWQ A;  3B6G D;  1KX4 D;  3KXB B;  3AV1 C;  3X1V C;  2Y2K A;  4J8W C;  1M18 A;  4J8V D;  5B24 D;  5AV6 D;  4DQY B;  1P3M A;  3AZL B;  4J8X D;  3V9R A;  5AY8 B;  4LD9 A;  1ID3 B;  3VH5 W;  4LD9 C;  5B1M A;  3REH A;  2JCH A;  3B6G B;  5JRG D;  4ZBJ C;  1KX4 B;  5CPI B;  1P3B D;  4WNN A;  5AVC D;  4Z66 D;  1P3I D;  2NZD C;  5AV6 B;  3UT9 D;  5CPJ D;  4WV4 B;  5B33 D;  4G91 C;  5GXQ C;  4X23 A;  1KX5 C;  3AYW B;  3AZF D;  4KGC A;  4KHA A;  3MGQ A;  1PZR A;  4XUJ A;  3WA9 A;  4KGC C;  3MGQ C;  4XUJ C;  4EO5 B;  4G92 B;  3AV2 C;  4NE5 A;  5JRG B;  5B0Z D;  5B0Y D;  1P3K D;  1M1A A;  3B0B A;  5CPK A;  5AVC B;  3TU4 A;  1P3I B;  3KXB C;  4JJN C;  5FUG B;  5CPJ B;  5CPK C;  5B33 B;  3C1C D;  4UUZ B;  3VH5 A;  3KUY A;  2ZY3 A;  3AZM A;  5BNV B;  5AV5 D;  3WKJ B;  1BH9 B;  3NQU B;  5G49 B;  5AY8 C;  3MVD B;  3KUY C;  1ID3 C;  1P34 A;  3AZM C;  1P3P D;  1KX3 B;  5DNM B;  5GSU B;  1P34 C;  3X1T B;  1N1J B;  5B0Z B;  5B0Y B;  1P3K B;  3B6G C;  1KX4 C;  3LZ1 B;  5B31 D;  5B24 A;  4J8V A;  3REI D;  2DQN C;  3W97 A;  4J8X A;  4WJ3 C;  4J8V C;  5B24 C;  5AV6 C;  3C1C B;  2Y2G A;  5AV5 B;  4J8X C;  2YFV A;  1A7W A;  4YM6 D;  5AVB A;  3AZG B;  1P3G D;  1P3P B;  3AFA A;  3F6T A;  4H9O B;  4EO5 C;  4G92 C;  3AN2 D;  3LJA A;  3UTB A;  5B31 G;  1P3B C;  3MGS D;  5AVC C;  4Z66 C;  5CP6 A;  1ULY A;  3A1K A;  3UTB C;  3UT9 C;  3AZK B;  4Z2M H;  5B33 C;  3AZN A;  3AZF A;  4H9R B;  5CP6 C;  4H9N A;  4YM6 B;  4R8P A;  3AZF C;  5B2I A;  1AOI A;  2HUE C;  3AZI D;  1P3G B;  5DNN B;  2F8N B;  2Y2M A;  1AOI C;  5GT3 D;  5B40 B;  3B0D B;  4CAY A;  5B0Z C;  3AN2 B;  5B0Y C;  1P3K C;  5BT1 D;  4WU9 A;  3AZJ D;  3X1S B;  3C1C C;  4ZUX A;  3MNN D;  4AWL B;  2ARO A;  3AZI B;  5B2J A;  4DRB A;  1BFM A;  1HTA A;  5GT3 B;  5JA4 A;  5B2J C;  2XD5 A;  3UTA B;  1BH8 A;  5B31 A;  3REJ B;  3VH5 T;  4Z5T A;  5B31 C;  3REI C;  1F66 B;  5F99 B;  2CV5 D;  3LEL D;  4WU8 D;  3MNN B;  3LZ0 D;  3W96 D;  3R45 B;  2NQB B;  3C1B D;  4YM6 C;  1ZLA B;  1EQZ D;  1P3G C;  2F2A C;  2JSS A;  1P3F D;  3MGP A;  3NQJ A;  2BG1 A;  4QLC A;  3A6N B;  1S32 A;  3MGS C;  3AZH A;  2CV5 B;  3X1U A;  3EG5 B;  3LEL B;  3AZL D;  3LZ0 B;  1JFI A;  1TAF A;  3AZE D;  3W99 D;  3MGR A;  3REL D;  1H3O A;  3KFU G;  3AZI C;  3REK A;  4DRA A;  5B32 A;  2HIO D;  1M18 B;  1P3M B;  1F1E A;  5B32 C;  2BYM A;  3X1V A;  4J8W A;  5BT1 C;  2BYK A;  3AZJ C;  5CPI D;  1P3O A;  2Y2P A;  3VH6 A;  1P3O C;  3MNN C;  3AZE B;  3W99 B;  3REL B;  3AYW D;  2CWE A;  2HIO B;  4WNN B;  5AV8 A;  5BO0 A;  4KUD A;  5AV8 C;  3O62 D;  2RVQ D;  2NZD A;  2YFW A;  4KUD C;  5GT0 A;  5GXQ A;  1KX5 A;  2CV5 C;  3LEL C;  5GT0 C;  4WU8 C;  2Y2L A;  4NE3 A;  2XD1 A;  3W96 C;  3LZ0 C;  3C1B C;  3WKJ D;  2UWX A;  1Z2C B;  3MVD D;  5AV9 D;  1EQZ C;  3AV2 A;  1KX3 D;  5BS7 C;  5DNM D;  1P3F C;  5GSU D;  3X1T D;  3O62 B;  3KXB A;  4JJN A;  3LZ1 D;  3P5J B;  2J8P A;  3AZL A;  1B67 A;  1HQ3 D;  1Q9C A;  3B6F D;  5AY8 A;  3AZL C;  1ID3 A;  3AZE C;  4H9P B;  3REL C;  5AV9 B;  3AZG D;  3W97 B;  2IO5 B;  3WAA D;  3B6G A;  1KX4 A;  5CPI A;  5AVB B;  4H9Q B;  5AV6 A;  5BNX A;  3W98 B;  5CPI C;  2ZY4 A;  1HQ3 B;  3AFA B;  3B6F B;  4H9S A;  3AYW A;  3AZK D;  4E45 A;  1P3L D;  4H9S C;  3LJA B;  3AYW C;  4YS3 D;  3WAA B;  5DNN D;  2F8N D;  5JRG A;  3AZN B;  5B40 D;  2F8N K;  3O62 C;  3VH6 T;  1P3B A;  5AVC A;  5JRG C;  2RVQ C;  4Z66 A;  1P3I A;  5KDM B;  2PYO D;  5B2I B;  3WTP E;  3UT9 A;  5CPJ A;  1U35 D;  5B33 A;  4CSR B;  1P3I C;  5BNV A;  5CPJ C;  1BH9 A;  3X1S D;  3NQU A;  5G49 A;  4E44 A;  3WTP D;  2F8N H;  1TZY B;  1P3L B;  3WKJ C;  5DNM A;  3MVD C;  5AV9 C;  4WU9 B;  4YS3 B;  4J8U D;  1N1J A;  1KX3 C;  1P3A D;  5DNM C;  5B0Z A;  5B0Y A;  2F8N G;  1P3K A;  5GSU C;  3UTA D;  3X1T C;  4ZUX B;  3REJ D;  2PYO B;  1U35 B;  3LZ1 C;  3C1C A;  1F66 D;  5AV5 A;  1HQ3 C;  5JA4 B;  5F99 D;  3WTP B;  3AZG A;  5AV5 C;  1P3P A;  2NQB D;  4Z5T B;  2FJ7 B;  1ZLA D;  3AZG C;  4J8U B;  1P3P C;  1P3A B;  3WAA C;  2JE5 A;  5E5A D;  1M19 D;  3REI A;  3A6N D;  2Y2O A;  4H9R A;  2Y2I A;  4YM6 A;  4XZQ D;  3AZK C;  3MGP B;  1P3G A;  4NE6 A;  1P3L C;  3AV1 D;  3KWQ D;  5B1L B;  4YS3 C;  5B40 A;  1T3U A;  5DNN C;  3VH6 W;  3AN2 A;  1M18 D;  3X1U B;  5E5A B;  1M19 B;  1P3M D;  5B40 C;  3MGS A;  3B0D C;  3AN2 C;  2PYO C;  3MGR B;  1H3O B;  4LD9 D;  3X1S A;  3H0M C;  5B1M D;  2Y2J A;  4XZQ B;  3X1S C;  3REH D;  3WTP C;  3AZI A;  2BYM B;  3AV1 B;  3X1V B;  3KWQ B;  3AL0 C;  4AWL C;  4J8W B;  5GT3 A;  3UTA A;  5GT3 C;  3UTA C;  3REJ C;  1F66 A;  1KU5 A;  3AZJ A;  3V9R B;  3EPL A;  4X23 D;  4LD9 B;  4KGC D;  2RIQ A;  1F66 C;  3MNN A;  3WA9 D;  5B1M B;  2NQB A;  5F99 C;  3R45 A;  3REH B;  4ZBJ B;  2NQB C;  1M1A D;  1ZLA C;  5CPK D;  3TU4 D;  4X23 B;  3AZM D;  4KGC B;  3A6N C;  4KHA B;  3MGQ B;  4XUJ B;  2CV5 A;  3LEL A;  4WU8 A;  1P34 D;  3AV2 B;  3WA9 B;  3LZ0 A;  3W96 A;  1W2E A;  2G5H C;  3C1B A;  4XZQ C;  1EQZ A;  4JJN B;  3KWQ C;  5C3I B;  5BS7 A;  1M1A B;  5CPK B;  1P3F A;  3TU4 B;  2Y2H A;  3EPJ A;  3H0R C;  3W97 D;  1M18 C;  1P3M C;  3KUY B;  1WWI A;  3AZM B;  2VQR A;  5AVB D;  1P34 B;  3W98 D;  3AZE A;  5B1M C;  3W99 A;  3AFA D;  3REH C;  3REL A;  2HIO A;  3W99 C;  4UPK A;  3IP4 C;  5B24 B;  3LJA D;  5BNX B;  4J8V B;  3UTB D;  2HIO C;  2Y2N A;  4J8X B;  5CP6 D;  3AZN D;  2Y2Q A;  2YFV B;  4X23 C;  4R8P D;  2LY8 A;  5B2I D;  1AOI D;  3WA9 C;  1P3B B;  3B0C W;  1TZY D;  4Z66 B;  1M1A C;  5C3I C;  3UTB B;  3UT9 B;  4WU9 D;  3TU4 C;  3O62 A;  5CP6 B;  3AZF B;  4WZS B;  2HUE B;  4ZUX D;  4H9N B;  4R8P B;  3FDD A;  1AOI B;  5FUG A;  2ARO D;  5B2J D;  4UUZ A;  3WKJ A;  4H9P A;  3MVD A;  5AV9 A;  4CAY B;  1KX3 A;  3KSY A;  4Z5T D;  2FJ7 D;  5GSU A;  3X1T A;  2FFF B;  3W97 C;  2IO5 C;  3LZ1 A;  4H9Q A;  3W98 A;  1HQ3 A;  2ARO B;  5AVB C;  5B2J B;  3EPH A;  3B6F A;  3W98 C;  2W8S A;  4M6B A;  3AFA C;  1BH8 B;  3B6F C;  5B31 B;  3REI B;  2ZY5 A;  3MGP D;  4QLC D;  3WAA A;  3LJA C;  1S32 D;  2ZM5 A;  5B1L D;  4H9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...