3VH5A

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
100
structure length
100
Chain Sequence
AGGEQRELLIQRLRAAVHYTTGALAQDVAEDKGVLFSKQTVAAISEITFRQAENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
total genus 42
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh5A00
1EQZA 3X1UA 5B40D 1P3LD 1N1JA 5BNVA 5FUGA 3UT9C 3AZGA 1P3BA 3LZ0B 5B31A 5B32C 3UT9D 2NQBA 5GSUB 3B0DB 3AV2A 5E5AB 3LZ0C 3AZKA 4XUJB 4YM6A 3LZ0D 1M1AB 3O62A 3REJC 1AOIB 4H9OA 5E5AD 3MGSB 3REJD 5CHLB 4Z5TB 3AYWC 4H9RA 4XUJD 2FJ7C 1M1AD 4G92C 3UTAA 2FJ7D 4WNNB 3MNNC 1AOID 3AZHC 3MVDB 2CV5A 3MGSD 2YFWA 4XZQA 4Z5TD 1EQZC 5B31B 3VH5A 3X1UC 1P3OB 3LELB 4NFTA 3X1UD 3VH6T 3MVDD 3AZGC 1P3BC 5B31C 4H9QA 4YM6B 1P3BD 1KX3A 2NQBC 5DNMA 5B31D 3C1BA 3AV2C 1P3OD 3LELD 5B2JB 1P3IB 3AZKC 4YM6C 3X1SA 3O62C 4YM6D 5BS7A 4WU8A 4J8XA 3O62D 1M19B 3VH5T 5B2JD 3REHB 2CV5B 3AZFA 2YFWB 3KWQA 3B6GB 4EO5B 3UTAC 4ZUXA 3C1CB 3AZNA 2CV5C 4XZQC 5DNNA 3REHD 2CV5D 1S32A 5AV9B 3B6GD 4NE3A 4M6BA 5DNMB 3AZLA 3AV1A 4JJNB 3NQJA 1ULYA 1U35A 4LD9A 1KX3C 5BO0B 5DNMC 5AV9D 3C1BC 3KUYB 1TZYB 5C3IB 5DNMD 4NE6A 4JJND 4YS3B 5BT1C 3X1SC 1ID3A 3AZFB 5BS7C 4WU8C 5AVCA 4J8XC 2IO5C 2F8NA 3KUYD 1TZYD 4KGCB 5CP6B 3AZFC 4YS3D 3KWQC 5B32G 1WWSA 4Z66A 4QLCA 3AZFD 3AN2A 2PYOB 4ZUXC 5B24A 1BFMA 4H9NA 3AZNC 4KGCD 5CPIB 5B40A 5DNNC 5CP6D 3AZND 5JA4A 4DRAA 1P3LA 1S32C 3B6FB 1S32D 5B2IA 3AZLC 3AV1C 2PYOD 3W98B 3RELB 3AV1D 1U35C 4LD9C 5JRGB 5AY8B 3B6FD 3X1TA 1ID3B 5BNXB 2F8NB 3LZ0A 3W98D 3W96B 3RELD 1ID3C 3WTPB 5AY8D 5GSUA 5JRGD 5E5AA 5AVCC 1ID3D 3AN2B 3LZ1B 2HUEC 4XUJA 2F8ND 4KUDB 1M1AA 3R45B 4Z66C 3W96D 4QLCC 4ZBJB 4CSRB 1AOIA 2HIOA 3AN2C 3WTPD 3MGSA 4Z5TA 1P3MB 3AN2D 3LZ1D 1B6WA 1KX5B 4KUDD 3AZMB 5B40C 1P3LC 4WNNA 3LJAA 1P3PA 3X1TB 4HGAC 3MVDA 5B2IC 3W99B 3UTBB 1KX5D 3WKJA 5B2ID 1TAFB 3X1TC 1P3OA 3LELA 5AVBB 3X1TD 3WAAB 3UTBD 2NZDB 3W97B 4UUZA 1P34B 5GSUC 5GXQA 3B0DC 3AFAB 5E5AC 2JSSA 2HIOB 5B2JA 1P3IA 5GSUD 1KX4A 4XUJC 1M1AC 3WAAD 1A7WA 5GT3B 2NZDD 1P34D 1AOIC 2HIOC 3AZEB 3WTPE 3LJAB 3MGSC 1M19A 1B67A 4Z5TC 1P3PB 2HIOD 4J8WB 3REHA 5AV6B 5AV5B 3V9RB 3B6GA 3WKJB 5GT3D 1HQ3B 3LJAC 5AV8B 1P3PC 1F1EA 3MVDC 3C1CA 3LJAD 5GT0A 1P3PD 3WKJC 4CAYB 3REKB 5AV9A 3B0BA 3WKJD 1WWIA 4UUZB 1P3OC 3LELC 1HQ3D 5GXQB 4JJNA 1KX4B 3B0CW 3KXBA 5BO0A 3REKD 5GXQC 3KUYA 1TZYA 5B2JC 1KX4C 1P3IC 5GXQD 4YS3A 4H9PB 2F8NH 1KX4D 1P3ID 3WA9B 1BH9B 1M19C 4KGCA 5CP6A 3REHC 5GT0B 5F99B 1M19D 3B6GC 4EO5C 3WA9D 2PYOA 4G91B 1BH8B 3C1CC 5GT0C 1F66B 5CPIA 3C1CD 3B6FA 5GT0D 5F99D 5AV9C 4G91C 3KXBB 3W98A 4JJNC 5B33A 3RELA 1F66D 3KXBC 5AY8A 5JRGA 3TU4B 1H3OB 5CPJB 3KXBD 5BNXA 1TZYC 5C3IC 3KUYC 5B1LB 4YS3C 5CPKB 3W96A 4WU9B 2BYMB 3WTPA 3TU4D 3NQUB 5CPJD 4R8PB 3LZ1A 2AROB 1M18B 4KGCC 5B1LD 5CP6C 4KUDA 4AWLB 3R45A 3AZIB 4WU9D 5CPKD 4CSRA 4DRBA 4J8UB 2PYOC 2RVQC 4R8PD 1P3MA 1KX5A 4AWLC 2AROD 1M18D 3MGRB 2RVQD 5CPIC 5B33B 3AZMA 3B6FC 5CPID 3X1VB 3W99A 4J8UD 3W98C 3UTBA 5B33C 3RELC 1TAFA 1P3KB 5B0YB 3A6NB 5AY8C 5JRGC 5B33D 5AVBA 3X1VD 4X23A 3WAAA 5G49B 3W96C 2NZDA 3W97A 5B1MB 5B31G 1P34A 1P3KD 3A6ND 3WTPC 3AFAA 4WZSB 3LZ1C 2BYKA 4KUDC 5GT3A 1P3FA 4ZBJC 5B1MD 4E45A 3AZEA 1P3MC 5KDMB 4J8WA 1KX5C 5AV6A 2LY8A 3V9RA 5AV5A 5B0ZB 3AZMC 1P3MD 4Z2MH 1HQ3A 3AZMD 5AV8A 1JFIB 3W99C 3MGPB 3UTBC 3W99D 4CAYA 4X23B 3REKA 5AVBC 3VH6W 3WAAC 4X23C 3MGPD 5AVBD 2BYKB 3UT9B 2NZDC 3W97C 1P34C 4X23D 1P3FB 5B32B 3AFAC 3W97D 3AZJA 1R4VA 3AFAD 4H9PA 5GT3C 1P3FC 3WA9A 1ZLAA 1P3FD 5B32D 3AZEC 3REJB 1BH9A 4J8WC 3AZED 5AV6C 3VH5W 5F99A 5AV5C 3AYWB 3VH6A 4J8WD 2FJ7B 5AV6D 1HQ3C 5AV5D 5AV8C 4G92B 1BH8A 3MNNB 5AV8D 3AZHB 1F66A 2YFVA 4KHAA 3REKC 3AYWD 3KSYA 1EQZB 3X1UB 1P3AA 1N1JB 5BNVB 3REIA 3MNND 3AZJB 5FUGB 3AZHD 3AZGB 1P3BB 3TU4A 1H3OA 5CPJA 2NQBB 1EQZD 1ZLAB 5B1LA 3AZJC 3AV2B 5CPKA 4WU9A 3AZKB 2BYMA 3AZJD 3AZGD 3WA9C 3NQUA 1ZLAC 3O62B 4R8PA 2NQBD 2F8NG 2AROA 1M18A 1ZLAD 4H9OB 3AV2D 3AZIA 5F99C 2YFVB 4KHAB 3AZKD 4H9RB 4J8UA 2L5AA 3UTAB 1P3AB 1F66C 3MGRA 3REIB 4XZQB 1KU5A 3X1VA 1P3AC 3UTAD 3REIC 1HTAA 1P3AD 1P3KA 2CWEA 5B0YA 3A6NA 3B0CT 4J8VA 3REID 3TU4C 4WV4B 4XZQD 4H9QB 1P3GA 1Q9CA 5CPJC 1KX3B 2F8NK 5B1LC 3C1BB 5G49A 5CPKC 4WU9C 5B1MA 3X1SB 4R8PC 4WU8B 1KX3D 4J8XB 2IO5B 2AROC 1M18C 3C1BD 3AZIC 3KWQB 3AZID 4J8UC 5BT1D 3X1SD 4H9SA 5KDMA 4ZUXB 4WU8D 4J8XD 3MGQA 3MGRC 3AZNB 5B0ZA 3MGRD 5DNNB 4J8VB 1P3GB 3KWQD 3X1VC 1S32B 1JFIA 3MGPA 3AZLB 4ZUXD 3AV1B 1P3KC 3NQJB 5B0YC 3A6NC 4J8VC 1P3GC 1U35B 4LD9B 5B0YD 5DNND 4J8VD 1P3GD 3UT9A 3AZLD 5B1MC 5B32A 4E44A 1U35D 4NE5A 4LD9D 5AVCB 2HUEB 3MGQB 4Z66B 4QLCB 3REJA 4H9SC 5B24B 5AVCD 3MGQC 4H9NB 3AYWA 5B0ZC 2FJ7A 3MGQD 5B40B 1P3LB 5B0ZD 5JA4B 4Z66D 4QLCD 3MNNA 5B24C 3MGPC 4HGAB 3AZHA 5B2IB 5B24D 4Z2MG
chains in the Genus database with same CATH superfamily
1EQZA 3X1UA 5B40D 2ZY3A 1P3LD 4WJ3C 1N1JA 5BNVA 5FUGA 3UT9C 3AZGA 1P3BA 3LZ0B 5B31A 5B32C 3UT9D 2NQBA 2JCHA 2Y2LA 5GSUB 3B0DB 3AV2A 5E5AB 3F6TA 3LZ0C 3AZKA 4XUJB 4YM6A 3LZ0D 1M1AB 3O62A 3REJC 2BG1A 1AOIB 4H9OA 5E5AD 3MGSB 3REJD 5CHLB 4Z5TB 3AYWC 4H9RA 4XUJD 2FJ7C 3FDDA 1M1AD 2Y2JA 4G92C 3UTAA 2FJ7D 4WNNB 3MNNC 1AOID 3AZHC 3MVDB 2CV5A 3MGSD 2YFWA 4XZQA 4Z5TD 1EQZC 2ZY5A 3VH5A 5B31B 3X1UC 1P3OB 3LELB 4NFTA 3X1UD 3A1KA 3VH6T 3MVDD 3AZGC 1P3BC 5B31C 4H9QA 4YM6B 1P3BD 1KX3A 2NQBC 5DNMA 5B31D 3C1BA 3AV2C 1P3OD 3LELD 5B2JB 1P3IB 3AZKC 4YM6C 3X1SA 3O62C 2ZY4A 5BS7A 4YM6D 4WU8A 4J8XA 3O62D 1M19B 3VH5T 5B2JD 3REHB 2CV5B 3A1IA 3AZFA 2YFWB 3KWQA 3B6GB 4EO5B 3UTAC 4ZUXA 3C1CB 3AZNA 2CV5C 4XZQC 5DNNA 3REHD 2CV5D 1S32A 5AV9B 3B6GD 4NE3A 4M6BA 5DNMB 3AZLA 3AV1A 4JJNB 3NQJA 1ULYA 2G5HC 1U35A 4LD9A 1KX3C 5BO0B 5DNMC 5AV9D 3C1BC 3KUYB 1TZYB 5C3IB 5DNMD 4NE6A 4JJND 4YS3B 5BT1C 3X1SC 1ID3A 2Y2QA 3AZFB 5BS7C 4WU8C 5AVCA 4J8XC 2IO5C 2F8NA 2JE5A 3KUYD 1TZYD 4KGCB 5CP6B 3AZFC 4YS3D 3KWQC 5B32G 1WWSA 4Z66A 4QLCA 3AZFD 3AN2A 2PYOB 4ZUXC 5B24A 1BFMA 4H9NA 3AZNC 4KGCD 5CPIB 5B40A 5DNNC 5CP6D 3AZND 5JA4A 4DRAA 1P3LA 1S32C 3B6FB 3EPKA 1S32D 5B2IA 3AZLC 3AV1C 2PYOD 3W98B 3RELB 3AV1D 1U35C 4LD9C 5JRGB 5AY8B 3B6FD 3X1TA 1ID3B 5BNXB 2F8NB 3LZ0A 3W98D 3W96B 3RELD 1ID3C 4UPKA 3WTPB 5AY8D 5GSUA 5JRGD 5E5AA 5AVCC 1ID3D 3AN2B 3LZ1B 2HUEC 4XUJA 2F8ND 2Y2HA 4KUDB 1M1AA 3R45B 2W8SA 4Z66C 4QLCC 3W96D 4ZBJB 4CSRB 1AOIA 2HIOA 3AN2C 3WTPD 3MGSA 4Z5TA 1P3MB 3AN2D 3LZ1D 1B6WA 1KX5B 4KUDD 3AZMB 5B40C 1P3LC 4WNNA 3LJAA 2FFFB 1P3PA 3X1TB 4HGAC 3MVDA 5B2IC 3W99B 3UTBB 4DQYB 1KX5D 3WKJA 5B2ID 1TAFB 2VQRA 3X1TC 1P3OA 2XD5A 3LELA 5AVBB 3X1TD 3WAAB 3UTBD 2NZDB 3W97B 4UUZA 1P34B 5GSUC 5GXQA 3B0DC 3AFAB 5E5AC 2JSSA 2HIOB 5B2JA 1P3IA 5GSUD 1KX4A 4XUJC 1M1AC 3WAAD 1A7WA 5GT3B 2NZDD 2Y2GA 1P34D 1AOIC 2HIOC 3AZEB 3WTPE 3LJAB 3MGSC 1M19A 1B67A 4Z5TC 1P3PB 2HIOD 4J8WB 3REHA 5AV6B 3V9RB 5AV5B 3B6GA 3WKJB 5GT3D 1HQ3B 3LJAC 5AV8B 1P3PC 1F1EA 3MVDC 3C1CA 3LJAD 5GT0A 1P3PD 3WKJC 3P5JB 4CAYB 3REKB 5AV9A 3B0BA 3WKJD 1WWIA 4UUZB 1P3OC 3LELC 1HQ3D 5GXQB 4JJNA 1KX4B 3B0CW 3KXBA 5BO0A 3REKD 5GXQC 3KUYA 1TZYA 5B2JC 1KX4C 1P3IC 5GXQD 4YS3A 4H9PB 2F8NH 1KX4D 1P3ID 3WA9B 1BH9B 1M19C 4KGCA 5CP6A 3REHC 2Y2PA 5GT0B 5F99B 1M19D 3B6GC 4EO5C 3WA9D 2PYOA 4G91B 1BH8B 3C1CC 5GT0C 1F66B 5CPIA 3C1CD 3B6FA 5GT0D 5F99D 5AV9C 2Y2IA 4G91C 3KXBB 3W98A 4JJNC 5B33A 3RELA 3EPLA 1F66D 3KXBC 5AY8A 5JRGA 3TU4B 1H3OB 1W2EA 5CPJB 3KXBD 5BNXA 1TZYC 5C3IC 3KUYC 5B1LB 4YS3C 5CPKB 3W96A 4WU9B 2BYMB 2F2AC 3WTPA 3TU4D 3NQUB 5CPJD 4R8PB 3EPHA 3LZ1A 2AROB 1M18B 4KGCC 5B1LD 5CP6C 4KUDA 4AWLB 3R45A 3AZIB 4WU9D 5CPKD 4CSRA 4DRBA 4J8UB 2PYOC 2RVQC 4R8PD 1P3MA 1KX5A 4AWLC 2AROD 1M18D 3MGRB 2RVQD 5CPIC 5B33B 3AZMA 3B6FC 5CPID 3X1VB 3W99A 4J8UD 3W98C 3UTBA 5B33C 3RELC 1TAFA 1P3KB 5B0YB 3A6NB 5AY8C 5JRGC 5B33D 2XD1A 5AVBA 3X1VD 4X23A 3WAAA 5G49B 3W96C 2NZDA 3W97A 5B1MB 5B31G 1P34A 1P3KD 3A6ND 3WTPC 2ZY2A 3AFAA 4WZSB 3LZ1C 2BYKA 4KUDC 5GT3A 1P3FA 4ZBJC 5B1MD 4E45A 3AZEA 1P3MC 5KDMB 4J8WA 1KX5C 5AV6A 2LY8A 3V9RA 5AV5A 5B0ZB 3AZMC 1P3MD 4Z2MH 1HQ3A 3AZMD 5AV8A 3H0MC 1JFIB 3W99C 3MGPB 3UTBC 3W99D 4CAYA 4X23B 3REKA 2DQNC 3AL0C 5AVBC 3VH6W 3WAAC 4X23C 3MGPD 5AVBD 2BYKB 3UT9B 2NZDC 3W97C 1P34C 4X23D 3EPJA 5B32B 1P3FB 3AFAC 3W97D 3AZJA 1R4VA 3AFAD 4H9PA 5GT3C 1P3FC 3EG5B 3H0LC 3WA9A 1ZLAA 1P3FD 5B32D 3AZEC 3REJB 1BH9A 4J8WC 3AZED 2RIQA 3VH5W 5AV6C 5F99A 5AV5C 3AYWB 3VH6A 4J8WD 2FJ7B 5AV6D 1HQ3C 3IP4C 5AV5D 5AV8C 2ZM5A 4G92B 1BH8A 3MNNB 5AV8D 3AZHB 1F66A 2YFVA 4KHAA 3REKC 3AYWD 2G5IC 3KSYA 1EQZB 3X1UB 1P3AA 2Y2MA 1N1JB 5BNVB 3REIA 3MNND 3AZJB 5FUGB 3AZHD 3AZGB 1P3BB 3TU4A 1H3OA 5CPJA 2DF4C 2NQBB 1EQZD 1ZLAB 5B1LA 3AZJC 3AV2B 5CPKA 4WU9A 3AZKB 2BYMA 3AZJD 3AZGD 3WA9C 3NQUA 1ZLAC 3O62B 4R8PA 2NQBD 2F8NG 2AROA 1M18A 1ZLAD 4H9OB 3AV2D 3AZIA 5F99C 2YFVB 4KHAB 3AZKD 4H9RB 4J8UA 2L5AA 3UTAB 1P3AB 1F66C 3MGRA 3REIB 4XZQB 1KU5A 3X1VA 1P3AC 3UTAD 3REIC 1HTAA 1P3AD 1P3KA 2CWEA 5B0YA 3A6NA 3B0CT 4J8VA 3REID 3TU4C 4WV4B 4XZQD 4H9QB 1P3GA 1Q9CA 5CPJC 1KX3B 2F8NK 5B1LC 3C1BB 5G49A 5CPKC 4WU9C 5B1MA 2UWXA 3X1SB 4R8PC 4WU8B 1KX3D 4J8XB 2IO5B 2AROC 1M18C 3C1BD 3AZIC 2Y2NA 3KWQB 3AZID 4J8UC 5BT1D 3X1SD 4H9SA 2Y2KA 5KDMA 4ZUXB 4WU8D 4J8XD 3MGQA 3MGRC 3AZNB 5B0ZA 3MGRD 5DNNB 4J8VB 1P3GB 3KWQD 3X1VC 1S32B 1JFIA 3MGPA 3AZLB 4ZUXD 3AV1B 1P3KC 3NQJB 5B0YC 3A6NC 4J8VC 1P3GC 2J8PA 1U35B 4LD9B 5B0YD 5DNND 4J8VD 1P3GD 1T3UA 3KFUG 3UT9A 3AZLD 5B1MC 5B32A 4E44A 1U35D 4NE5A 4LD9D 5AVCB 2HUEB 3MGQB 3H0RC 4Z66B 4QLCB 3REJA 4H9SC 5AVCD 1Z2CB 2Y2OA 5B24B 3MGQC 4H9NB 3AYWA 5B0ZC 2FJ7A 3MGQD 5B40B 1P3LB 5JA4B 5B0ZD 4Z66D 4QLCD 3MNNA 5B24C 3MGPC 4HGAB 3AZHA 5B2IB 5B24D 4Z2MG 1PZRA
chains in the Genus database with same CATH topology
1EQZA 3X1UA 5B40D 2ZY3A 1P3LD 4WJ3C 1N1JA 5BNVA 5FUGA 3UT9C 3AZGA 1P3BA 3LZ0B 5B31A 5B32C 3UT9D 2NQBA 2JCHA 2Y2LA 5GSUB 3B0DB 3AV2A 5E5AB 3F6TA 3LZ0C 3AZKA 4XUJB 4YM6A 3LZ0D 1M1AB 3O62A 3REJC 2BG1A 1AOIB 4H9OA 5E5AD 3MGSB 3REJD 5CHLB 4Z5TB 3AYWC 4H9RA 4XUJD 2FJ7C 3FDDA 1M1AD 2Y2JA 4G92C 3UTAA 2FJ7D 4WNNB 3MNNC 1AOID 3AZHC 3MVDB 2CV5A 3MGSD 2YFWA 4XZQA 4Z5TD 1EQZC 2ZY5A 3VH5A 5B31B 3X1UC 1P3OB 3LELB 4NFTA 3X1UD 3A1KA 3VH6T 3MVDD 3AZGC 1P3BC 5B31C 4H9QA 4YM6B 1P3BD 1KX3A 2NQBC 5DNMA 5B31D 3C1BA 3AV2C 1P3OD 3LELD 5B2JB 1P3IB 3AZKC 4YM6C 3X1SA 3O62C 2ZY4A 5BS7A 4YM6D 4WU8A 4J8XA 3O62D 1M19B 3VH5T 5B2JD 3REHB 2CV5B 3A1IA 3AZFA 2YFWB 3KWQA 3B6GB 4EO5B 3UTAC 4ZUXA 3C1CB 3AZNA 2CV5C 4XZQC 5DNNA 3REHD 2CV5D 1S32A 5AV9B 3B6GD 4NE3A 4M6BA 5DNMB 3AZLA 3AV1A 4JJNB 3NQJA 1ULYA 2G5HC 1U35A 4LD9A 1KX3C 5BO0B 5DNMC 5AV9D 3C1BC 3KUYB 1TZYB 5C3IB 5DNMD 4NE6A 4JJND 4YS3B 5BT1C 3X1SC 1ID3A 2Y2QA 3AZFB 5BS7C 4WU8C 5AVCA 4J8XC 2IO5C 2F8NA 2JE5A 3KUYD 1TZYD 4KGCB 5CP6B 3AZFC 4YS3D 3KWQC 5B32G 1WWSA 4Z66A 4QLCA 3AZFD 3AN2A 2PYOB 4ZUXC 5B24A 1BFMA 4H9NA 3AZNC 4KGCD 5CPIB 5B40A 5DNNC 5CP6D 3AZND 5JA4A 4DRAA 1P3LA 1S32C 3B6FB 3EPKA 1S32D 5B2IA 3AZLC 3AV1C 2PYOD 3W98B 3RELB 3AV1D 1U35C 4LD9C 5JRGB 5AY8B 3B6FD 3X1TA 1ID3B 5BNXB 2F8NB 3LZ0A 3W98D 3W96B 3RELD 1ID3C 4UPKA 3WTPB 5AY8D 5GSUA 5JRGD 5E5AA 5AVCC 1ID3D 3AN2B 3LZ1B 2HUEC 4XUJA 2F8ND 2Y2HA 4KUDB 1M1AA 3R45B 2W8SA 4Z66C 4QLCC 3W96D 4ZBJB 4CSRB 1AOIA 2HIOA 3AN2C 3WTPD 3MGSA 4Z5TA 1P3MB 3AN2D 3LZ1D 1B6WA 1KX5B 4KUDD 3AZMB 5B40C 1P3LC 4WNNA 3LJAA 2FFFB 1P3PA 3X1TB 4HGAC 3MVDA 5B2IC 3W99B 3UTBB 4DQYB 1KX5D 3WKJA 5B2ID 1TAFB 2VQRA 3X1TC 1P3OA 2XD5A 3LELA 5AVBB 3X1TD 3WAAB 3UTBD 2NZDB 3W97B 4UUZA 1P34B 5GSUC 5GXQA 3B0DC 3AFAB 5E5AC 2JSSA 2HIOB 5B2JA 1P3IA 5GSUD 1KX4A 4XUJC 1M1AC 3WAAD 1A7WA 5GT3B 2NZDD 2Y2GA 1P34D 1AOIC 2HIOC 3AZEB 3WTPE 3LJAB 3MGSC 1M19A 1B67A 4Z5TC 1P3PB 2HIOD 4J8WB 3REHA 5AV6B 3V9RB 5AV5B 3B6GA 3WKJB 5GT3D 1HQ3B 3LJAC 5AV8B 1P3PC 1F1EA 3MVDC 3C1CA 3LJAD 5GT0A 1P3PD 3WKJC 3P5JB 4CAYB 3REKB 5AV9A 3B0BA 3WKJD 1WWIA 4UUZB 1P3OC 3LELC 1HQ3D 5GXQB 4JJNA 1KX4B 3B0CW 3KXBA 5BO0A 3REKD 5GXQC 3KUYA 1TZYA 5B2JC 1KX4C 1P3IC 5GXQD 4YS3A 4H9PB 2F8NH 1KX4D 1P3ID 3WA9B 1BH9B 1M19C 4KGCA 5CP6A 3REHC 2Y2PA 5GT0B 5F99B 1M19D 3B6GC 4EO5C 3WA9D 2PYOA 4G91B 1BH8B 3C1CC 5GT0C 1F66B 5CPIA 3C1CD 3B6FA 5GT0D 5F99D 5AV9C 2Y2IA 4G91C 3KXBB 3W98A 4JJNC 5B33A 3RELA 3EPLA 1F66D 3KXBC 5AY8A 5JRGA 3TU4B 1H3OB 1W2EA 5CPJB 3KXBD 5BNXA 1TZYC 5C3IC 3KUYC 5B1LB 4YS3C 5CPKB 3W96A 4WU9B 2BYMB 2F2AC 3WTPA 3TU4D 3NQUB 5CPJD 4R8PB 3EPHA 3LZ1A 2AROB 1M18B 4KGCC 5B1LD 5CP6C 4KUDA 4AWLB 3R45A 3AZIB 4WU9D 5CPKD 4CSRA 4DRBA 4J8UB 2PYOC 2RVQC 4R8PD 1P3MA 1KX5A 4AWLC 2AROD 1M18D 3MGRB 2RVQD 5CPIC 5B33B 3AZMA 3B6FC 5CPID 3X1VB 3W99A 4J8UD 3W98C 3UTBA 5B33C 3RELC 1TAFA 1P3KB 5B0YB 3A6NB 5AY8C 5JRGC 5B33D 2XD1A 5AVBA 3X1VD 4X23A 3WAAA 5G49B 3W96C 2NZDA 3W97A 5B1MB 5B31G 1P34A 1P3KD 3A6ND 3WTPC 2ZY2A 3AFAA 4WZSB 3LZ1C 2BYKA 4KUDC 5GT3A 1P3FA 4ZBJC 5B1MD 4E45A 3AZEA 1P3MC 5KDMB 4J8WA 1KX5C 5AV6A 2LY8A 3V9RA 5AV5A 5B0ZB 3AZMC 1P3MD 4Z2MH 1HQ3A 3AZMD 5AV8A 3H0MC 1JFIB 3W99C 3MGPB 3UTBC 3W99D 4CAYA 4X23B 3REKA 2DQNC 3AL0C 5AVBC 3VH6W 3WAAC 4X23C 3MGPD 5AVBD 2BYKB 3UT9B 2NZDC 3W97C 1P34C 4X23D 3EPJA 5B32B 1P3FB 3AFAC 3W97D 3AZJA 1R4VA 3AFAD 4H9PA 5GT3C 1P3FC 3EG5B 3H0LC 3WA9A 1ZLAA 1P3FD 5B32D 3AZEC 3REJB 1BH9A 4J8WC 3AZED 2RIQA 3VH5W 5AV6C 5F99A 5AV5C 3AYWB 3VH6A 4J8WD 2FJ7B 5AV6D 1HQ3C 3IP4C 5AV5D 5AV8C 2ZM5A 4G92B 1BH8A 3MNNB 5AV8D 3AZHB 1F66A 2YFVA 4KHAA 3REKC 3AYWD 2G5IC 3KSYA 1EQZB 3X1UB 1P3AA 2Y2MA 1N1JB 5BNVB 3REIA 3MNND 3AZJB 5FUGB 3AZHD 3AZGB 1P3BB 3TU4A 1H3OA 5CPJA 2DF4C 2NQBB 1EQZD 1ZLAB 5B1LA 3AZJC 3AV2B 5CPKA 4WU9A 3AZKB 2BYMA 3AZJD 3AZGD 3WA9C 3NQUA 1ZLAC 3O62B 4R8PA 2NQBD 2F8NG 2AROA 1M18A 1ZLAD 4H9OB 3AV2D 3AZIA 5F99C 2YFVB 4KHAB 3AZKD 4H9RB 4J8UA 2L5AA 3UTAB 1P3AB 1F66C 3MGRA 3REIB 4XZQB 1KU5A 3X1VA 1P3AC 3UTAD 3REIC 1HTAA 1P3AD 1P3KA 2CWEA 5B0YA 3A6NA 3B0CT 4J8VA 3REID 3TU4C 4WV4B 4XZQD 4H9QB 1P3GA 1Q9CA 5CPJC 1KX3B 2F8NK 5B1LC 3C1BB 5G49A 5CPKC 4WU9C 5B1MA 2UWXA 3X1SB 4R8PC 4WU8B 1KX3D 4J8XB 2IO5B 2AROC 1M18C 3C1BD 3AZIC 2Y2NA 3KWQB 3AZID 4J8UC 5BT1D 3X1SD 4H9SA 2Y2KA 5KDMA 4ZUXB 4WU8D 4J8XD 3MGQA 3MGRC 3AZNB 5B0ZA 3MGRD 5DNNB 4J8VB 1P3GB 3KWQD 3X1VC 1S32B 1JFIA 3MGPA 3AZLB 4ZUXD 3AV1B 1P3KC 3NQJB 5B0YC 3A6NC 4J8VC 1P3GC 2J8PA 1U35B 4LD9B 5B0YD 5DNND 4J8VD 1P3GD 1T3UA 3KFUG 3UT9A 3AZLD 5B1MC 5B32A 4E44A 1U35D 4NE5A 4LD9D 5AVCB 2HUEB 3MGQB 3H0RC 4Z66B 4QLCB 3REJA 4H9SC 5AVCD 1Z2CB 2Y2OA 5B24B 3MGQC 4H9NB 3AYWA 5B0ZC 2FJ7A 3MGQD 5B40B 1P3LB 5JA4B 5B0ZD 4Z66D 4QLCD 3MNNA 5B24C 3MGPC 4HGAB 3AZHA 5B2IB 5B24D 4Z2MG 1PZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ A;  3X1U A;  5B40 D;  1P3L D;  1N1J A;  5BNV A;  5FUG A;  3UT9 C;  3AZG A;  1P3B A;  3LZ0 B;  5B31 A;  5B32 C;  3UT9 D;  2NQB A;  5GSU B;  3B0D B;  3AV2 A;  5E5A B;  3LZ0 C;  3AZK A;  4XUJ B;  4YM6 A;  3LZ0 D;  1M1A B;  3O62 A;  3REJ C;  1AOI B;  4H9O A;  5E5A D;  3MGS B;  3REJ D;  5CHL B;  4Z5T B;  3AYW C;  4H9R A;  4XUJ D;  2FJ7 C;  1M1A D;  4G92 C;  3UTA A;  2FJ7 D;  4WNN B;  3MNN C;  1AOI D;  3AZH C;  3MVD B;  2CV5 A;  3MGS D;  2YFW A;  4XZQ A;  4Z5T D;  1EQZ C;  5B31 B;  3VH5 A;  3X1U C;  1P3O B;  3LEL B;  4NFT A;  3X1U D;  3VH6 T;  3MVD D;  3AZG C;  1P3B C;  5B31 C;  4H9Q A;  4YM6 B;  1P3B D;  1KX3 A;  2NQB C;  5DNM A;  5B31 D;  3C1B A;  3AV2 C;  1P3O D;  3LEL D;  5B2J B;  1P3I B;  3AZK C;  4YM6 C;  3X1S A;  3O62 C;  4YM6 D;  5BS7 A;  4WU8 A;  4J8X A;  3O62 D;  1M19 B;  3VH5 T;  5B2J D;  3REH B;  2CV5 B;  3AZF A;  2YFW B;  3KWQ A;  3B6G B;  4EO5 B;  3UTA C;  4ZUX A;  3C1C B;  3AZN A;  2CV5 C;  4XZQ C;  5DNN A;  3REH D;  2CV5 D;  1S32 A;  5AV9 B;  3B6G D;  4NE3 A;  4M6B A;  5DNM B;  3AZL A;  3AV1 A;  4JJN B;  3NQJ A;  1ULY A;  1U35 A;  4LD9 A;  1KX3 C;  5BO0 B;  5DNM C;  5AV9 D;  3C1B C;  3KUY B;  1TZY B;  5C3I B;  5DNM D;  4NE6 A;  4JJN D;  4YS3 B;  5BT1 C;  3X1S C;  1ID3 A;  3AZF B;  5BS7 C;  4WU8 C;  5AVC A;  4J8X C;  2IO5 C;  2F8N A;  3KUY D;  1TZY D;  4KGC B;  5CP6 B;  3AZF C;  4YS3 D;  3KWQ C;  5B32 G;  1WWS A;  4Z66 A;  4QLC A;  3AZF D;  3AN2 A;  2PYO B;  4ZUX C;  5B24 A;  1BFM A;  4H9N A;  3AZN C;  4KGC D;  5CPI B;  5B40 A;  5DNN C;  5CP6 D;  3AZN D;  5JA4 A;  4DRA A;  1P3L A;  1S32 C;  3B6F B;  1S32 D;  5B2I A;  3AZL C;  3AV1 C;  2PYO D;  3W98 B;  3REL B;  3AV1 D;  1U35 C;  4LD9 C;  5JRG B;  5AY8 B;  3B6F D;  3X1T A;  1ID3 B;  5BNX B;  2F8N B;  3LZ0 A;  3W98 D;  3W96 B;  3REL D;  1ID3 C;  3WTP B;  5AY8 D;  5GSU A;  5JRG D;  5E5A A;  5AVC C;  1ID3 D;  3AN2 B;  3LZ1 B;  2HUE C;  4XUJ A;  2F8N D;  4KUD B;  1M1A A;  3R45 B;  4Z66 C;  3W96 D;  4QLC C;  4ZBJ B;  4CSR B;  1AOI A;  2HIO A;  3AN2 C;  3WTP D;  3MGS A;  4Z5T A;  1P3M B;  3AN2 D;  3LZ1 D;  1B6W A;  1KX5 B;  4KUD D;  3AZM B;  5B40 C;  1P3L C;  4WNN A;  3LJA A;  1P3P A;  3X1T B;  4HGA C;  3MVD A;  5B2I C;  3W99 B;  3UTB B;  1KX5 D;  3WKJ A;  5B2I D;  1TAF B;  3X1T C;  1P3O A;  3LEL A;  5AVB B;  3X1T D;  3WAA B;  3UTB D;  2NZD B;  3W97 B;  4UUZ A;  1P34 B;  5GSU C;  5GXQ A;  3B0D C;  3AFA B;  5E5A C;  2JSS A;  2HIO B;  5B2J A;  1P3I A;  5GSU D;  1KX4 A;  4XUJ C;  1M1A C;  3WAA D;  1A7W A;  5GT3 B;  2NZD D;  1P34 D;  1AOI C;  2HIO C;  3AZE B;  3WTP E;  3LJA B;  3MGS C;  1M19 A;  1B67 A;  4Z5T C;  1P3P B;  2HIO D;  4J8W B;  3REH A;  5AV6 B;  5AV5 B;  3V9R B;  3B6G A;  3WKJ B;  5GT3 D;  1HQ3 B;  3LJA C;  5AV8 B;  1P3P C;  1F1E A;  3MVD C;  3C1C A;  3LJA D;  5GT0 A;  1P3P D;  3WKJ C;  4CAY B;  3REK B;  5AV9 A;  3B0B A;  3WKJ D;  1WWI A;  4UUZ B;  1P3O C;  3LEL C;  1HQ3 D;  5GXQ B;  4JJN A;  1KX4 B;  3B0C W;  3KXB A;  5BO0 A;  3REK D;  5GXQ C;  3KUY A;  1TZY A;  5B2J C;  1KX4 C;  1P3I C;  5GXQ D;  4YS3 A;  4H9P B;  2F8N H;  1KX4 D;  1P3I D;  3WA9 B;  1BH9 B;  1M19 C;  4KGC A;  5CP6 A;  3REH C;  5GT0 B;  5F99 B;  1M19 D;  3B6G C;  4EO5 C;  3WA9 D;  2PYO A;  4G91 B;  1BH8 B;  3C1C C;  5GT0 C;  1F66 B;  5CPI A;  3C1C D;  3B6F A;  5GT0 D;  5F99 D;  5AV9 C;  4G91 C;  3KXB B;  3W98 A;  4JJN C;  5B33 A;  3REL A;  1F66 D;  3KXB C;  5AY8 A;  5JRG A;  3TU4 B;  1H3O B;  5CPJ B;  3KXB D;  5BNX A;  1TZY C;  5C3I C;  3KUY C;  5B1L B;  4YS3 C;  5CPK B;  3W96 A;  4WU9 B;  2BYM B;  3WTP A;  3TU4 D;  3NQU B;  5CPJ D;  4R8P B;  3LZ1 A;  2ARO B;  1M18 B;  4KGC C;  5B1L D;  5CP6 C;  4KUD A;  4AWL B;  3R45 A;  3AZI B;  4WU9 D;  5CPK D;  4CSR A;  4DRB A;  4J8U B;  2PYO C;  2RVQ C;  4R8P D;  1P3M A;  1KX5 A;  4AWL C;  2ARO D;  1M18 D;  3MGR B;  2RVQ D;  5CPI C;  5B33 B;  3AZM A;  3B6F C;  5CPI D;  3X1V B;  3W99 A;  4J8U D;  3W98 C;  3UTB A;  5B33 C;  3REL C;  1TAF A;  1P3K B;  5B0Y B;  3A6N B;  5AY8 C;  5JRG C;  5B33 D;  5AVB A;  3X1V D;  4X23 A;  3WAA A;  5G49 B;  3W96 C;  2NZD A;  3W97 A;  5B1M B;  5B31 G;  1P34 A;  1P3K D;  3A6N D;  3WTP C;  3AFA A;  4WZS B;  3LZ1 C;  2BYK A;  4KUD C;  5GT3 A;  1P3F A;  4ZBJ C;  5B1M D;  4E45 A;  3AZE A;  1P3M C;  5KDM B;  4J8W A;  1KX5 C;  5AV6 A;  2LY8 A;  3V9R A;  5AV5 A;  5B0Z B;  3AZM C;  1P3M D;  4Z2M H;  1HQ3 A;  3AZM D;  5AV8 A;  1JFI B;  3W99 C;  3MGP B;  3UTB C;  3W99 D;  4CAY A;  4X23 B;  3REK A;  5AVB C;  3VH6 W;  3WAA C;  4X23 C;  3MGP D;  5AVB D;  2BYK B;  3UT9 B;  2NZD C;  3W97 C;  1P34 C;  4X23 D;  1P3F B;  5B32 B;  3AFA C;  3W97 D;  3AZJ A;  1R4V A;  3AFA D;  4H9P A;  5GT3 C;  1P3F C;  3WA9 A;  1ZLA A;  1P3F D;  5B32 D;  3AZE C;  3REJ B;  1BH9 A;  4J8W C;  3AZE D;  5AV6 C;  3VH5 W;  5F99 A;  5AV5 C;  3AYW B;  3VH6 A;  4J8W D;  2FJ7 B;  5AV6 D;  1HQ3 C;  5AV5 D;  5AV8 C;  4G92 B;  1BH8 A;  3MNN B;  5AV8 D;  3AZH B;  1F66 A;  2YFV A;  4KHA A;  3REK C;  3AYW D;  3KSY A;  1EQZ B;  3X1U B;  1P3A A;  1N1J B;  5BNV B;  3REI A;  3MNN D;  3AZJ B;  5FUG B;  3AZH D;  3AZG B;  1P3B B;  3TU4 A;  1H3O A;  5CPJ A;  2NQB B;  1EQZ D;  1ZLA B;  5B1L A;  3AZJ C;  3AV2 B;  5CPK A;  4WU9 A;  3AZK B;  2BYM A;  3AZJ D;  3AZG D;  3WA9 C;  3NQU A;  1ZLA C;  3O62 B;  4R8P A;  2NQB D;  2F8N G;  2ARO A;  1M18 A;  1ZLA D;  4H9O B;  3AV2 D;  3AZI A;  5F99 C;  2YFV B;  4KHA B;  3AZK D;  4H9R B;  4J8U A;  2L5A A;  3UTA B;  1P3A B;  1F66 C;  3MGR A;  3REI B;  4XZQ B;  1KU5 A;  3X1V A;  1P3A C;  3UTA D;  3REI C;  1HTA A;  1P3A D;  1P3K A;  2CWE A;  5B0Y A;  3A6N A;  3B0C T;  4J8V A;  3REI D;  3TU4 C;  4WV4 B;  4XZQ D;  4H9Q B;  1P3G A;  1Q9C A;  5CPJ C;  1KX3 B;  2F8N K;  5B1L C;  3C1B B;  5G49 A;  5CPK C;  4WU9 C;  5B1M A;  3X1S B;  4R8P C;  4WU8 B;  1KX3 D;  4J8X B;  2IO5 B;  2ARO C;  1M18 C;  3C1B D;  3AZI C;  3KWQ B;  3AZI D;  4J8U C;  5BT1 D;  3X1S D;  4H9S A;  5KDM A;  4ZUX B;  4WU8 D;  4J8X D;  3MGQ A;  3MGR C;  3AZN B;  5B0Z A;  3MGR D;  5DNN B;  4J8V B;  1P3G B;  3KWQ D;  3X1V C;  1S32 B;  1JFI A;  3MGP A;  3AZL B;  4ZUX D;  3AV1 B;  1P3K C;  3NQJ B;  5B0Y C;  3A6N C;  4J8V C;  1P3G C;  1U35 B;  4LD9 B;  5B0Y D;  5DNN D;  4J8V D;  1P3G D;  3UT9 A;  3AZL D;  5B1M C;  5B32 A;  4E44 A;  1U35 D;  4NE5 A;  4LD9 D;  5AVC B;  2HUE B;  3MGQ B;  4Z66 B;  4QLC B;  3REJ A;  4H9S C;  5B24 B;  5AVC D;  3MGQ C;  4H9N B;  3AYW A;  5B0Z C;  2FJ7 A;  3MGQ D;  5B40 B;  1P3L B;  5B0Z D;  5JA4 B;  4Z66 D;  4QLC D;  3MNN A;  5B24 C;  3MGP C;  4HGA B;  3AZH A;  5B2I B;  5B24 D;  4Z2M G; 
#chains in the Genus database with same CATH topology
 1EQZ A;  3X1U A;  5B40 D;  2ZY3 A;  1P3L D;  4WJ3 C;  1N1J A;  5BNV A;  5FUG A;  3UT9 C;  3AZG A;  1P3B A;  3LZ0 B;  5B31 A;  5B32 C;  3UT9 D;  2NQB A;  2JCH A;  2Y2L A;  5GSU B;  3B0D B;  3AV2 A;  5E5A B;  3F6T A;  3LZ0 C;  3AZK A;  4XUJ B;  4YM6 A;  3LZ0 D;  1M1A B;  3O62 A;  3REJ C;  2BG1 A;  1AOI B;  4H9O A;  5E5A D;  3MGS B;  3REJ D;  5CHL B;  4Z5T B;  3AYW C;  4H9R A;  4XUJ D;  2FJ7 C;  3FDD A;  1M1A D;  2Y2J A;  4G92 C;  3UTA A;  2FJ7 D;  4WNN B;  3MNN C;  1AOI D;  3AZH C;  3MVD B;  2CV5 A;  3MGS D;  2YFW A;  4XZQ A;  4Z5T D;  1EQZ C;  2ZY5 A;  3VH5 A;  5B31 B;  3X1U C;  1P3O B;  3LEL B;  4NFT A;  3X1U D;  3A1K A;  3VH6 T;  3MVD D;  3AZG C;  1P3B C;  5B31 C;  4H9Q A;  4YM6 B;  1P3B D;  1KX3 A;  2NQB C;  5DNM A;  5B31 D;  3C1B A;  3AV2 C;  1P3O D;  3LEL D;  5B2J B;  1P3I B;  3AZK C;  4YM6 C;  3X1S A;  3O62 C;  2ZY4 A;  5BS7 A;  4YM6 D;  4WU8 A;  4J8X A;  3O62 D;  1M19 B;  3VH5 T;  5B2J D;  3REH B;  2CV5 B;  3A1I A;  3AZF A;  2YFW B;  3KWQ A;  3B6G B;  4EO5 B;  3UTA C;  4ZUX A;  3C1C B;  3AZN A;  2CV5 C;  4XZQ C;  5DNN A;  3REH D;  2CV5 D;  1S32 A;  5AV9 B;  3B6G D;  4NE3 A;  4M6B A;  5DNM B;  3AZL A;  3AV1 A;  4JJN B;  3NQJ A;  1ULY A;  2G5H C;  1U35 A;  4LD9 A;  1KX3 C;  5BO0 B;  5DNM C;  5AV9 D;  3C1B C;  3KUY B;  1TZY B;  5C3I B;  5DNM D;  4NE6 A;  4JJN D;  4YS3 B;  5BT1 C;  3X1S C;  1ID3 A;  2Y2Q A;  3AZF B;  5BS7 C;  4WU8 C;  5AVC A;  4J8X C;  2IO5 C;  2F8N A;  2JE5 A;  3KUY D;  1TZY D;  4KGC B;  5CP6 B;  3AZF C;  4YS3 D;  3KWQ C;  5B32 G;  1WWS A;  4Z66 A;  4QLC A;  3AZF D;  3AN2 A;  2PYO B;  4ZUX C;  5B24 A;  1BFM A;  4H9N A;  3AZN C;  4KGC D;  5CPI B;  5B40 A;  5DNN C;  5CP6 D;  3AZN D;  5JA4 A;  4DRA A;  1P3L A;  1S32 C;  3B6F B;  3EPK A;  1S32 D;  5B2I A;  3AZL C;  3AV1 C;  2PYO D;  3W98 B;  3REL B;  3AV1 D;  1U35 C;  4LD9 C;  5JRG B;  5AY8 B;  3B6F D;  3X1T A;  1ID3 B;  5BNX B;  2F8N B;  3LZ0 A;  3W98 D;  3W96 B;  3REL D;  1ID3 C;  4UPK A;  3WTP B;  5AY8 D;  5GSU A;  5JRG D;  5E5A A;  5AVC C;  1ID3 D;  3AN2 B;  3LZ1 B;  2HUE C;  4XUJ A;  2F8N D;  2Y2H A;  4KUD B;  1M1A A;  3R45 B;  2W8S A;  4Z66 C;  4QLC C;  3W96 D;  4ZBJ B;  4CSR B;  1AOI A;  2HIO A;  3AN2 C;  3WTP D;  3MGS A;  4Z5T A;  1P3M B;  3AN2 D;  3LZ1 D;  1B6W A;  1KX5 B;  4KUD D;  3AZM B;  5B40 C;  1P3L C;  4WNN A;  3LJA A;  2FFF B;  1P3P A;  3X1T B;  4HGA C;  3MVD A;  5B2I C;  3W99 B;  3UTB B;  4DQY B;  1KX5 D;  3WKJ A;  5B2I D;  1TAF B;  2VQR A;  3X1T C;  1P3O A;  2XD5 A;  3LEL A;  5AVB B;  3X1T D;  3WAA B;  3UTB D;  2NZD B;  3W97 B;  4UUZ A;  1P34 B;  5GSU C;  5GXQ A;  3B0D C;  3AFA B;  5E5A C;  2JSS A;  2HIO B;  5B2J A;  1P3I A;  5GSU D;  1KX4 A;  4XUJ C;  1M1A C;  3WAA D;  1A7W A;  5GT3 B;  2NZD D;  2Y2G A;  1P34 D;  1AOI C;  2HIO C;  3AZE B;  3WTP E;  3LJA B;  3MGS C;  1M19 A;  1B67 A;  4Z5T C;  1P3P B;  2HIO D;  4J8W B;  3REH A;  5AV6 B;  3V9R B;  5AV5 B;  3B6G A;  3WKJ B;  5GT3 D;  1HQ3 B;  3LJA C;  5AV8 B;  1P3P C;  1F1E A;  3MVD C;  3C1C A;  3LJA D;  5GT0 A;  1P3P D;  3WKJ C;  3P5J B;  4CAY B;  3REK B;  5AV9 A;  3B0B A;  3WKJ D;  1WWI A;  4UUZ B;  1P3O C;  3LEL C;  1HQ3 D;  5GXQ B;  4JJN A;  1KX4 B;  3B0C W;  3KXB A;  5BO0 A;  3REK D;  5GXQ C;  3KUY A;  1TZY A;  5B2J C;  1KX4 C;  1P3I C;  5GXQ D;  4YS3 A;  4H9P B;  2F8N H;  1KX4 D;  1P3I D;  3WA9 B;  1BH9 B;  1M19 C;  4KGC A;  5CP6 A;  3REH C;  2Y2P A;  5GT0 B;  5F99 B;  1M19 D;  3B6G C;  4EO5 C;  3WA9 D;  2PYO A;  4G91 B;  1BH8 B;  3C1C C;  5GT0 C;  1F66 B;  5CPI A;  3C1C D;  3B6F A;  5GT0 D;  5F99 D;  5AV9 C;  2Y2I A;  4G91 C;  3KXB B;  3W98 A;  4JJN C;  5B33 A;  3REL A;  3EPL A;  1F66 D;  3KXB C;  5AY8 A;  5JRG A;  3TU4 B;  1H3O B;  1W2E A;  5CPJ B;  3KXB D;  5BNX A;  1TZY C;  5C3I C;  3KUY C;  5B1L B;  4YS3 C;  5CPK B;  3W96 A;  4WU9 B;  2BYM B;  2F2A C;  3WTP A;  3TU4 D;  3NQU B;  5CPJ D;  4R8P B;  3EPH A;  3LZ1 A;  2ARO B;  1M18 B;  4KGC C;  5B1L D;  5CP6 C;  4KUD A;  4AWL B;  3R45 A;  3AZI B;  4WU9 D;  5CPK D;  4CSR A;  4DRB A;  4J8U B;  2PYO C;  2RVQ C;  4R8P D;  1P3M A;  1KX5 A;  4AWL C;  2ARO D;  1M18 D;  3MGR B;  2RVQ D;  5CPI C;  5B33 B;  3AZM A;  3B6F C;  5CPI D;  3X1V B;  3W99 A;  4J8U D;  3W98 C;  3UTB A;  5B33 C;  3REL C;  1TAF A;  1P3K B;  5B0Y B;  3A6N B;  5AY8 C;  5JRG C;  5B33 D;  2XD1 A;  5AVB A;  3X1V D;  4X23 A;  3WAA A;  5G49 B;  3W96 C;  2NZD A;  3W97 A;  5B1M B;  5B31 G;  1P34 A;  1P3K D;  3A6N D;  3WTP C;  2ZY2 A;  3AFA A;  4WZS B;  3LZ1 C;  2BYK A;  4KUD C;  5GT3 A;  1P3F A;  4ZBJ C;  5B1M D;  4E45 A;  3AZE A;  1P3M C;  5KDM B;  4J8W A;  1KX5 C;  5AV6 A;  2LY8 A;  3V9R A;  5AV5 A;  5B0Z B;  3AZM C;  1P3M D;  4Z2M H;  1HQ3 A;  3AZM D;  5AV8 A;  3H0M C;  1JFI B;  3W99 C;  3MGP B;  3UTB C;  3W99 D;  4CAY A;  4X23 B;  3REK A;  2DQN C;  3AL0 C;  5AVB C;  3VH6 W;  3WAA C;  4X23 C;  3MGP D;  5AVB D;  2BYK B;  3UT9 B;  2NZD C;  3W97 C;  1P34 C;  4X23 D;  3EPJ A;  5B32 B;  1P3F B;  3AFA C;  3W97 D;  3AZJ A;  1R4V A;  3AFA D;  4H9P A;  5GT3 C;  1P3F C;  3EG5 B;  3H0L C;  3WA9 A;  1ZLA A;  1P3F D;  5B32 D;  3AZE C;  3REJ B;  1BH9 A;  4J8W C;  3AZE D;  2RIQ A;  3VH5 W;  5AV6 C;  5F99 A;  5AV5 C;  3AYW B;  3VH6 A;  4J8W D;  2FJ7 B;  5AV6 D;  1HQ3 C;  3IP4 C;  5AV5 D;  5AV8 C;  2ZM5 A;  4G92 B;  1BH8 A;  3MNN B;  5AV8 D;  3AZH B;  1F66 A;  2YFV A;  4KHA A;  3REK C;  3AYW D;  2G5I C;  3KSY A;  1EQZ B;  3X1U B;  1P3A A;  2Y2M A;  1N1J B;  5BNV B;  3REI A;  3MNN D;  3AZJ B;  5FUG B;  3AZH D;  3AZG B;  1P3B B;  3TU4 A;  1H3O A;  5CPJ A;  2DF4 C;  2NQB B;  1EQZ D;  1ZLA B;  5B1L A;  3AZJ C;  3AV2 B;  5CPK A;  4WU9 A;  3AZK B;  2BYM A;  3AZJ D;  3AZG D;  3WA9 C;  3NQU A;  1ZLA C;  3O62 B;  4R8P A;  2NQB D;  2F8N G;  2ARO A;  1M18 A;  1ZLA D;  4H9O B;  3AV2 D;  3AZI A;  5F99 C;  2YFV B;  4KHA B;  3AZK D;  4H9R B;  4J8U A;  2L5A A;  3UTA B;  1P3A B;  1F66 C;  3MGR A;  3REI B;  4XZQ B;  1KU5 A;  3X1V A;  1P3A C;  3UTA D;  3REI C;  1HTA A;  1P3A D;  1P3K A;  2CWE A;  5B0Y A;  3A6N A;  3B0C T;  4J8V A;  3REI D;  3TU4 C;  4WV4 B;  4XZQ D;  4H9Q B;  1P3G A;  1Q9C A;  5CPJ C;  1KX3 B;  2F8N K;  5B1L C;  3C1B B;  5G49 A;  5CPK C;  4WU9 C;  5B1M A;  2UWX A;  3X1S B;  4R8P C;  4WU8 B;  1KX3 D;  4J8X B;  2IO5 B;  2ARO C;  1M18 C;  3C1B D;  3AZI C;  2Y2N A;  3KWQ B;  3AZI D;  4J8U C;  5BT1 D;  3X1S D;  4H9S A;  2Y2K A;  5KDM A;  4ZUX B;  4WU8 D;  4J8X D;  3MGQ A;  3MGR C;  3AZN B;  5B0Z A;  3MGR D;  5DNN B;  4J8V B;  1P3G B;  3KWQ D;  3X1V C;  1S32 B;  1JFI A;  3MGP A;  3AZL B;  4ZUX D;  3AV1 B;  1P3K C;  3NQJ B;  5B0Y C;  3A6N C;  4J8V C;  1P3G C;  2J8P A;  1U35 B;  4LD9 B;  5B0Y D;  5DNN D;  4J8V D;  1P3G D;  1T3U A;  3KFU G;  3UT9 A;  3AZL D;  5B1M C;  5B32 A;  4E44 A;  1U35 D;  4NE5 A;  4LD9 D;  5AVC B;  2HUE B;  3MGQ B;  3H0R C;  4Z66 B;  4QLC B;  3REJ A;  4H9S C;  5AVC D;  1Z2C B;  2Y2O A;  5B24 B;  3MGQ C;  4H9N B;  3AYW A;  5B0Z C;  2FJ7 A;  3MGQ D;  5B40 B;  1P3L B;  5JA4 B;  5B0Z D;  4Z66 D;  4QLC D;  3MNN A;  5B24 C;  3MGP C;  4HGA B;  3AZH A;  5B2I B;  5B24 D;  4Z2M G;  1PZR A; 
#chains in the Genus database with same CATH homology
 1EQZ A;  3X1U A;  5B40 D;  2ZY3 A;  1P3L D;  4WJ3 C;  1N1J A;  5BNV A;  5FUG A;  3UT9 C;  3AZG A;  1P3B A;  3LZ0 B;  5B31 A;  5B32 C;  3UT9 D;  2NQB A;  2JCH A;  2Y2L A;  5GSU B;  3B0D B;  3AV2 A;  5E5A B;  3F6T A;  3LZ0 C;  3AZK A;  4XUJ B;  4YM6 A;  3LZ0 D;  1M1A B;  3O62 A;  3REJ C;  2BG1 A;  1AOI B;  4H9O A;  5E5A D;  3MGS B;  3REJ D;  5CHL B;  4Z5T B;  3AYW C;  4H9R A;  4XUJ D;  2FJ7 C;  3FDD A;  1M1A D;  2Y2J A;  4G92 C;  3UTA A;  2FJ7 D;  4WNN B;  3MNN C;  1AOI D;  3AZH C;  3MVD B;  2CV5 A;  3MGS D;  2YFW A;  4XZQ A;  4Z5T D;  1EQZ C;  2ZY5 A;  3VH5 A;  5B31 B;  3X1U C;  1P3O B;  3LEL B;  4NFT A;  3X1U D;  3A1K A;  3VH6 T;  3MVD D;  3AZG C;  1P3B C;  5B31 C;  4H9Q A;  4YM6 B;  1P3B D;  1KX3 A;  2NQB C;  5DNM A;  5B31 D;  3C1B A;  3AV2 C;  1P3O D;  3LEL D;  5B2J B;  1P3I B;  3AZK C;  4YM6 C;  3X1S A;  3O62 C;  2ZY4 A;  5BS7 A;  4YM6 D;  4WU8 A;  4J8X A;  3O62 D;  1M19 B;  3VH5 T;  5B2J D;  3REH B;  2CV5 B;  3A1I A;  3AZF A;  2YFW B;  3KWQ A;  3B6G B;  4EO5 B;  3UTA C;  4ZUX A;  3C1C B;  3AZN A;  2CV5 C;  4XZQ C;  5DNN A;  3REH D;  2CV5 D;  1S32 A;  5AV9 B;  3B6G D;  4NE3 A;  4M6B A;  5DNM B;  3AZL A;  3AV1 A;  4JJN B;  3NQJ A;  1ULY A;  2G5H C;  1U35 A;  4LD9 A;  1KX3 C;  5BO0 B;  5DNM C;  5AV9 D;  3C1B C;  3KUY B;  1TZY B;  5C3I B;  5DNM D;  4NE6 A;  4JJN D;  4YS3 B;  5BT1 C;  3X1S C;  1ID3 A;  2Y2Q A;  3AZF B;  5BS7 C;  4WU8 C;  5AVC A;  4J8X C;  2IO5 C;  2F8N A;  2JE5 A;  3KUY D;  1TZY D;  4KGC B;  5CP6 B;  3AZF C;  4YS3 D;  3KWQ C;  5B32 G;  1WWS A;  4Z66 A;  4QLC A;  3AZF D;  3AN2 A;  2PYO B;  4ZUX C;  5B24 A;  1BFM A;  4H9N A;  3AZN C;  4KGC D;  5CPI B;  5B40 A;  5DNN C;  5CP6 D;  3AZN D;  5JA4 A;  4DRA A;  1P3L A;  1S32 C;  3B6F B;  3EPK A;  1S32 D;  5B2I A;  3AZL C;  3AV1 C;  2PYO D;  3W98 B;  3REL B;  3AV1 D;  1U35 C;  4LD9 C;  5JRG B;  5AY8 B;  3B6F D;  3X1T A;  1ID3 B;  5BNX B;  2F8N B;  3LZ0 A;  3W98 D;  3W96 B;  3REL D;  1ID3 C;  4UPK A;  3WTP B;  5AY8 D;  5GSU A;  5JRG D;  5E5A A;  5AVC C;  1ID3 D;  3AN2 B;  3LZ1 B;  2HUE C;  4XUJ A;  2F8N D;  2Y2H A;  4KUD B;  1M1A A;  3R45 B;  2W8S A;  4Z66 C;  4QLC C;  3W96 D;  4ZBJ B;  4CSR B;  1AOI A;  2HIO A;  3AN2 C;  3WTP D;  3MGS A;  4Z5T A;  1P3M B;  3AN2 D;  3LZ1 D;  1B6W A;  1KX5 B;  4KUD D;  3AZM B;  5B40 C;  1P3L C;  4WNN A;  3LJA A;  2FFF B;  1P3P A;  3X1T B;  4HGA C;  3MVD A;  5B2I C;  3W99 B;  3UTB B;  4DQY B;  1KX5 D;  3WKJ A;  5B2I D;  1TAF B;  2VQR A;  3X1T C;  1P3O A;  2XD5 A;  3LEL A;  5AVB B;  3X1T D;  3WAA B;  3UTB D;  2NZD B;  3W97 B;  4UUZ A;  1P34 B;  5GSU C;  5GXQ A;  3B0D C;  3AFA B;  5E5A C;  2JSS A;  2HIO B;  5B2J A;  1P3I A;  5GSU D;  1KX4 A;  4XUJ C;  1M1A C;  3WAA D;  1A7W A;  5GT3 B;  2NZD D;  2Y2G A;  1P34 D;  1AOI C;  2HIO C;  3AZE B;  3WTP E;  3LJA B;  3MGS C;  1M19 A;  1B67 A;  4Z5T C;  1P3P B;  2HIO D;  4J8W B;  3REH A;  5AV6 B;  3V9R B;  5AV5 B;  3B6G A;  3WKJ B;  5GT3 D;  1HQ3 B;  3LJA C;  5AV8 B;  1P3P C;  1F1E A;  3MVD C;  3C1C A;  3LJA D;  5GT0 A;  1P3P D;  3WKJ C;  3P5J B;  4CAY B;  3REK B;  5AV9 A;  3B0B A;  3WKJ D;  1WWI A;  4UUZ B;  1P3O C;  3LEL C;  1HQ3 D;  5GXQ B;  4JJN A;  1KX4 B;  3B0C W;  3KXB A;  5BO0 A;  3REK D;  5GXQ C;  3KUY A;  1TZY A;  5B2J C;  1KX4 C;  1P3I C;  5GXQ D;  4YS3 A;  4H9P B;  2F8N H;  1KX4 D;  1P3I D;  3WA9 B;  1BH9 B;  1M19 C;  4KGC A;  5CP6 A;  3REH C;  2Y2P A;  5GT0 B;  5F99 B;  1M19 D;  3B6G C;  4EO5 C;  3WA9 D;  2PYO A;  4G91 B;  1BH8 B;  3C1C C;  5GT0 C;  1F66 B;  5CPI A;  3C1C D;  3B6F A;  5GT0 D;  5F99 D;  5AV9 C;  2Y2I A;  4G91 C;  3KXB B;  3W98 A;  4JJN C;  5B33 A;  3REL A;  3EPL A;  1F66 D;  3KXB C;  5AY8 A;  5JRG A;  3TU4 B;  1H3O B;  1W2E A;  5CPJ B;  3KXB D;  5BNX A;  1TZY C;  5C3I C;  3KUY C;  5B1L B;  4YS3 C;  5CPK B;  3W96 A;  4WU9 B;  2BYM B;  2F2A C;  3WTP A;  3TU4 D;  3NQU B;  5CPJ D;  4R8P B;  3EPH A;  3LZ1 A;  2ARO B;  1M18 B;  4KGC C;  5B1L D;  5CP6 C;  4KUD A;  4AWL B;  3R45 A;  3AZI B;  4WU9 D;  5CPK D;  4CSR A;  4DRB A;  4J8U B;  2PYO C;  2RVQ C;  4R8P D;  1P3M A;  1KX5 A;  4AWL C;  2ARO D;  1M18 D;  3MGR B;  2RVQ D;  5CPI C;  5B33 B;  3AZM A;  3B6F C;  5CPI D;  3X1V B;  3W99 A;  4J8U D;  3W98 C;  3UTB A;  5B33 C;  3REL C;  1TAF A;  1P3K B;  5B0Y B;  3A6N B;  5AY8 C;  5JRG C;  5B33 D;  2XD1 A;  5AVB A;  3X1V D;  4X23 A;  3WAA A;  5G49 B;  3W96 C;  2NZD A;  3W97 A;  5B1M B;  5B31 G;  1P34 A;  1P3K D;  3A6N D;  3WTP C;  2ZY2 A;  3AFA A;  4WZS B;  3LZ1 C;  2BYK A;  4KUD C;  5GT3 A;  1P3F A;  4ZBJ C;  5B1M D;  4E45 A;  3AZE A;  1P3M C;  5KDM B;  4J8W A;  1KX5 C;  5AV6 A;  2LY8 A;  3V9R A;  5AV5 A;  5B0Z B;  3AZM C;  1P3M D;  4Z2M H;  1HQ3 A;  3AZM D;  5AV8 A;  3H0M C;  1JFI B;  3W99 C;  3MGP B;  3UTB C;  3W99 D;  4CAY A;  4X23 B;  3REK A;  2DQN C;  3AL0 C;  5AVB C;  3VH6 W;  3WAA C;  4X23 C;  3MGP D;  5AVB D;  2BYK B;  3UT9 B;  2NZD C;  3W97 C;  1P34 C;  4X23 D;  3EPJ A;  5B32 B;  1P3F B;  3AFA C;  3W97 D;  3AZJ A;  1R4V A;  3AFA D;  4H9P A;  5GT3 C;  1P3F C;  3EG5 B;  3H0L C;  3WA9 A;  1ZLA A;  1P3F D;  5B32 D;  3AZE C;  3REJ B;  1BH9 A;  4J8W C;  3AZE D;  2RIQ A;  3VH5 W;  5AV6 C;  5F99 A;  5AV5 C;  3AYW B;  3VH6 A;  4J8W D;  2FJ7 B;  5AV6 D;  1HQ3 C;  3IP4 C;  5AV5 D;  5AV8 C;  2ZM5 A;  4G92 B;  1BH8 A;  3MNN B;  5AV8 D;  3AZH B;  1F66 A;  2YFV A;  4KHA A;  3REK C;  3AYW D;  2G5I C;  3KSY A;  1EQZ B;  3X1U B;  1P3A A;  2Y2M A;  1N1J B;  5BNV B;  3REI A;  3MNN D;  3AZJ B;  5FUG B;  3AZH D;  3AZG B;  1P3B B;  3TU4 A;  1H3O A;  5CPJ A;  2DF4 C;  2NQB B;  1EQZ D;  1ZLA B;  5B1L A;  3AZJ C;  3AV2 B;  5CPK A;  4WU9 A;  3AZK B;  2BYM A;  3AZJ D;  3AZG D;  3WA9 C;  3NQU A;  1ZLA C;  3O62 B;  4R8P A;  2NQB D;  2F8N G;  2ARO A;  1M18 A;  1ZLA D;  4H9O B;  3AV2 D;  3AZI A;  5F99 C;  2YFV B;  4KHA B;  3AZK D;  4H9R B;  4J8U A;  2L5A A;  3UTA B;  1P3A B;  1F66 C;  3MGR A;  3REI B;  4XZQ B;  1KU5 A;  3X1V A;  1P3A C;  3UTA D;  3REI C;  1HTA A;  1P3A D;  1P3K A;  2CWE A;  5B0Y A;  3A6N A;  3B0C T;  4J8V A;  3REI D;  3TU4 C;  4WV4 B;  4XZQ D;  4H9Q B;  1P3G A;  1Q9C A;  5CPJ C;  1KX3 B;  2F8N K;  5B1L C;  3C1B B;  5G49 A;  5CPK C;  4WU9 C;  5B1M A;  2UWX A;  3X1S B;  4R8P C;  4WU8 B;  1KX3 D;  4J8X B;  2IO5 B;  2ARO C;  1M18 C;  3C1B D;  3AZI C;  2Y2N A;  3KWQ B;  3AZI D;  4J8U C;  5BT1 D;  3X1S D;  4H9S A;  2Y2K A;  5KDM A;  4ZUX B;  4WU8 D;  4J8X D;  3MGQ A;  3MGR C;  3AZN B;  5B0Z A;  3MGR D;  5DNN B;  4J8V B;  1P3G B;  3KWQ D;  3X1V C;  1S32 B;  1JFI A;  3MGP A;  3AZL B;  4ZUX D;  3AV1 B;  1P3K C;  3NQJ B;  5B0Y C;  3A6N C;  4J8V C;  1P3G C;  2J8P A;  1U35 B;  4LD9 B;  5B0Y D;  5DNN D;  4J8V D;  1P3G D;  1T3U A;  3KFU G;  3UT9 A;  3AZL D;  5B1M C;  5B32 A;  4E44 A;  1U35 D;  4NE5 A;  4LD9 D;  5AVC B;  2HUE B;  3MGQ B;  3H0R C;  4Z66 B;  4QLC B;  3REJ A;  4H9S C;  5AVC D;  1Z2C B;  2Y2O A;  5B24 B;  3MGQ C;  4H9N B;  3AYW A;  5B0Z C;  2FJ7 A;  3MGQ D;  5B40 B;  1P3L B;  5JA4 B;  5B0Z D;  4Z66 D;  4QLC D;  3MNN A;  5B24 C;  3MGP C;  4HGA B;  3AZH A;  5B2I B;  5B24 D;  4Z2M G;  1PZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...