3VH5A

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
100
structure length
100
Chain Sequence
AGGEQRELLIQRLRAAVHYTTGALAQDVAEDKGVLFSKQTVAAISEITFRQAENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 42
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh5A00
3AV1B 3VH6A 1F66A 1TZYC 3WKJC 3REJD 1ID3D 3AZIA 1KX3B 1EQZA 5CPKB 3KWQD 3WTPD 4X23A 4ZUXC 1P3LA 3MGPC 5CPJD 3REHA 5B0YD 1KX5B 3MVDC 2HUEB 5B1LB 3C1CD 3AZGC 5C3IC 3REKA 4ZBJC 3AFAC 3UTAD 3KUYA 3X1UD 3TU4A 3B6GB 5B2ID 5GXQA 4J8UC 4LD9C 5B1MD 4WZSB 1N1JB 3AZED 3O62D 4YS3C 4XZQA 2LY8A 1M1AB 1P3OA 4R8PA 3KXBA 3UT9A 2F8NH 3AZKC 3WAAC 3RELA 5AVCB 4CAYB 4WU8C 4J8WB 4QLCB 5B24C 1HQ3B 3MGRA 5GSUD 3AZHA 3KSYA 4UUZA 1F66B 4KUDA 5DNMD 3C1BA 5B31A 3AZIB 1EQZB 1R4VA 3W98A 4J8VC 4X23B 3MGSD 1P3LB 2IO5B 3V9RA 5AY8D 3REHB 1BFMA 5B32C 3NQJA 1TZYA 3WKJA 5JRGD 3W96D 1ULYA 3KUYB 1KU5A 1Q9CA 3TU4B 3LELC 5GXQB 3X1SC 4ZUXA 3B6FD 3MGPA 4J8XC 4AWLC 1M19C 4XZQB 3AZGA 5AV9D 1KX4D 1P3OB 4R8PB 3KXBB 3UT9B 3AFAA 5BT1D 3REID 3RELB 4J8UA 4G91B 4Z5TD 1P3BD 4LD9A 4JJND 4Z2MG 3MGQD 4YS3A 5B33D 5DNMC 3MGRB 5BS7C 2NQBD 1P3MC 4UUZB 3AZLC 3LZ1D 3AZKA 1A7WA 3WAAA 4KUDB 4WU8A 3C1BB 5B31B 4DRBA 4G92C 3AYWC 5B24A 3W98B 3UTBC 1P3AD 3V9RB 3W97D 3W99C 3LZ0C 3NQJB 1TZYB 3WKJB 3B6FC 4Z66D 1P3KD 3AZJD 5F99D 2AROC 5AV9C 5CP6D 3AZMD 4H9PA 2CWEA 4HGAC 5B2JC 1S32C 4J8VA 4ZUXB 3MGPB 1P34D 4WU9D 3LJAC 5B32A 3WA9D 3MVDB 3AZGB 5C3IB 5B40C 1P3IC 4E45A 4H9QA 4ZBJB 3AFAB 2CV5C 3A6ND 5AVBC 3X1TD 5GT3C 3LELA 1ZLAC 4J8UB 3X1SA 4EO5B 5AV8D 5AVCA 4LD9B 3LZ1C 4NE6A 4J8XA 4YM6C 5JA4B 1P3GD 1M19A 5AV6D 4YS3B 2FJ7C 5B0ZC 1AOID 4XUJD 3AZKB 3WAAB 3MNNC 2JSSA 5DNND 4WU8B 2NZDC 5B24B 1BH9A 1WWSA 5DNMA 5GT0C 5BS7A 3AV2D 1P3MA 3AZNC 3AZLA 5CPID 5E5AD 1M18C 2PYOD 3X1VD 3WA9C 3AV1D 3AN2D 4H9PB 3AYWA 4DRAA 4J8VB 3UTBA 4EO5C 5BNXA 3W99A 5B32B 2F8ND 3LZ0A 1KX3D 5G49A 1TAFB 5CPKD 3AZEB 3B6FA 4H9QB 1P3FC 2AROA 5AV9A 1AOIC 1KX5D 3LELB 1U35C 4KGCC 5B1LD 5B2JA 3X1SB 1S32A 4J8XB 4NE3A 4AWLB 3LJAA 1M19B 3NQUA 3REJC 5B40A 1P3IA 1ID3C 2CV5A 5AVBA 2BYMA 3KWQC 3WTPC 5GT3A 1M1AD 1ZLAA 5CPJC 3LZ1A 5B0YC 1BH8A 5CPIC 4YM6A 3C1CC 1BH9B 2FJ7A 5DNMB 5B0ZA 3UTAC 3AN2C 3X1UC 4J8WD 3VH5T 1P3MB 5B2IC 3AZLB 2RVQD 1JFIA 4QLCD 3MNNA 5B1MC 3AZEC 1HQ3D 3O62C 4G92B 2NZDA 3AYWB 2F8NG 1F66D 3UTBB 5GT0A 5BNXB 5FUGA 3W99B 5AV5D 3LZ0B 3AZID 3AZNA 5G49B 1EQZD 3B6FB 3MVDA 1M18A 4H9SC 4X23D 2AROB 1P3LD 3WA9A 5AV9B 1KX4B 4HGAB 5GSUC 5B2JB 3REKD 1S32B 3KUYD 3AZFD 3LJAB 3NQUB 3TU4D 5JA4A 5B40B 1P3IB 5GXQD 1H3OA 3X1VB 2CV5B 1P3FA 5AVBB 2BYMB 5GT3B 4XZQD 3MGSC 1U35A 4KGCA 1ZLAB 1P3OD 4R8PD 3KXBD 5AY8C 3LZ1B 1HTAA 1BH8B 4YM6B 1B6WA 2FJ7B 5JRGC 3W96C 5B0ZB 3REJA 1ID3A 1JFIB 3B0DC 3KWQA 3MNNB 3WTPA 3MGRD 5CPJA 5AV5C 1P3PD 5B0YA 5CPIA 3R45A 3AZHD 4H9RA 3C1CA 1KX4C 2NZDB 1F1EA 4KGCD 5GT0B 5BT1C 3UTAA 3AN2A 4KUDD 5FUGB 3REIC 3X1UA 3C1BD 5B31D 5B2IA 3AZNB 1M18B 3W98D 4Z5TC 1TAFA 3AZFC 5B1MA 3AZEA 1P3BC 4KHAA 2F8NA 3WA9B 3O62A 4JJNC 3MGQC 5B33C 1TZYD 3WKJD 2NQBC 5BO0A 4NE5A 1H3OB 4H9SA 4ZUXD 1P3FB 3MGPD 3VH5A 2BYKA 1AOIB 1U35B 4KGCB 3AZGD 5GSUA 1P3AC 3W97C 2HIOD 3AFAD 4H9OA 4Z66C 1P3KC 3REJB 3AZJC 1P3PC 5F99C 4J8UD 4NFTA 1ID3B 5CP6C 4LD9D 3AZMC 3KWQB 3B0CW 3WTPB 3MGSA 5CPJB 1P34C 4WNNA 4WU9C 5AY8A 5B0YB 5CPIB 3R45B 4H9RB 3C1CB 5B31G 5JRGA 3W96A 3AZKD 3WAAD 3UTAB 3AN2B 3A6NC 3X1UB 4WU8D 3B0CT 5B2IB 3X1TC 5B24D 5AV8C 4WV4B 5B1MB 2F8NB 4KHAB 5AV5A 3O62B 1P3GC 5AV6C 4CSRA 1KX4A 3REIA 4XUJC 5BO0B 5DNNC 2HIOC 3B6GD 4J8VD 4Z5TA 1P3BA 3AZFA 2YFWB 2BYKB 4JJNA 3MGQA 5B32D 5B33A 5GSUB 3WTPE 3VH5W 3AV2C 2NQBA 4H9OB 5CHLB 5E5AC 2PYOC 3LELD 3X1VC 3X1SD 4M6BA 3AV1C 5AVCD 4J8XD 1M19D 3MGSB 1P3AA 4WNNB 3W97A 5AY8B 1KX3C 5CPKC 5JRGB 4Z66A 3W96B 1P3KA 3AZJA 1P3PA 5F99A 1B67A 5CP6A 2F8NK 3AZMA 1KX5C 2HUEC 5B1LC 3B0DB 3VH6W 5AV5B 2L5AA 4WU9A 1P34A 4Z2MH 4CSRB 3B6GC 1P3MD 3AZLD 3REHD 3REIB 3A6NA 5BNVA 5KDMA 3REKB 3VH6T 3X1TA 1M1AC 3AYWD 5B32G 5AV8A 4Z5TB 1P3BB 3AZFB 3UTBD 4H9NA 4JJNB 1P3GA 3MGQB 3W99D 5AV6A 5B33B 3LZ0D 5AVCC 1AOIA 2NQBB 4J8WC 1WWIA 3UT9D 2AROD 2RVQC 4XUJA 4QLCC 5DNNA 2HIOA 1HQ3C 2YFVA 5B2JD 1S32D 3RELD 1F66C 3LJAD 1P3AB 5B40D 3AV2A 1P3ID 3W97B 3AZIC 2CV5D 1EQZC 4Z66B 5E5AA 5AVBD 1P3KB 2PYOA 5GT3D 4X23C 3AZJB 5F99B 3X1VA 2IO5C 1P3LC 1P3PB 3AZHB 3AV1A 5CP6B 1ZLAD 3REHC 3AZMB 4YM6D 3REKC 2FJ7D 5B0ZD 4WU9B 1P34B 3KUYC 3TU4C 1KX3A 5CPKA 5GXQC 3MNND 3A6NB 5BNVB 5KDMB 3X1TB 1KX5A 4XZQC 2NZDD 5B1LA 1P3OC 5AV8B 4R8PC 3KXBC 3UT9C 5GT0D 4H9NB 2YFWA 1P3GB 5AV6B 3B6GA 3AZND 3RELC 3MVDD 1M18D 4G91C 1N1JA 4XUJB 5DNNB 1M1AA 2HIOB 3B0BA 3MGRC 2YFVB 3AZHC 4E44A 4KUDC 4CAYA 4YS3D 3AV2B 3C1BC 5B31C 4J8WA 1P3FD 4QLCA 5E5AB 3W98C 2PYOB 1U35D 1HQ3A
chains in the Genus database with same CATH superfamily
3AV1B 3VH6A 1F66A 1TZYC 3WKJC 3REJD 1ID3D 3AZIA 1KX3B 1EQZA 5CPKB 3KWQD 3WTPD 4X23A 4ZUXC 1P3LA 3MGPC 5CPJD 3REHA 5B0YD 1KX5B 3MVDC 2HUEB 5B1LB 3C1CD 3AZGC 5C3IC 3REKA 4ZBJC 3AFAC 3UTAD 3KUYA 3X1UD 3TU4A 3B6GB 2JCHA 5B2ID 5GXQA 4J8UC 4LD9C 5B1MD 4WZSB 1N1JB 3AZED 3O62D 4YS3C 4XZQA 2LY8A 1M1AB 1P3OA 4R8PA 3KXBA 3UT9A 2F8NH 2J8PA 3AZKC 3WAAC 3RELA 5AVCB 4CAYB 4WU8C 4J8WB 4QLCB 5B24C 3AL0C 1HQ3B 3MGRA 5GSUD 3AZHA 3KSYA 4UUZA 1F66B 4KUDA 3EPHA 5DNMD 3C1BA 5B31A 3AZIB 1EQZB 2Y2PA 1R4VA 3W98A 4J8VC 4X23B 3MGSD 1P3LB 2IO5B 1T3UA 2Y2LA 3V9RA 5AY8D 3REHB 1BFMA 5B32C 3NQJA 1TZYA 3WKJA 3F6TA 5JRGD 3W96D 1ULYA 3KUYB 1KU5A 1Q9CA 3TU4B 3LELC 5GXQB 3X1SC 4ZUXA 3B6FD 3MGPA 4J8XC 2BG1A 4AWLC 1M19C 4XZQB 3AZGA 5AV9D 1KX4D 1P3OB 4R8PB 3KXBB 3UT9B 1Z2CB 3AFAA 5BT1D 3REID 3RELB 4J8UA 4G91B 4Z5TD 1P3BD 4LD9A 4JJND 4Z2MG 3MGQD 4YS3A 5B33D 5DNMC 3MGRB 3IP4C 5BS7C 2NQBD 1P3MC 4UUZB 3AZLC 3LZ1D 2Y2OA 1A7WA 3FDDA 3AZKA 3WAAA 4KUDB 4WU8A 3C1BB 5B31B 4DRBA 4G92C 3AYWC 5B24A 3W98B 1W2EA 3UTBC 1P3AD 3V9RB 3W97D 3W99C 3LZ0C 3NQJB 1TZYB 3WKJB 3B6FC 4Z66D 1P3KD 3AZJD 5F99D 2AROC 5AV9C 5CP6D 3AZMD 4H9PA 2CWEA 4HGAC 5B2JC 1S32C 2Y2MA 4J8VA 4ZUXB 3MGPB 1P34D 4WU9D 2F2AC 3LJAC 5B32A 3WA9D 3MVDB 3AZGB 5C3IB 5B40C 1P3IC 4E45A 4H9QA 4ZBJB 3AFAB 2CV5C 3A6ND 2G5HC 5AVBC 3X1TD 5GT3C 2ZY5A 3LELA 1ZLAC 4J8UB 3X1SA 4EO5B 5AV8D 5AVCA 4LD9B 3LZ1C 4NE6A 4J8XA 4YM6C 5JA4B 1P3GD 1M19A 5AV6D 4YS3B 2FJ7C 5B0ZC 1AOID 2UWXA 4XUJD 3AZKB 3WAAB 3MNNC 2JSSA 5DNND 4UPKA 4WU8B 2JE5A 2NZDC 5B24B 1BH9A 1WWSA 5DNMA 2DF4C 5GT0C 5BS7A 3AV2D 1P3MA 3AZNC 3AZLA 3H0RC 5CPID 5E5AD 1M18C 2PYOD 2Y2NA 2ZY2A 3X1VD 3WA9C 3AV1D 3AN2D 4H9PB 3AYWA 4DRAA 4J8VB 3UTBA 4EO5C 5BNXA 3EPLA 3W99A 5B32B 2F8ND 3LZ0A 1KX3D 5G49A 1TAFB 5CPKD 3AZEB 3B6FA 4H9QB 1P3FC 2AROA 5AV9A 1AOIC 1KX5D 3LELB 1U35C 4KGCC 5B1LD 5B2JA 3X1SB 1S32A 4J8XB 4NE3A 4AWLB 3LJAA 1M19B 3NQUA 3REJC 5B40A 1P3IA 1ID3C 2CV5A 5AVBA 2BYMA 3KWQC 3WTPC 5GT3A 1M1AD 1ZLAA 5CPJC 3LZ1A 5B0YC 1BH8A 5CPIC 4YM6A 3C1CC 1BH9B 2FJ7A 5DNMB 5B0ZA 3UTAC 3AN2C 3X1UC 4J8WD 3VH5T 1P3MB 5B2IC 3AZLB 2RVQD 1JFIA 4QLCD 3MNNA 5B1MC 3AZEC 1HQ3D 3O62C 4G92B 2NZDA 3AYWB 2F8NG 1F66D 3UTBB 5GT0A 5BNXB 5FUGA 2RIQA 3W99B 5AV5D 3LZ0B 3AZID 3AZNA 5G49B 1EQZD 3B6FB 3MVDA 1M18A 4H9SC 2Y2IA 4X23D 2AROB 1P3LD 3WA9A 5AV9B 1KX4B 4HGAB 5GSUC 5B2JB 3REKD 1S32B 3KUYD 3AZFD 3LJAB 3NQUB 3TU4D 5JA4A 5B40B 1P3IB 5GXQD 1H3OA 3X1VB 2CV5B 1P3FA 5AVBB 2BYMB 5GT3B 4XZQD 3MGSC 1U35A 4KGCA 2FFFB 1P3OD 1ZLAB 4R8PD 3A1KA 3P5JB 5AY8C 3KXBD 1HTAA 1BH8B 4YM6B 3LZ1B 1B6WA 2FJ7B 5JRGC 3W96C 5B0ZB 3REJA 2ZY4A 1ID3A 1JFIB 3B0DC 3KWQA 3MNNB 3WTPA 3MGRD 5CPJA 5AV5C 1P3PD 3EG5B 5B0YA 5CPIA 3R45A 3AZHD 4H9RA 3C1CA 1KX4C 2NZDB 1F1EA 4KGCD 5GT0B 5BT1C 3UTAA 3AN2A 4KUDD 5FUGB 2XD5A 3X1UA 3C1BD 3REIC 5B31D 5B2IA 3AZNB 1M18B 3W98D 4Z5TC 1TAFA 3AZFC 5B1MA 3AZEA 1P3BC 4KHAA 2F8NA 3WA9B 3O62A 4JJNC 3MGQC 5B33C 1TZYD 3WKJD 2NQBC 5BO0A 4NE5A 1H3OB 4H9SA 4ZUXD 1P3FB 3MGPD 3VH5A 2BYKA 3H0LC 3EPJA 1AOIB 1U35B 4KGCB 3AZGD 5GSUA 1P3AC 3W97C 2HIOD 3AFAD 2Y2GA 2ZM5A 4H9OA 4Z66C 1P3KC 3REJB 3AZJC 1P3PC 5F99C 4J8UD 4NFTA 1ID3B 5CP6C 4LD9D 3AZMC 4WJ3C 3KWQB 3B0CW 3WTPB 3MGSA 5CPJB 1P34C 4WNNA 4WU9C 5AY8A 3A1IA 5B0YB 5CPIB 3R45B 4H9RB 3C1CB 5B31G 5JRGA 3W96A 2Y2HA 3AZKD 3WAAD 3KFUG 3UTAB 3AN2B 3A6NC 3X1UB 4WU8D 3B0CT 5B2IB 3X1TC 2W8SA 5B24D 5AV8C 4WV4B 5B1MB 2F8NB 4KHAB 5AV5A 3O62B 1P3GC 5AV6C 4CSRA 1KX4A 1PZRA 3REIA 4XUJC 5BO0B 5DNNC 2Y2JA 2HIOC 3B6GD 4J8VD 4Z5TA 2VQRA 3AZFA 2YFWB 1P3BA 2BYKB 4JJNA 3MGQA 5B32D 2XD1A 5B33A 5GSUB 2DQNC 3WTPE 3VH5W 3AV2C 2NQBA 4H9OB 5CHLB 5E5AC 2PYOC 3LELD 3X1VC 3X1SD 4M6BA 3AV1C 5AVCD 4J8XD 1M19D 3MGSB 1P3AA 4WNNB 3W97A 5AY8B 1KX3C 5CPKC 5JRGB 4Z66A 3W96B 1P3KA 3AZJA 1P3PA 5F99A 1B67A 5CP6A 2F8NK 3AZMA 1KX5C 2HUEC 5B1LC 3B0DB 2Y2KA 3VH6W 5AV5B 2L5AA 4WU9A 1P34A 4Z2MH 4CSRB 3B6GC 1P3MD 3AZLD 3REHD 3REIB 3A6NA 5BNVA 4DQYB 5KDMA 3REKB 3VH6T 3X1TA 1M1AC 3AYWD 5B32G 5AV8A 4Z5TB 1P3BB 3AZFB 3UTBD 4H9NA 4JJNB 1P3GA 3MGQB 3W99D 5AV6A 5B33B 3LZ0D 5AVCC 1AOIA 2NQBB 4J8WC 1WWIA 3UT9D 2AROD 2G5IC 2RVQC 4XUJA 4QLCC 5DNNA 2HIOA 1HQ3C 2YFVA 5B2JD 3H0MC 3RELD 1S32D 1F66C 3LJAD 1P3AB 5B40D 3AV2A 1P3ID 3W97B 3AZIC 2CV5D 1EQZC 4Z66B 5E5AA 5AVBD 1P3KB 2PYOA 5GT3D 4X23C 3AZJB 5F99B 3X1VA 2IO5C 1P3LC 1P3PB 3AZHB 3AV1A 5CP6B 1ZLAD 3REHC 3AZMB 4YM6D 3REKC 2FJ7D 5B0ZD 4WU9B 1P34B 3KUYC 3TU4C 1KX3A 5CPKA 3EPKA 5GXQC 3MNND 2Y2QA 3A6NB 5BNVB 5KDMB 3X1TB 1KX5A 4XZQC 2NZDD 5B1LA 1P3OC 5AV8B 4R8PC 3KXBC 3UT9C 5GT0D 4H9NB 2YFWA 1P3GB 5AV6B 3B6GA 3AZND 3RELC 3MVDD 1M18D 4G91C 1N1JA 4XUJB 5DNNB 1M1AA 2HIOB 3B0BA 3MGRC 2YFVB 2ZY3A 3AZHC 4E44A 4KUDC 4CAYA 4YS3D 3AV2B 3C1BC 5B31C 4J8WA 1P3FD 4QLCA 5E5AB 3W98C 2PYOB 1U35D 1HQ3A
chains in the Genus database with same CATH topology
3AV1B 3VH6A 1F66A 1TZYC 3WKJC 3REJD 1ID3D 3AZIA 1KX3B 1EQZA 5CPKB 3KWQD 3WTPD 4X23A 4ZUXC 1P3LA 3MGPC 5CPJD 3REHA 5B0YD 1KX5B 3MVDC 2HUEB 5B1LB 3C1CD 3AZGC 5C3IC 3REKA 4ZBJC 3AFAC 3UTAD 3KUYA 3X1UD 3TU4A 3B6GB 2JCHA 5B2ID 5GXQA 4J8UC 4LD9C 5B1MD 4WZSB 1N1JB 3AZED 3O62D 4YS3C 4XZQA 2LY8A 1M1AB 1P3OA 4R8PA 3KXBA 3UT9A 2F8NH 2J8PA 3AZKC 3WAAC 3RELA 5AVCB 4CAYB 4WU8C 4J8WB 4QLCB 5B24C 3AL0C 1HQ3B 3MGRA 5GSUD 3AZHA 3KSYA 4UUZA 1F66B 4KUDA 3EPHA 5DNMD 3C1BA 5B31A 3AZIB 1EQZB 2Y2PA 1R4VA 3W98A 4J8VC 4X23B 3MGSD 1P3LB 2IO5B 1T3UA 2Y2LA 3V9RA 5AY8D 3REHB 1BFMA 5B32C 3NQJA 1TZYA 3WKJA 3F6TA 5JRGD 3W96D 1ULYA 3KUYB 1KU5A 1Q9CA 3TU4B 3LELC 5GXQB 3X1SC 4ZUXA 3B6FD 3MGPA 4J8XC 2BG1A 4AWLC 1M19C 4XZQB 3AZGA 5AV9D 1KX4D 1P3OB 4R8PB 3KXBB 3UT9B 1Z2CB 3AFAA 5BT1D 3REID 3RELB 4J8UA 4G91B 4Z5TD 1P3BD 4LD9A 4JJND 4Z2MG 3MGQD 4YS3A 5B33D 5DNMC 3MGRB 3IP4C 5BS7C 2NQBD 1P3MC 4UUZB 3AZLC 3LZ1D 2Y2OA 1A7WA 3FDDA 3AZKA 3WAAA 4KUDB 4WU8A 3C1BB 5B31B 4DRBA 4G92C 3AYWC 5B24A 3W98B 1W2EA 3UTBC 1P3AD 3V9RB 3W97D 3W99C 3LZ0C 3NQJB 1TZYB 3WKJB 3B6FC 4Z66D 1P3KD 3AZJD 5F99D 2AROC 5AV9C 5CP6D 3AZMD 4H9PA 2CWEA 4HGAC 5B2JC 1S32C 2Y2MA 4J8VA 4ZUXB 3MGPB 1P34D 4WU9D 2F2AC 3LJAC 5B32A 3WA9D 3MVDB 3AZGB 5C3IB 5B40C 1P3IC 4E45A 4H9QA 4ZBJB 3AFAB 2CV5C 3A6ND 2G5HC 5AVBC 3X1TD 5GT3C 2ZY5A 3LELA 1ZLAC 4J8UB 3X1SA 4EO5B 5AV8D 5AVCA 4LD9B 3LZ1C 4NE6A 4J8XA 4YM6C 5JA4B 1P3GD 1M19A 5AV6D 4YS3B 2FJ7C 5B0ZC 1AOID 2UWXA 4XUJD 3AZKB 3WAAB 3MNNC 2JSSA 5DNND 4UPKA 4WU8B 2JE5A 2NZDC 5B24B 1BH9A 1WWSA 5DNMA 2DF4C 5GT0C 5BS7A 3AV2D 1P3MA 3AZNC 3AZLA 3H0RC 5CPID 5E5AD 1M18C 2PYOD 2Y2NA 2ZY2A 3X1VD 3WA9C 3AV1D 3AN2D 4H9PB 3AYWA 4DRAA 4J8VB 3UTBA 4EO5C 5BNXA 3EPLA 3W99A 5B32B 2F8ND 3LZ0A 1KX3D 5G49A 1TAFB 5CPKD 3AZEB 3B6FA 4H9QB 1P3FC 2AROA 5AV9A 1AOIC 1KX5D 3LELB 1U35C 4KGCC 5B1LD 5B2JA 3X1SB 1S32A 4J8XB 4NE3A 4AWLB 3LJAA 1M19B 3NQUA 3REJC 5B40A 1P3IA 1ID3C 2CV5A 5AVBA 2BYMA 3KWQC 3WTPC 5GT3A 1M1AD 1ZLAA 5CPJC 3LZ1A 5B0YC 1BH8A 5CPIC 4YM6A 3C1CC 1BH9B 2FJ7A 5DNMB 5B0ZA 3UTAC 3AN2C 3X1UC 4J8WD 3VH5T 1P3MB 5B2IC 3AZLB 2RVQD 1JFIA 4QLCD 3MNNA 5B1MC 3AZEC 1HQ3D 3O62C 4G92B 2NZDA 3AYWB 2F8NG 1F66D 3UTBB 5GT0A 5BNXB 5FUGA 2RIQA 3W99B 5AV5D 3LZ0B 3AZID 3AZNA 5G49B 1EQZD 3B6FB 3MVDA 1M18A 4H9SC 2Y2IA 4X23D 2AROB 1P3LD 3WA9A 5AV9B 1KX4B 4HGAB 5GSUC 5B2JB 3REKD 1S32B 3KUYD 3AZFD 3LJAB 3NQUB 3TU4D 5JA4A 5B40B 1P3IB 5GXQD 1H3OA 3X1VB 2CV5B 1P3FA 5AVBB 2BYMB 5GT3B 4XZQD 3MGSC 1U35A 4KGCA 2FFFB 1P3OD 1ZLAB 4R8PD 3A1KA 3P5JB 5AY8C 3KXBD 1HTAA 1BH8B 4YM6B 3LZ1B 1B6WA 2FJ7B 5JRGC 3W96C 5B0ZB 3REJA 2ZY4A 1ID3A 1JFIB 3B0DC 3KWQA 3MNNB 3WTPA 3MGRD 5CPJA 5AV5C 1P3PD 3EG5B 5B0YA 5CPIA 3R45A 3AZHD 4H9RA 3C1CA 1KX4C 2NZDB 1F1EA 4KGCD 5GT0B 5BT1C 3UTAA 3AN2A 4KUDD 5FUGB 2XD5A 3X1UA 3C1BD 3REIC 5B31D 5B2IA 3AZNB 1M18B 3W98D 4Z5TC 1TAFA 3AZFC 5B1MA 3AZEA 1P3BC 4KHAA 2F8NA 3WA9B 3O62A 4JJNC 3MGQC 5B33C 1TZYD 3WKJD 2NQBC 5BO0A 4NE5A 1H3OB 4H9SA 4ZUXD 1P3FB 3MGPD 3VH5A 2BYKA 3H0LC 3EPJA 1AOIB 1U35B 4KGCB 3AZGD 5GSUA 1P3AC 3W97C 2HIOD 3AFAD 2Y2GA 2ZM5A 4H9OA 4Z66C 1P3KC 3REJB 3AZJC 1P3PC 5F99C 4J8UD 4NFTA 1ID3B 5CP6C 4LD9D 3AZMC 4WJ3C 3KWQB 3B0CW 3WTPB 3MGSA 5CPJB 1P34C 4WNNA 4WU9C 5AY8A 3A1IA 5B0YB 5CPIB 3R45B 4H9RB 3C1CB 5B31G 5JRGA 3W96A 2Y2HA 3AZKD 3WAAD 3KFUG 3UTAB 3AN2B 3A6NC 3X1UB 4WU8D 3B0CT 5B2IB 3X1TC 2W8SA 5B24D 5AV8C 4WV4B 5B1MB 2F8NB 4KHAB 5AV5A 3O62B 1P3GC 5AV6C 4CSRA 1KX4A 1PZRA 3REIA 4XUJC 5BO0B 5DNNC 2Y2JA 2HIOC 3B6GD 4J8VD 4Z5TA 2VQRA 3AZFA 2YFWB 1P3BA 2BYKB 4JJNA 3MGQA 5B32D 2XD1A 5B33A 5GSUB 2DQNC 3WTPE 3VH5W 3AV2C 2NQBA 4H9OB 5CHLB 5E5AC 2PYOC 3LELD 3X1VC 3X1SD 4M6BA 3AV1C 5AVCD 4J8XD 1M19D 3MGSB 1P3AA 4WNNB 3W97A 5AY8B 1KX3C 5CPKC 5JRGB 4Z66A 3W96B 1P3KA 3AZJA 1P3PA 5F99A 1B67A 5CP6A 2F8NK 3AZMA 1KX5C 2HUEC 5B1LC 3B0DB 2Y2KA 3VH6W 5AV5B 2L5AA 4WU9A 1P34A 4Z2MH 4CSRB 3B6GC 1P3MD 3AZLD 3REHD 3REIB 3A6NA 5BNVA 4DQYB 5KDMA 3REKB 3VH6T 3X1TA 1M1AC 3AYWD 5B32G 5AV8A 4Z5TB 1P3BB 3AZFB 3UTBD 4H9NA 4JJNB 1P3GA 3MGQB 3W99D 5AV6A 5B33B 3LZ0D 5AVCC 1AOIA 2NQBB 4J8WC 1WWIA 3UT9D 2AROD 2G5IC 2RVQC 4XUJA 4QLCC 5DNNA 2HIOA 1HQ3C 2YFVA 5B2JD 3H0MC 3RELD 1S32D 1F66C 3LJAD 1P3AB 5B40D 3AV2A 1P3ID 3W97B 3AZIC 2CV5D 1EQZC 4Z66B 5E5AA 5AVBD 1P3KB 2PYOA 5GT3D 4X23C 3AZJB 5F99B 3X1VA 2IO5C 1P3LC 1P3PB 3AZHB 3AV1A 5CP6B 1ZLAD 3REHC 3AZMB 4YM6D 3REKC 2FJ7D 5B0ZD 4WU9B 1P34B 3KUYC 3TU4C 1KX3A 5CPKA 3EPKA 5GXQC 3MNND 2Y2QA 3A6NB 5BNVB 5KDMB 3X1TB 1KX5A 4XZQC 2NZDD 5B1LA 1P3OC 5AV8B 4R8PC 3KXBC 3UT9C 5GT0D 4H9NB 2YFWA 1P3GB 5AV6B 3B6GA 3AZND 3RELC 3MVDD 1M18D 4G91C 1N1JA 4XUJB 5DNNB 1M1AA 2HIOB 3B0BA 3MGRC 2YFVB 2ZY3A 3AZHC 4E44A 4KUDC 4CAYA 4YS3D 3AV2B 3C1BC 5B31C 4J8WA 1P3FD 4QLCA 5E5AB 3W98C 2PYOB 1U35D 1HQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 B;  3VH6 A;  1F66 A;  1TZY C;  3WKJ C;  3REJ D;  1ID3 D;  3AZI A;  1KX3 B;  1EQZ A;  5CPK B;  3KWQ D;  3WTP D;  4X23 A;  4ZUX C;  1P3L A;  3MGP C;  5CPJ D;  3REH A;  5B0Y D;  1KX5 B;  3MVD C;  2HUE B;  5B1L B;  3C1C D;  3AZG C;  5C3I C;  3REK A;  4ZBJ C;  3AFA C;  3UTA D;  3KUY A;  3X1U D;  3TU4 A;  3B6G B;  5B2I D;  5GXQ A;  4J8U C;  4LD9 C;  5B1M D;  4WZS B;  1N1J B;  3AZE D;  3O62 D;  4YS3 C;  4XZQ A;  2LY8 A;  1M1A B;  1P3O A;  4R8P A;  3KXB A;  3UT9 A;  2F8N H;  3AZK C;  3WAA C;  3REL A;  5AVC B;  4CAY B;  4WU8 C;  4J8W B;  4QLC B;  5B24 C;  1HQ3 B;  3MGR A;  5GSU D;  3AZH A;  3KSY A;  4UUZ A;  1F66 B;  4KUD A;  5DNM D;  3C1B A;  5B31 A;  3AZI B;  1EQZ B;  1R4V A;  3W98 A;  4J8V C;  4X23 B;  3MGS D;  1P3L B;  2IO5 B;  3V9R A;  5AY8 D;  3REH B;  1BFM A;  5B32 C;  3NQJ A;  1TZY A;  3WKJ A;  5JRG D;  3W96 D;  1ULY A;  3KUY B;  1KU5 A;  1Q9C A;  3TU4 B;  3LEL C;  5GXQ B;  3X1S C;  4ZUX A;  3B6F D;  3MGP A;  4J8X C;  4AWL C;  1M19 C;  4XZQ B;  3AZG A;  5AV9 D;  1KX4 D;  1P3O B;  4R8P B;  3KXB B;  3UT9 B;  3AFA A;  5BT1 D;  3REI D;  3REL B;  4J8U A;  4G91 B;  4Z5T D;  1P3B D;  4LD9 A;  4JJN D;  4Z2M G;  3MGQ D;  4YS3 A;  5B33 D;  5DNM C;  3MGR B;  5BS7 C;  2NQB D;  1P3M C;  4UUZ B;  3AZL C;  3LZ1 D;  3AZK A;  1A7W A;  3WAA A;  4KUD B;  4WU8 A;  3C1B B;  5B31 B;  4DRB A;  4G92 C;  3AYW C;  5B24 A;  3W98 B;  3UTB C;  1P3A D;  3V9R B;  3W97 D;  3W99 C;  3LZ0 C;  3NQJ B;  1TZY B;  3WKJ B;  3B6F C;  4Z66 D;  1P3K D;  3AZJ D;  5F99 D;  2ARO C;  5AV9 C;  5CP6 D;  3AZM D;  4H9P A;  2CWE A;  4HGA C;  5B2J C;  1S32 C;  4J8V A;  4ZUX B;  3MGP B;  1P34 D;  4WU9 D;  3LJA C;  5B32 A;  3WA9 D;  3MVD B;  3AZG B;  5C3I B;  5B40 C;  1P3I C;  4E45 A;  4H9Q A;  4ZBJ B;  3AFA B;  2CV5 C;  3A6N D;  5AVB C;  3X1T D;  5GT3 C;  3LEL A;  1ZLA C;  4J8U B;  3X1S A;  4EO5 B;  5AV8 D;  5AVC A;  4LD9 B;  3LZ1 C;  4NE6 A;  4J8X A;  4YM6 C;  5JA4 B;  1P3G D;  1M19 A;  5AV6 D;  4YS3 B;  2FJ7 C;  5B0Z C;  1AOI D;  4XUJ D;  3AZK B;  3WAA B;  3MNN C;  2JSS A;  5DNN D;  4WU8 B;  2NZD C;  5B24 B;  1BH9 A;  1WWS A;  5DNM A;  5GT0 C;  5BS7 A;  3AV2 D;  1P3M A;  3AZN C;  3AZL A;  5CPI D;  5E5A D;  1M18 C;  2PYO D;  3X1V D;  3WA9 C;  3AV1 D;  3AN2 D;  4H9P B;  3AYW A;  4DRA A;  4J8V B;  3UTB A;  4EO5 C;  5BNX A;  3W99 A;  5B32 B;  2F8N D;  3LZ0 A;  1KX3 D;  5G49 A;  1TAF B;  5CPK D;  3AZE B;  3B6F A;  4H9Q B;  1P3F C;  2ARO A;  5AV9 A;  1AOI C;  1KX5 D;  3LEL B;  1U35 C;  4KGC C;  5B1L D;  5B2J A;  3X1S B;  1S32 A;  4J8X B;  4NE3 A;  4AWL B;  3LJA A;  1M19 B;  3NQU A;  3REJ C;  5B40 A;  1P3I A;  1ID3 C;  2CV5 A;  5AVB A;  2BYM A;  3KWQ C;  3WTP C;  5GT3 A;  1M1A D;  1ZLA A;  5CPJ C;  3LZ1 A;  5B0Y C;  1BH8 A;  5CPI C;  4YM6 A;  3C1C C;  1BH9 B;  2FJ7 A;  5DNM B;  5B0Z A;  3UTA C;  3AN2 C;  3X1U C;  4J8W D;  3VH5 T;  1P3M B;  5B2I C;  3AZL B;  2RVQ D;  1JFI A;  4QLC D;  3MNN A;  5B1M C;  3AZE C;  1HQ3 D;  3O62 C;  4G92 B;  2NZD A;  3AYW B;  2F8N G;  1F66 D;  3UTB B;  5GT0 A;  5BNX B;  5FUG A;  3W99 B;  5AV5 D;  3LZ0 B;  3AZI D;  3AZN A;  5G49 B;  1EQZ D;  3B6F B;  3MVD A;  1M18 A;  4H9S C;  4X23 D;  2ARO B;  1P3L D;  3WA9 A;  5AV9 B;  1KX4 B;  4HGA B;  5GSU C;  5B2J B;  3REK D;  1S32 B;  3KUY D;  3AZF D;  3LJA B;  3NQU B;  3TU4 D;  5JA4 A;  5B40 B;  1P3I B;  5GXQ D;  1H3O A;  3X1V B;  2CV5 B;  1P3F A;  5AVB B;  2BYM B;  5GT3 B;  4XZQ D;  3MGS C;  1U35 A;  4KGC A;  1ZLA B;  1P3O D;  4R8P D;  3KXB D;  5AY8 C;  3LZ1 B;  1HTA A;  1BH8 B;  4YM6 B;  1B6W A;  2FJ7 B;  5JRG C;  3W96 C;  5B0Z B;  3REJ A;  1ID3 A;  1JFI B;  3B0D C;  3KWQ A;  3MNN B;  3WTP A;  3MGR D;  5CPJ A;  5AV5 C;  1P3P D;  5B0Y A;  5CPI A;  3R45 A;  3AZH D;  4H9R A;  3C1C A;  1KX4 C;  2NZD B;  1F1E A;  4KGC D;  5GT0 B;  5BT1 C;  3UTA A;  3AN2 A;  4KUD D;  5FUG B;  3REI C;  3X1U A;  3C1B D;  5B31 D;  5B2I A;  3AZN B;  1M18 B;  3W98 D;  4Z5T C;  1TAF A;  3AZF C;  5B1M A;  3AZE A;  1P3B C;  4KHA A;  2F8N A;  3WA9 B;  3O62 A;  4JJN C;  3MGQ C;  5B33 C;  1TZY D;  3WKJ D;  2NQB C;  5BO0 A;  4NE5 A;  1H3O B;  4H9S A;  4ZUX D;  1P3F B;  3MGP D;  3VH5 A;  2BYK A;  1AOI B;  1U35 B;  4KGC B;  3AZG D;  5GSU A;  1P3A C;  3W97 C;  2HIO D;  3AFA D;  4H9O A;  4Z66 C;  1P3K C;  3REJ B;  3AZJ C;  1P3P C;  5F99 C;  4J8U D;  4NFT A;  1ID3 B;  5CP6 C;  4LD9 D;  3AZM C;  3KWQ B;  3B0C W;  3WTP B;  3MGS A;  5CPJ B;  1P34 C;  4WNN A;  4WU9 C;  5AY8 A;  5B0Y B;  5CPI B;  3R45 B;  4H9R B;  3C1C B;  5B31 G;  5JRG A;  3W96 A;  3AZK D;  3WAA D;  3UTA B;  3AN2 B;  3A6N C;  3X1U B;  4WU8 D;  3B0C T;  5B2I B;  3X1T C;  5B24 D;  5AV8 C;  4WV4 B;  5B1M B;  2F8N B;  4KHA B;  5AV5 A;  3O62 B;  1P3G C;  5AV6 C;  4CSR A;  1KX4 A;  3REI A;  4XUJ C;  5BO0 B;  5DNN C;  2HIO C;  3B6G D;  4J8V D;  4Z5T A;  1P3B A;  3AZF A;  2YFW B;  2BYK B;  4JJN A;  3MGQ A;  5B32 D;  5B33 A;  5GSU B;  3WTP E;  3VH5 W;  3AV2 C;  2NQB A;  4H9O B;  5CHL B;  5E5A C;  2PYO C;  3LEL D;  3X1V C;  3X1S D;  4M6B A;  3AV1 C;  5AVC D;  4J8X D;  1M19 D;  3MGS B;  1P3A A;  4WNN B;  3W97 A;  5AY8 B;  1KX3 C;  5CPK C;  5JRG B;  4Z66 A;  3W96 B;  1P3K A;  3AZJ A;  1P3P A;  5F99 A;  1B67 A;  5CP6 A;  2F8N K;  3AZM A;  1KX5 C;  2HUE C;  5B1L C;  3B0D B;  3VH6 W;  5AV5 B;  2L5A A;  4WU9 A;  1P34 A;  4Z2M H;  4CSR B;  3B6G C;  1P3M D;  3AZL D;  3REH D;  3REI B;  3A6N A;  5BNV A;  5KDM A;  3REK B;  3VH6 T;  3X1T A;  1M1A C;  3AYW D;  5B32 G;  5AV8 A;  4Z5T B;  1P3B B;  3AZF B;  3UTB D;  4H9N A;  4JJN B;  1P3G A;  3MGQ B;  3W99 D;  5AV6 A;  5B33 B;  3LZ0 D;  5AVC C;  1AOI A;  2NQB B;  4J8W C;  1WWI A;  3UT9 D;  2ARO D;  2RVQ C;  4XUJ A;  4QLC C;  5DNN A;  2HIO A;  1HQ3 C;  2YFV A;  5B2J D;  1S32 D;  3REL D;  1F66 C;  3LJA D;  1P3A B;  5B40 D;  3AV2 A;  1P3I D;  3W97 B;  3AZI C;  2CV5 D;  1EQZ C;  4Z66 B;  5E5A A;  5AVB D;  1P3K B;  2PYO A;  5GT3 D;  4X23 C;  3AZJ B;  5F99 B;  3X1V A;  2IO5 C;  1P3L C;  1P3P B;  3AZH B;  3AV1 A;  5CP6 B;  1ZLA D;  3REH C;  3AZM B;  4YM6 D;  3REK C;  2FJ7 D;  5B0Z D;  4WU9 B;  1P34 B;  3KUY C;  3TU4 C;  1KX3 A;  5CPK A;  5GXQ C;  3MNN D;  3A6N B;  5BNV B;  5KDM B;  3X1T B;  1KX5 A;  4XZQ C;  2NZD D;  5B1L A;  1P3O C;  5AV8 B;  4R8P C;  3KXB C;  3UT9 C;  5GT0 D;  4H9N B;  2YFW A;  1P3G B;  5AV6 B;  3B6G A;  3AZN D;  3REL C;  3MVD D;  1M18 D;  4G91 C;  1N1J A;  4XUJ B;  5DNN B;  1M1A A;  2HIO B;  3B0B A;  3MGR C;  2YFV B;  3AZH C;  4E44 A;  4KUD C;  4CAY A;  4YS3 D;  3AV2 B;  3C1B C;  5B31 C;  4J8W A;  1P3F D;  4QLC A;  5E5A B;  3W98 C;  2PYO B;  1U35 D;  1HQ3 A; 
#chains in the Genus database with same CATH topology
 3AV1 B;  3VH6 A;  1F66 A;  1TZY C;  3WKJ C;  3REJ D;  1ID3 D;  3AZI A;  1KX3 B;  1EQZ A;  5CPK B;  3KWQ D;  3WTP D;  4X23 A;  4ZUX C;  1P3L A;  3MGP C;  5CPJ D;  3REH A;  5B0Y D;  1KX5 B;  3MVD C;  2HUE B;  5B1L B;  3C1C D;  3AZG C;  5C3I C;  3REK A;  4ZBJ C;  3AFA C;  3UTA D;  3KUY A;  3X1U D;  3TU4 A;  3B6G B;  2JCH A;  5B2I D;  5GXQ A;  4J8U C;  4LD9 C;  5B1M D;  4WZS B;  1N1J B;  3AZE D;  3O62 D;  4YS3 C;  4XZQ A;  2LY8 A;  1M1A B;  1P3O A;  4R8P A;  3KXB A;  3UT9 A;  2F8N H;  2J8P A;  3AZK C;  3WAA C;  3REL A;  5AVC B;  4CAY B;  4WU8 C;  4J8W B;  4QLC B;  5B24 C;  3AL0 C;  1HQ3 B;  3MGR A;  5GSU D;  3AZH A;  3KSY A;  4UUZ A;  1F66 B;  4KUD A;  3EPH A;  5DNM D;  3C1B A;  5B31 A;  3AZI B;  1EQZ B;  2Y2P A;  1R4V A;  3W98 A;  4J8V C;  4X23 B;  3MGS D;  1P3L B;  2IO5 B;  1T3U A;  2Y2L A;  3V9R A;  5AY8 D;  3REH B;  1BFM A;  5B32 C;  3NQJ A;  1TZY A;  3WKJ A;  3F6T A;  5JRG D;  3W96 D;  1ULY A;  3KUY B;  1KU5 A;  1Q9C A;  3TU4 B;  3LEL C;  5GXQ B;  3X1S C;  4ZUX A;  3B6F D;  3MGP A;  4J8X C;  2BG1 A;  4AWL C;  1M19 C;  4XZQ B;  3AZG A;  5AV9 D;  1KX4 D;  1P3O B;  4R8P B;  3KXB B;  3UT9 B;  1Z2C B;  3AFA A;  5BT1 D;  3REI D;  3REL B;  4J8U A;  4G91 B;  4Z5T D;  1P3B D;  4LD9 A;  4JJN D;  4Z2M G;  3MGQ D;  4YS3 A;  5B33 D;  5DNM C;  3MGR B;  3IP4 C;  5BS7 C;  2NQB D;  1P3M C;  4UUZ B;  3AZL C;  3LZ1 D;  2Y2O A;  1A7W A;  3FDD A;  3AZK A;  3WAA A;  4KUD B;  4WU8 A;  3C1B B;  5B31 B;  4DRB A;  4G92 C;  3AYW C;  5B24 A;  3W98 B;  1W2E A;  3UTB C;  1P3A D;  3V9R B;  3W97 D;  3W99 C;  3LZ0 C;  3NQJ B;  1TZY B;  3WKJ B;  3B6F C;  4Z66 D;  1P3K D;  3AZJ D;  5F99 D;  2ARO C;  5AV9 C;  5CP6 D;  3AZM D;  4H9P A;  2CWE A;  4HGA C;  5B2J C;  1S32 C;  2Y2M A;  4J8V A;  4ZUX B;  3MGP B;  1P34 D;  4WU9 D;  2F2A C;  3LJA C;  5B32 A;  3WA9 D;  3MVD B;  3AZG B;  5C3I B;  5B40 C;  1P3I C;  4E45 A;  4H9Q A;  4ZBJ B;  3AFA B;  2CV5 C;  3A6N D;  2G5H C;  5AVB C;  3X1T D;  5GT3 C;  2ZY5 A;  3LEL A;  1ZLA C;  4J8U B;  3X1S A;  4EO5 B;  5AV8 D;  5AVC A;  4LD9 B;  3LZ1 C;  4NE6 A;  4J8X A;  4YM6 C;  5JA4 B;  1P3G D;  1M19 A;  5AV6 D;  4YS3 B;  2FJ7 C;  5B0Z C;  1AOI D;  2UWX A;  4XUJ D;  3AZK B;  3WAA B;  3MNN C;  2JSS A;  5DNN D;  4UPK A;  4WU8 B;  2JE5 A;  2NZD C;  5B24 B;  1BH9 A;  1WWS A;  5DNM A;  2DF4 C;  5GT0 C;  5BS7 A;  3AV2 D;  1P3M A;  3AZN C;  3AZL A;  3H0R C;  5CPI D;  5E5A D;  1M18 C;  2PYO D;  2Y2N A;  2ZY2 A;  3X1V D;  3WA9 C;  3AV1 D;  3AN2 D;  4H9P B;  3AYW A;  4DRA A;  4J8V B;  3UTB A;  4EO5 C;  5BNX A;  3EPL A;  3W99 A;  5B32 B;  2F8N D;  3LZ0 A;  1KX3 D;  5G49 A;  1TAF B;  5CPK D;  3AZE B;  3B6F A;  4H9Q B;  1P3F C;  2ARO A;  5AV9 A;  1AOI C;  1KX5 D;  3LEL B;  1U35 C;  4KGC C;  5B1L D;  5B2J A;  3X1S B;  1S32 A;  4J8X B;  4NE3 A;  4AWL B;  3LJA A;  1M19 B;  3NQU A;  3REJ C;  5B40 A;  1P3I A;  1ID3 C;  2CV5 A;  5AVB A;  2BYM A;  3KWQ C;  3WTP C;  5GT3 A;  1M1A D;  1ZLA A;  5CPJ C;  3LZ1 A;  5B0Y C;  1BH8 A;  5CPI C;  4YM6 A;  3C1C C;  1BH9 B;  2FJ7 A;  5DNM B;  5B0Z A;  3UTA C;  3AN2 C;  3X1U C;  4J8W D;  3VH5 T;  1P3M B;  5B2I C;  3AZL B;  2RVQ D;  1JFI A;  4QLC D;  3MNN A;  5B1M C;  3AZE C;  1HQ3 D;  3O62 C;  4G92 B;  2NZD A;  3AYW B;  2F8N G;  1F66 D;  3UTB B;  5GT0 A;  5BNX B;  5FUG A;  2RIQ A;  3W99 B;  5AV5 D;  3LZ0 B;  3AZI D;  3AZN A;  5G49 B;  1EQZ D;  3B6F B;  3MVD A;  1M18 A;  4H9S C;  2Y2I A;  4X23 D;  2ARO B;  1P3L D;  3WA9 A;  5AV9 B;  1KX4 B;  4HGA B;  5GSU C;  5B2J B;  3REK D;  1S32 B;  3KUY D;  3AZF D;  3LJA B;  3NQU B;  3TU4 D;  5JA4 A;  5B40 B;  1P3I B;  5GXQ D;  1H3O A;  3X1V B;  2CV5 B;  1P3F A;  5AVB B;  2BYM B;  5GT3 B;  4XZQ D;  3MGS C;  1U35 A;  4KGC A;  2FFF B;  1P3O D;  1ZLA B;  4R8P D;  3A1K A;  3P5J B;  5AY8 C;  3KXB D;  1HTA A;  1BH8 B;  4YM6 B;  3LZ1 B;  1B6W A;  2FJ7 B;  5JRG C;  3W96 C;  5B0Z B;  3REJ A;  2ZY4 A;  1ID3 A;  1JFI B;  3B0D C;  3KWQ A;  3MNN B;  3WTP A;  3MGR D;  5CPJ A;  5AV5 C;  1P3P D;  3EG5 B;  5B0Y A;  5CPI A;  3R45 A;  3AZH D;  4H9R A;  3C1C A;  1KX4 C;  2NZD B;  1F1E A;  4KGC D;  5GT0 B;  5BT1 C;  3UTA A;  3AN2 A;  4KUD D;  5FUG B;  2XD5 A;  3X1U A;  3C1B D;  3REI C;  5B31 D;  5B2I A;  3AZN B;  1M18 B;  3W98 D;  4Z5T C;  1TAF A;  3AZF C;  5B1M A;  3AZE A;  1P3B C;  4KHA A;  2F8N A;  3WA9 B;  3O62 A;  4JJN C;  3MGQ C;  5B33 C;  1TZY D;  3WKJ D;  2NQB C;  5BO0 A;  4NE5 A;  1H3O B;  4H9S A;  4ZUX D;  1P3F B;  3MGP D;  3VH5 A;  2BYK A;  3H0L C;  3EPJ A;  1AOI B;  1U35 B;  4KGC B;  3AZG D;  5GSU A;  1P3A C;  3W97 C;  2HIO D;  3AFA D;  2Y2G A;  2ZM5 A;  4H9O A;  4Z66 C;  1P3K C;  3REJ B;  3AZJ C;  1P3P C;  5F99 C;  4J8U D;  4NFT A;  1ID3 B;  5CP6 C;  4LD9 D;  3AZM C;  4WJ3 C;  3KWQ B;  3B0C W;  3WTP B;  3MGS A;  5CPJ B;  1P34 C;  4WNN A;  4WU9 C;  5AY8 A;  3A1I A;  5B0Y B;  5CPI B;  3R45 B;  4H9R B;  3C1C B;  5B31 G;  5JRG A;  3W96 A;  2Y2H A;  3AZK D;  3WAA D;  3KFU G;  3UTA B;  3AN2 B;  3A6N C;  3X1U B;  4WU8 D;  3B0C T;  5B2I B;  3X1T C;  2W8S A;  5B24 D;  5AV8 C;  4WV4 B;  5B1M B;  2F8N B;  4KHA B;  5AV5 A;  3O62 B;  1P3G C;  5AV6 C;  4CSR A;  1KX4 A;  1PZR A;  3REI A;  4XUJ C;  5BO0 B;  5DNN C;  2Y2J A;  2HIO C;  3B6G D;  4J8V D;  4Z5T A;  2VQR A;  3AZF A;  2YFW B;  1P3B A;  2BYK B;  4JJN A;  3MGQ A;  5B32 D;  2XD1 A;  5B33 A;  5GSU B;  2DQN C;  3WTP E;  3VH5 W;  3AV2 C;  2NQB A;  4H9O B;  5CHL B;  5E5A C;  2PYO C;  3LEL D;  3X1V C;  3X1S D;  4M6B A;  3AV1 C;  5AVC D;  4J8X D;  1M19 D;  3MGS B;  1P3A A;  4WNN B;  3W97 A;  5AY8 B;  1KX3 C;  5CPK C;  5JRG B;  4Z66 A;  3W96 B;  1P3K A;  3AZJ A;  1P3P A;  5F99 A;  1B67 A;  5CP6 A;  2F8N K;  3AZM A;  1KX5 C;  2HUE C;  5B1L C;  3B0D B;  2Y2K A;  3VH6 W;  5AV5 B;  2L5A A;  4WU9 A;  1P34 A;  4Z2M H;  4CSR B;  3B6G C;  1P3M D;  3AZL D;  3REH D;  3REI B;  3A6N A;  5BNV A;  4DQY B;  5KDM A;  3REK B;  3VH6 T;  3X1T A;  1M1A C;  3AYW D;  5B32 G;  5AV8 A;  4Z5T B;  1P3B B;  3AZF B;  3UTB D;  4H9N A;  4JJN B;  1P3G A;  3MGQ B;  3W99 D;  5AV6 A;  5B33 B;  3LZ0 D;  5AVC C;  1AOI A;  2NQB B;  4J8W C;  1WWI A;  3UT9 D;  2ARO D;  2G5I C;  2RVQ C;  4XUJ A;  4QLC C;  5DNN A;  2HIO A;  1HQ3 C;  2YFV A;  5B2J D;  3H0M C;  3REL D;  1S32 D;  1F66 C;  3LJA D;  1P3A B;  5B40 D;  3AV2 A;  1P3I D;  3W97 B;  3AZI C;  2CV5 D;  1EQZ C;  4Z66 B;  5E5A A;  5AVB D;  1P3K B;  2PYO A;  5GT3 D;  4X23 C;  3AZJ B;  5F99 B;  3X1V A;  2IO5 C;  1P3L C;  1P3P B;  3AZH B;  3AV1 A;  5CP6 B;  1ZLA D;  3REH C;  3AZM B;  4YM6 D;  3REK C;  2FJ7 D;  5B0Z D;  4WU9 B;  1P34 B;  3KUY C;  3TU4 C;  1KX3 A;  5CPK A;  3EPK A;  5GXQ C;  3MNN D;  2Y2Q A;  3A6N B;  5BNV B;  5KDM B;  3X1T B;  1KX5 A;  4XZQ C;  2NZD D;  5B1L A;  1P3O C;  5AV8 B;  4R8P C;  3KXB C;  3UT9 C;  5GT0 D;  4H9N B;  2YFW A;  1P3G B;  5AV6 B;  3B6G A;  3AZN D;  3REL C;  3MVD D;  1M18 D;  4G91 C;  1N1J A;  4XUJ B;  5DNN B;  1M1A A;  2HIO B;  3B0B A;  3MGR C;  2YFV B;  2ZY3 A;  3AZH C;  4E44 A;  4KUD C;  4CAY A;  4YS3 D;  3AV2 B;  3C1B C;  5B31 C;  4J8W A;  1P3F D;  4QLC A;  5E5A B;  3W98 C;  2PYO B;  1U35 D;  1HQ3 A; 
#chains in the Genus database with same CATH homology
 3AV1 B;  3VH6 A;  1F66 A;  1TZY C;  3WKJ C;  3REJ D;  1ID3 D;  3AZI A;  1KX3 B;  1EQZ A;  5CPK B;  3KWQ D;  3WTP D;  4X23 A;  4ZUX C;  1P3L A;  3MGP C;  5CPJ D;  3REH A;  5B0Y D;  1KX5 B;  3MVD C;  2HUE B;  5B1L B;  3C1C D;  3AZG C;  5C3I C;  3REK A;  4ZBJ C;  3AFA C;  3UTA D;  3KUY A;  3X1U D;  3TU4 A;  3B6G B;  2JCH A;  5B2I D;  5GXQ A;  4J8U C;  4LD9 C;  5B1M D;  4WZS B;  1N1J B;  3AZE D;  3O62 D;  4YS3 C;  4XZQ A;  2LY8 A;  1M1A B;  1P3O A;  4R8P A;  3KXB A;  3UT9 A;  2F8N H;  2J8P A;  3AZK C;  3WAA C;  3REL A;  5AVC B;  4CAY B;  4WU8 C;  4J8W B;  4QLC B;  5B24 C;  3AL0 C;  1HQ3 B;  3MGR A;  5GSU D;  3AZH A;  3KSY A;  4UUZ A;  1F66 B;  4KUD A;  3EPH A;  5DNM D;  3C1B A;  5B31 A;  3AZI B;  1EQZ B;  2Y2P A;  1R4V A;  3W98 A;  4J8V C;  4X23 B;  3MGS D;  1P3L B;  2IO5 B;  1T3U A;  2Y2L A;  3V9R A;  5AY8 D;  3REH B;  1BFM A;  5B32 C;  3NQJ A;  1TZY A;  3WKJ A;  3F6T A;  5JRG D;  3W96 D;  1ULY A;  3KUY B;  1KU5 A;  1Q9C A;  3TU4 B;  3LEL C;  5GXQ B;  3X1S C;  4ZUX A;  3B6F D;  3MGP A;  4J8X C;  2BG1 A;  4AWL C;  1M19 C;  4XZQ B;  3AZG A;  5AV9 D;  1KX4 D;  1P3O B;  4R8P B;  3KXB B;  3UT9 B;  1Z2C B;  3AFA A;  5BT1 D;  3REI D;  3REL B;  4J8U A;  4G91 B;  4Z5T D;  1P3B D;  4LD9 A;  4JJN D;  4Z2M G;  3MGQ D;  4YS3 A;  5B33 D;  5DNM C;  3MGR B;  3IP4 C;  5BS7 C;  2NQB D;  1P3M C;  4UUZ B;  3AZL C;  3LZ1 D;  2Y2O A;  1A7W A;  3FDD A;  3AZK A;  3WAA A;  4KUD B;  4WU8 A;  3C1B B;  5B31 B;  4DRB A;  4G92 C;  3AYW C;  5B24 A;  3W98 B;  1W2E A;  3UTB C;  1P3A D;  3V9R B;  3W97 D;  3W99 C;  3LZ0 C;  3NQJ B;  1TZY B;  3WKJ B;  3B6F C;  4Z66 D;  1P3K D;  3AZJ D;  5F99 D;  2ARO C;  5AV9 C;  5CP6 D;  3AZM D;  4H9P A;  2CWE A;  4HGA C;  5B2J C;  1S32 C;  2Y2M A;  4J8V A;  4ZUX B;  3MGP B;  1P34 D;  4WU9 D;  2F2A C;  3LJA C;  5B32 A;  3WA9 D;  3MVD B;  3AZG B;  5C3I B;  5B40 C;  1P3I C;  4E45 A;  4H9Q A;  4ZBJ B;  3AFA B;  2CV5 C;  3A6N D;  2G5H C;  5AVB C;  3X1T D;  5GT3 C;  2ZY5 A;  3LEL A;  1ZLA C;  4J8U B;  3X1S A;  4EO5 B;  5AV8 D;  5AVC A;  4LD9 B;  3LZ1 C;  4NE6 A;  4J8X A;  4YM6 C;  5JA4 B;  1P3G D;  1M19 A;  5AV6 D;  4YS3 B;  2FJ7 C;  5B0Z C;  1AOI D;  2UWX A;  4XUJ D;  3AZK B;  3WAA B;  3MNN C;  2JSS A;  5DNN D;  4UPK A;  4WU8 B;  2JE5 A;  2NZD C;  5B24 B;  1BH9 A;  1WWS A;  5DNM A;  2DF4 C;  5GT0 C;  5BS7 A;  3AV2 D;  1P3M A;  3AZN C;  3AZL A;  3H0R C;  5CPI D;  5E5A D;  1M18 C;  2PYO D;  2Y2N A;  2ZY2 A;  3X1V D;  3WA9 C;  3AV1 D;  3AN2 D;  4H9P B;  3AYW A;  4DRA A;  4J8V B;  3UTB A;  4EO5 C;  5BNX A;  3EPL A;  3W99 A;  5B32 B;  2F8N D;  3LZ0 A;  1KX3 D;  5G49 A;  1TAF B;  5CPK D;  3AZE B;  3B6F A;  4H9Q B;  1P3F C;  2ARO A;  5AV9 A;  1AOI C;  1KX5 D;  3LEL B;  1U35 C;  4KGC C;  5B1L D;  5B2J A;  3X1S B;  1S32 A;  4J8X B;  4NE3 A;  4AWL B;  3LJA A;  1M19 B;  3NQU A;  3REJ C;  5B40 A;  1P3I A;  1ID3 C;  2CV5 A;  5AVB A;  2BYM A;  3KWQ C;  3WTP C;  5GT3 A;  1M1A D;  1ZLA A;  5CPJ C;  3LZ1 A;  5B0Y C;  1BH8 A;  5CPI C;  4YM6 A;  3C1C C;  1BH9 B;  2FJ7 A;  5DNM B;  5B0Z A;  3UTA C;  3AN2 C;  3X1U C;  4J8W D;  3VH5 T;  1P3M B;  5B2I C;  3AZL B;  2RVQ D;  1JFI A;  4QLC D;  3MNN A;  5B1M C;  3AZE C;  1HQ3 D;  3O62 C;  4G92 B;  2NZD A;  3AYW B;  2F8N G;  1F66 D;  3UTB B;  5GT0 A;  5BNX B;  5FUG A;  2RIQ A;  3W99 B;  5AV5 D;  3LZ0 B;  3AZI D;  3AZN A;  5G49 B;  1EQZ D;  3B6F B;  3MVD A;  1M18 A;  4H9S C;  2Y2I A;  4X23 D;  2ARO B;  1P3L D;  3WA9 A;  5AV9 B;  1KX4 B;  4HGA B;  5GSU C;  5B2J B;  3REK D;  1S32 B;  3KUY D;  3AZF D;  3LJA B;  3NQU B;  3TU4 D;  5JA4 A;  5B40 B;  1P3I B;  5GXQ D;  1H3O A;  3X1V B;  2CV5 B;  1P3F A;  5AVB B;  2BYM B;  5GT3 B;  4XZQ D;  3MGS C;  1U35 A;  4KGC A;  2FFF B;  1P3O D;  1ZLA B;  4R8P D;  3A1K A;  3P5J B;  5AY8 C;  3KXB D;  1HTA A;  1BH8 B;  4YM6 B;  3LZ1 B;  1B6W A;  2FJ7 B;  5JRG C;  3W96 C;  5B0Z B;  3REJ A;  2ZY4 A;  1ID3 A;  1JFI B;  3B0D C;  3KWQ A;  3MNN B;  3WTP A;  3MGR D;  5CPJ A;  5AV5 C;  1P3P D;  3EG5 B;  5B0Y A;  5CPI A;  3R45 A;  3AZH D;  4H9R A;  3C1C A;  1KX4 C;  2NZD B;  1F1E A;  4KGC D;  5GT0 B;  5BT1 C;  3UTA A;  3AN2 A;  4KUD D;  5FUG B;  2XD5 A;  3X1U A;  3C1B D;  3REI C;  5B31 D;  5B2I A;  3AZN B;  1M18 B;  3W98 D;  4Z5T C;  1TAF A;  3AZF C;  5B1M A;  3AZE A;  1P3B C;  4KHA A;  2F8N A;  3WA9 B;  3O62 A;  4JJN C;  3MGQ C;  5B33 C;  1TZY D;  3WKJ D;  2NQB C;  5BO0 A;  4NE5 A;  1H3O B;  4H9S A;  4ZUX D;  1P3F B;  3MGP D;  3VH5 A;  2BYK A;  3H0L C;  3EPJ A;  1AOI B;  1U35 B;  4KGC B;  3AZG D;  5GSU A;  1P3A C;  3W97 C;  2HIO D;  3AFA D;  2Y2G A;  2ZM5 A;  4H9O A;  4Z66 C;  1P3K C;  3REJ B;  3AZJ C;  1P3P C;  5F99 C;  4J8U D;  4NFT A;  1ID3 B;  5CP6 C;  4LD9 D;  3AZM C;  4WJ3 C;  3KWQ B;  3B0C W;  3WTP B;  3MGS A;  5CPJ B;  1P34 C;  4WNN A;  4WU9 C;  5AY8 A;  3A1I A;  5B0Y B;  5CPI B;  3R45 B;  4H9R B;  3C1C B;  5B31 G;  5JRG A;  3W96 A;  2Y2H A;  3AZK D;  3WAA D;  3KFU G;  3UTA B;  3AN2 B;  3A6N C;  3X1U B;  4WU8 D;  3B0C T;  5B2I B;  3X1T C;  2W8S A;  5B24 D;  5AV8 C;  4WV4 B;  5B1M B;  2F8N B;  4KHA B;  5AV5 A;  3O62 B;  1P3G C;  5AV6 C;  4CSR A;  1KX4 A;  1PZR A;  3REI A;  4XUJ C;  5BO0 B;  5DNN C;  2Y2J A;  2HIO C;  3B6G D;  4J8V D;  4Z5T A;  2VQR A;  3AZF A;  2YFW B;  1P3B A;  2BYK B;  4JJN A;  3MGQ A;  5B32 D;  2XD1 A;  5B33 A;  5GSU B;  2DQN C;  3WTP E;  3VH5 W;  3AV2 C;  2NQB A;  4H9O B;  5CHL B;  5E5A C;  2PYO C;  3LEL D;  3X1V C;  3X1S D;  4M6B A;  3AV1 C;  5AVC D;  4J8X D;  1M19 D;  3MGS B;  1P3A A;  4WNN B;  3W97 A;  5AY8 B;  1KX3 C;  5CPK C;  5JRG B;  4Z66 A;  3W96 B;  1P3K A;  3AZJ A;  1P3P A;  5F99 A;  1B67 A;  5CP6 A;  2F8N K;  3AZM A;  1KX5 C;  2HUE C;  5B1L C;  3B0D B;  2Y2K A;  3VH6 W;  5AV5 B;  2L5A A;  4WU9 A;  1P34 A;  4Z2M H;  4CSR B;  3B6G C;  1P3M D;  3AZL D;  3REH D;  3REI B;  3A6N A;  5BNV A;  4DQY B;  5KDM A;  3REK B;  3VH6 T;  3X1T A;  1M1A C;  3AYW D;  5B32 G;  5AV8 A;  4Z5T B;  1P3B B;  3AZF B;  3UTB D;  4H9N A;  4JJN B;  1P3G A;  3MGQ B;  3W99 D;  5AV6 A;  5B33 B;  3LZ0 D;  5AVC C;  1AOI A;  2NQB B;  4J8W C;  1WWI A;  3UT9 D;  2ARO D;  2G5I C;  2RVQ C;  4XUJ A;  4QLC C;  5DNN A;  2HIO A;  1HQ3 C;  2YFV A;  5B2J D;  3H0M C;  3REL D;  1S32 D;  1F66 C;  3LJA D;  1P3A B;  5B40 D;  3AV2 A;  1P3I D;  3W97 B;  3AZI C;  2CV5 D;  1EQZ C;  4Z66 B;  5E5A A;  5AVB D;  1P3K B;  2PYO A;  5GT3 D;  4X23 C;  3AZJ B;  5F99 B;  3X1V A;  2IO5 C;  1P3L C;  1P3P B;  3AZH B;  3AV1 A;  5CP6 B;  1ZLA D;  3REH C;  3AZM B;  4YM6 D;  3REK C;  2FJ7 D;  5B0Z D;  4WU9 B;  1P34 B;  3KUY C;  3TU4 C;  1KX3 A;  5CPK A;  3EPK A;  5GXQ C;  3MNN D;  2Y2Q A;  3A6N B;  5BNV B;  5KDM B;  3X1T B;  1KX5 A;  4XZQ C;  2NZD D;  5B1L A;  1P3O C;  5AV8 B;  4R8P C;  3KXB C;  3UT9 C;  5GT0 D;  4H9N B;  2YFW A;  1P3G B;  5AV6 B;  3B6G A;  3AZN D;  3REL C;  3MVD D;  1M18 D;  4G91 C;  1N1J A;  4XUJ B;  5DNN B;  1M1A A;  2HIO B;  3B0B A;  3MGR C;  2YFV B;  2ZY3 A;  3AZH C;  4E44 A;  4KUD C;  4CAY A;  4YS3 D;  3AV2 B;  3C1B C;  5B31 C;  4J8W A;  1P3F D;  4QLC A;  5E5A B;  3W98 C;  2PYO B;  1U35 D;  1HQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...