3VH5A

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
100
structure length
100
Chain Sequence
AGGEQRELLIQRLRAAVHYTTGALAQDVAEDKGVLFSKQTVAAISEITFRQAENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 42
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh5A00
5F99B 3AZJA 2NQBD 1KX3C 5AV8B 1M1AC 1ZLAA 3AZIC 4KHAA 4WU9B 5B0ZD 3REJD 3LELD 2HUEB 3MVDC 3A6ND 2NZDC 3X1VD 5B40D 3AZIB 3W98D 4H9QB 4JJND 3UT9A 2FJ7A 2CV5D 1M1AA 4EO5B 3LZ0B 3MVDB 2NZDB 4KGCA 3VH6W 3LZ1D 3WTPD 2LY8A 4DRBA 5GSUD 4G92B 4XZQA 1WWIA 1BFMA 2NQBC 5GXQA 5AV5A 5JRGB 4Z5TD 5B0ZC 1M18D 5FUGA 3C1BD 4H9RB 3REJC 3MGSD 2YFVB 4ZUXC 3LELC 3RELA 1BH8A 3AN2D 5B31C 3A6NC 2NQBB 3MNND 3W98C 3AZKA 1TAFA 5BS7C 5B0ZB 5B2IC 3VH5T 2CV5C 3REJB 5B0YA 3LELB 5B33D 5BO0B 5B31B 3A6NB 1BH9A 3WTPC 5B40B 3X1VB 3B6GD 3W98B 2YFWA 4JJNB 1P3PC 5GSUC 3UTAD 2CV5B 3AZFA 3X1UC 3MGQD 3B6FD 2PYOD 3LZ1B 3WTPB 4Z5TC 1P3MC 1M18C 1U35A 1P3KA 4YS3D 5GSUB 5AVBD 3AYWD 1P3PB 4G91C 3C1BC 1F66A 5CPID 3MNNC 3O62D 5AV6D 5B1MD 3R45B 3AZGA 4Z5TB 5B1LA 2AROA 1M18B 5BNVA 3KWQA 4G91B 3C1BB 3X1UA 1KX5D 5CP6D 3MGSB 3AN2B 5B33C 2RVQD 3MNNB 3W97D 1P3OD 3B6GC 3AZHC 1P3AD 3UTAC 1P3BD 4WNNA 5B33B 5GT0A 3MGQC 1TZYC 1HTAA 2PYOC 5B24D 5KDMA 3B6FC 4YM6C 3B6GB 3AZJD 4YS3C 5AVBC 3REHC 3AYWC 3UTAB 1ZLAD 3NQJA 2F8NG 5CPIC 3MGQB 3O62C 3B6FB 5AV6C 2PYOB 4Z2MG 5B1MC 4E44A 3C1CC 3AYWB 5AVBB 4YS3B 1KX4C 1KX5C 5CP6C 3B0CT 1ULYA 3UT9D 5CPIB 1KX3D 3AV2A 2FJ7D 3O62B 3REHA 5AV6B 3W97C 1P3OC 1M1AD 5B1MB 3AZEC 1P3AC 2BYKB 3NQUA 1KX5B 4KGCD 5CP6B 4CAYA 4H9OA 3W97B 5B24C 3VH6A 1KX4A 1P3OB 3AZJC 1P3AB 5GXQD 1P3BB 5AV5D 3KXBA 1ZLAC 4UUZA 3AZEA 5B24B 1KU5A 1H3OA 3AZJB 5CHLB 3LJAA 3WKJC 1ZLAB 4H9SA 3AZKD 4KHAB 3UT9C 2FJ7C 5JA4A 4Z66A 5B0YD 5CPJA 4KGCC 4ZUXD 3UT9B 5B31D 1KX3B 4XZQC 2FJ7B 3AZFD 1M1AB 3WKJA 5GXQC 3X1TC 1JFIA 5AV5C 4KGCB 5B2ID 1U35D 1P3KD 1F66D 3RELC 1P3IA 3AZNA 1AOIA 2F8NK 5GXQB 5AV5B 1P3PD 3AZKC 3AZGD 4J8XA 5F99A 5B1LD 4J8UA 4WV4B 5FUGB 3X1TA 4H9NA 3KWQD 3X1UD 5B0YC 2IO5C 1BH8B 3WA9C 4X23A 1P3MD 1A7WA 3AZKB 3AZFC 3VH5W 5B0YB 4NFTA 2IO5B 4R8PC 4AWLC 1N1JA 5BNXA 2YFWB 4ZUXB 3LZ0A 1U35C 1P3KC 1P3FC 3WA9A 4KUDA 1F66C 3AZFB 5B31G 4AWLB 1P3GA 3AZHD 4WU8A 3WAAA 5B2IB 3AZLA 3AZGC 5B1LC 2AROC 4R8PA 1U35B 1P3KB 3AFAA 3KWQC 5AVCA 1F66B 1TZYD 4YM6D 1P3FA 3X1SA 4QLCC 3REHD 3MGRA 3AZGB 4NE6A 4H9PA 5B1LB 5E5AC 3KWQB 3X1UB 5GT0C 3C1CD 4J8VC 1P3MB 5G49A 1KX4D 5DNNA 3KXBD 4QLCA 4WNNB 5B40A 4JJNA 3AZED 5E5AA 5KDMB 4J8WA 5GT3A 3LJAD 4J8VA 1M19A 3LZ1A 3NQJB 4HGAC 5AY8A 3REKC 1WWSA 3AZHB 3AV2C 4ZBJC 4LD9A 4XUJA 5CPJD 2BYMA 5B32A 1TZYB 4HGAB 3B0CW 4YM6B 3WTPE 1EQZC 3REHB 3MGSA 4ZBJB 3AN2A 3WKJD 3REKA 3AZMA 3NQUB 3KXBC 4CAYB 3C1CB 4H9OB 3MGPA 1ID3A 1KX4B 3AZND 1AOID 2F8NH 3KUYC 5CPKA 3LJAC 1EQZA 3KXBB 4XZQD 4H9SC 4J8XD 4J8UD 5B2JA 4UUZB 3AZEB 3X1TD 3W96A 2F8NA 4M6BA 4Z66C 3TU4A 1S32A 1H3OB 5CPJC 4X23D 3LJAB 3W99A 5AV9C 3RELD 3KUYA 5JA4B 1P3LA 5CPJB 5BT1D 3VH5A 3AV1A 3WA9D 4KUDD 1P3IC 3UTBC 3AZNC 1AOIC 3WKJB 5AV9A 1P3GD 2HIOA 4WU8D 3WAAD 3AZLD 5DNMA 4J8XC 5F99C 4J8UC 4R8PD 3AFAD 3REIA 5AVCD 3AZNB 1AOIB 1HQ3A 4X23C 3V9RA 1P3FD 1B6WA 4CSRA 4XZQB 3MGRD 4J8XB 2HUEC 4WZSB 4J8UB 3UTBA 3B0DC 3X1TB 4H9NB 1P34A 2JSSA 4X23B 2AROD 5BT1C 5AV8A 4EO5C 3RELB 3LZ0C 3B0DB 4KUDC 4WU9A 5DNND 4QLCD 1P3GC 1TAFB 3WAAC 4WU8C 1N1JB 5E5AD 4G92C 1KX3A 3AZLC 5BNXB 4J8WD 3AZIA 3AFAC 1F1EA 5GT0D 4H9QA 5GT3D 3WA9B 1BH9B 5AVCC 4J8VD 4KUDB 1M19D 5JRGC 5AY8D 1P3GB 4WU8B 3MVDA 3X1SC 3WAAB 3AZLB 3MGRC 3VH6T 2NZDA 4LD9D 4XUJD 4R8PB 3AFAB 5AVCB 5B32D 4NE5A 1P3FB 1R4VA 3X1SB 3MGRB 5JRGA 4H9PB 3REKD 3AZMD 5DNNC 3AV2D 3X1VC 5B40C 4H9RA 2YFVA 3MGPD 4JJNC 2NQBA 2AROB 5G49B 5BNVB 1ID3D 4J8WC 5GT3C 5CPKD 1EQZD 5B0ZA 5DNNB 1M19C 4QLCB 3LZ1C 5AY8C 3REJA 2L5AA 5B2JD 4ZUXA 3LELA 5E5AB 5BO0A 5B31A 3A6NA 2F8ND 3W96D 3TU4D 4LD9C 4XUJC 1S32D 4J8WB 3X1VA 3W98A 5GT3B 5GT0B 5BS7A 4J8VB 3W99D 5B32C 1M19B 5B2IA 2CV5A 5AY8B 3KUYD 1P3LD 3MGSC 3AN2C 4LD9B 4XUJB 3KSYA 1Q9CA 2BYMB 3WTPA 3AZMC 1P3PA 5GSUA 5B32B 4Z66D 3AV1D 4E45A 3MGPC 5B32G 1ID3C 4NE3A 5AV9D 3R45A 2HIOD 4DRAA 4Z5TA 3REKB 3AZMB 5CPKC 1P3MA 1M18A 3AV2B 5DNMD 3C1BA 5B2JC 3MGPB 3W96C 3REID 1ID3B 3MNNA 3TU4C 3B0BA 1S32C 1HQ3D 5CPKB 3W99C 1EQZB 1P3ID 3UTBD 5B2JB 5B33A 3W96B 2F8NB 1B67A 3TU4B 1P34D 1P3LC 1S32B 4Z2MH 3B6GA 5F99D 3AZHA 3W99B 5AV8D 3UTAA 3AV1C 3KUYB 4WU9D 1P3LB 3MGQA 1TZYA 2CWEA 2PYOA 3B6FA 4YM6A 2HIOC 2RVQC 3AYWA 5AVBA 4YS3A 5DNMC 4Z66B 3AV1B 3AZID 5C3IC 1P3BC 3REIC 5CPIA 3O62A 1HQ3C 5AV6A 5AV9B 5B1MA 3C1CA 2HIOB 3LZ0D 3MVDD 2BYKA 2NZDD 5DNMB 1KX5A 5CP6A 5C3IB 1JFIB 3REIB 1P34C 3W97A 1HQ3B 1P3OA 3V9RB 1P3AA 4CSRB 5AV8C 1P3BA 1P3IB 5JRGD 3UTBB 4WU9C 1P34B 3X1SD 5B24A
chains in the Genus database with same CATH superfamily
5F99B 3AZJA 2NQBD 1KX3C 5AV8B 1M1AC 1ZLAA 3AZIC 4KHAA 4WU9B 5B0ZD 3REJD 3LELD 2HUEB 2XD1A 3MVDC 3A6ND 2NZDC 3X1VD 5B40D 3AZIB 3W98D 4H9QB 4JJND 3UT9A 2FJ7A 2CV5D 1M1AA 2Y2LA 4EO5B 3LZ0B 1T3UA 3MVDB 2NZDB 4KGCA 3VH6W 3LZ1D 3WTPD 2LY8A 4DRBA 5GSUD 4G92B 4XZQA 1WWIA 2XD5A 1BFMA 2NQBC 5GXQA 5AV5A 5JRGB 4Z5TD 5B0ZC 1M18D 5FUGA 3C1BD 4H9RB 3REJC 3MGSD 2YFVB 4ZUXC 3LELC 3RELA 1BH8A 3AN2D 5B31C 3A6NC 2NQBB 3MNND 3W98C 3AZKA 1TAFA 5BS7C 5B0ZB 5B2IC 3VH5T 2CV5C 3REJB 5B0YA 3LELB 5B33D 5BO0B 5B31B 2Y2JA 3A6NB 1BH9A 3WTPC 5B40B 3X1VB 3B6GD 3W98B 2YFWA 4JJNB 3EPJA 5GSUC 1P3PC 3UTAD 2CV5B 3AZFA 2DF4C 3X1UC 3MGQD 3B6FD 2PYOD 3LZ1B 3WTPB 4Z5TC 1P3MC 1M18C 1U35A 1P3KA 4YS3D 5GSUB 5AVBD 3AYWD 1P3PB 4G91C 3C1BC 1F66A 3AL0C 5CPID 3MNNC 3O62D 5AV6D 5B1MD 3R45B 3AZGA 4Z5TB 5B1LA 2AROA 1M18B 5BNVA 3KWQA 4G91B 3C1BB 3X1UA 1KX5D 5CP6D 3MGSB 3AN2B 5B33C 2RVQD 3MNNB 3W97D 1P3OD 3B6GC 3AZHC 2Y2MA 1P3AD 3UTAC 1P3BD 4WNNA 5B33B 5GT0A 3MGQC 1TZYC 1HTAA 2PYOC 5B24D 5KDMA 3B6FC 4YM6C 3B6GB 3AZJD 4YS3C 5AVBC 3REHC 3AYWC 3UTAB 1ZLAD 3NQJA 2F8NG 5CPIC 3MGQB 3O62C 3B6FB 5AV6C 2PYOB 4Z2MG 5B1MC 4E44A 3C1CC 3AYWB 5AVBB 4YS3B 1KX4C 1KX5C 5CP6C 3B0CT 1ULYA 3UT9D 5CPIB 1KX3D 3AV2A 2FJ7D 3O62B 3REHA 5AV6B 3W97C 1P3OC 1M1AD 5B1MB 3AZEC 1P3AC 2BYKB 3NQUA 1KX5B 4KGCD 5CP6B 4CAYA 4H9OA 3W97B 5B24C 3VH6A 1KX4A 1P3OB 3AZJC 1P3AB 5GXQD 1P3BB 2ZY5A 5AV5D 3KXBA 1ZLAC 4UUZA 3AZEA 5B24B 2Y2KA 2Y2IA 1KU5A 1H3OA 3AZJB 5CHLB 3LJAA 3WKJC 1ZLAB 3H0LC 4H9SA 3AZKD 4KHAB 3UT9C 2FJ7C 5JA4A 4Z66A 5B0YD 5CPJA 4KGCC 2G5IC 4ZUXD 3UT9B 5B31D 1KX3B 4XZQC 2FJ7B 3AZFD 1M1AB 3WKJA 5GXQC 3X1TC 1JFIA 5AV5C 4KGCB 5B2ID 3EPHA 2W8SA 1U35D 1P3KD 1F66D 3RELC 1P3IA 3AZNA 1AOIA 2F8NK 5GXQB 5AV5B 1P3PD 3AZKC 3AZGD 4J8XA 5F99A 5B1LD 4J8UA 4WV4B 5FUGB 3X1TA 4H9NA 3KWQD 3X1UD 5B0YC 2IO5C 1BH8B 3WA9C 4X23A 3EG5B 1P3MD 1A7WA 3AZKB 3AZFC 3VH5W 5B0YB 4NFTA 2IO5B 4R8PC 4AWLC 3P5JB 1N1JA 2UWXA 5BNXA 2YFWB 4ZUXB 3LZ0A 1U35C 1P3KC 1P3FC 3WA9A 4KUDA 1F66C 3AZFB 5B31G 4AWLB 1P3GA 3AZHD 4WU8A 3WAAA 5B2IB 3AZLA 3AZGC 5B1LC 2AROC 4R8PA 1U35B 1P3KB 3AFAA 3KWQC 5AVCA 1F66B 1TZYD 4YM6D 1P3FA 2JCHA 3X1SA 4QLCC 3REHD 3MGRA 3AZGB 4NE6A 4H9PA 5B1LB 5E5AC 3H0RC 3KWQB 3X1UB 5GT0C 3C1CD 4J8VC 1P3MB 5G49A 1KX4D 3FDDA 2J8PA 2ZM5A 5DNNA 3KXBD 4QLCA 4WNNB 5B40A 4JJNA 3AZED 5E5AA 5KDMB 4J8WA 2Y2QA 5GT3A 3KFUG 3LJAD 4J8VA 1M19A 3LZ1A 3NQJB 4HGAC 5AY8A 3REKC 1WWSA 3AZHB 3AV2C 4ZBJC 4LD9A 4XUJA 5CPJD 2BYMA 5B32A 1TZYB 4HGAB 3B0CW 4YM6B 3WTPE 1EQZC 3REHB 3MGSA 4ZBJB 4DQYB 3AN2A 3WKJD 3A1KA 3REKA 3AZMA 3NQUB 3KXBC 4CAYB 3C1CB 4H9OB 3MGPA 1ID3A 1KX4B 3AZND 1AOID 2F8NH 3KUYC 5CPKA 3LJAC 1EQZA 3KXBB 4XZQD 4H9SC 2Y2GA 4J8XD 4J8UD 5B2JA 4UUZB 3AZEB 3X1TD 3W96A 3EPLA 2F8NA 4M6BA 4Z66C 3TU4A 1S32A 1H3OB 5CPJC 4X23D 3LJAB 3W99A 5AV9C 3RELD 2G5HC 3KUYA 5JA4B 1P3LA 5CPJB 2FFFB 5BT1D 3VH5A 3AV1A 3WA9D 4KUDD 1P3IC 3UTBC 3AZNC 1AOIC 3WKJB 5AV9A 1P3GD 2HIOA 4WU8D 3WAAD 3AZLD 5DNMA 4J8XC 5F99C 4J8UC 4R8PD 3AFAD 3REIA 5AVCD 3AZNB 1AOIB 1HQ3A 4X23C 3V9RA 1P3FD 2Y2NA 1B6WA 4CSRA 4XZQB 3MGRD 4J8XB 2Y2PA 2ZY4A 2HUEC 4WZSB 4J8UB 3UTBA 3B0DC 3X1TB 4H9NB 1P34A 2JSSA 4X23B 2AROD 5BT1C 5AV8A 4EO5C 3RELB 3A1IA 3LZ0C 3B0DB 4WJ3C 4KUDC 4WU9A 5DNND 4QLCD 1P3GC 1TAFB 3WAAC 4WU8C 1N1JB 5E5AD 4G92C 1KX3A 3AZLC 2DQNC 5BNXB 4J8WD 4UPKA 3AZIA 3AFAC 1F1EA 4H9QA 5GT3D 5GT0D 3WA9B 1BH9B 5AVCC 4J8VD 4KUDB 2RIQA 5JRGC 1M19D 5AY8D 1P3GB 4WU8B 3MVDA 3X1SC 3WAAB 1PZRA 3AZLB 3MGRC 3VH6T 2NZDA 4LD9D 4XUJD 4R8PB 3AFAB 5AVCB 5B32D 4NE5A 2Y2HA 3F6TA 1R4VA 3X1SB 1P3FB 3MGRB 5JRGA 4H9PB 3REKD 3AZMD 5DNNC 3AV2D 3X1VC 5B40C 4H9RA 2YFVA 3H0MC 3MGPD 4JJNC 2NQBA 2AROB 5G49B 5BNVB 1ID3D 4J8WC 5GT3C 5CPKD 1EQZD 5B0ZA 5DNNB 1M19C 4QLCB 3LZ1C 5AY8C 3REJA 2L5AA 5B2JD 4ZUXA 3LELA 5E5AB 5BO0A 5B31A 3A6NA 2F8ND 3W96D 3TU4D 4LD9C 4XUJC 1S32D 4J8WB 3X1VA 3W98A 5GT3B 5GT0B 5BS7A 4J8VB 3W99D 5B32C 1M19B 5B2IA 2CV5A 5AY8B 3KUYD 3EPKA 2ZY2A 2ZY3A 1P3LD 3MGSC 3AN2C 4LD9B 4XUJB 3KSYA 1Q9CA 2BYMB 3WTPA 3AZMC 1P3PA 5GSUA 5B32B 4Z66D 3AV1D 4E45A 3MGPC 5B32G 1ID3C 4NE3A 5AV9D 3R45A 2HIOD 4DRAA 4Z5TA 3REKB 3AZMB 5CPKC 1P3MA 1M18A 3AV2B 5DNMD 3C1BA 5B2JC 3IP4C 3MGPB 3W96C 3REID 1ID3B 3MNNA 3TU4C 3B0BA 1S32C 1HQ3D 5CPKB 3W99C 1EQZB 1P3ID 3UTBD 5B2JB 5B33A 3W96B 2F8NB 1B67A 3TU4B 1P34D 1P3LC 1S32B 4Z2MH 3B6GA 5F99D 3AZHA 3W99B 2BG1A 5AV8D 3UTAA 3AV1C 3KUYB 4WU9D 1P3LB 3MGQA 1TZYA 2CWEA 2PYOA 3B6FA 4YM6A 2HIOC 2RVQC 3AYWA 5AVBA 4YS3A 5DNMC 2VQRA 4Z66B 3AV1B 3AZID 5C3IC 1P3BC 3REIC 5CPIA 1W2EA 3O62A 1HQ3C 5AV6A 5AV9B 5B1MA 3C1CA 2HIOB 3LZ0D 3MVDD 2BYKA 2NZDD 5DNMB 1KX5A 5CP6A 5C3IB 1JFIB 3REIB 2JE5A 1P34C 3W97A 1HQ3B 1P3OA 3V9RB 1P3AA 4CSRB 5AV8C 1P3BA 1P3IB 5JRGD 3UTBB 2Y2OA 1Z2CB 4WU9C 1P34B 3X1SD 2F2AC 5B24A
chains in the Genus database with same CATH topology
5F99B 3AZJA 2NQBD 1KX3C 5AV8B 1M1AC 1ZLAA 3AZIC 4KHAA 4WU9B 5B0ZD 3REJD 3LELD 2HUEB 2XD1A 3MVDC 3A6ND 2NZDC 3X1VD 5B40D 3AZIB 3W98D 4H9QB 4JJND 3UT9A 2FJ7A 2CV5D 1M1AA 2Y2LA 4EO5B 3LZ0B 1T3UA 3MVDB 2NZDB 4KGCA 3VH6W 3LZ1D 3WTPD 2LY8A 4DRBA 5GSUD 4G92B 4XZQA 1WWIA 2XD5A 1BFMA 2NQBC 5GXQA 5AV5A 5JRGB 4Z5TD 5B0ZC 1M18D 5FUGA 3C1BD 4H9RB 3REJC 3MGSD 2YFVB 4ZUXC 3LELC 3RELA 1BH8A 3AN2D 5B31C 3A6NC 2NQBB 3MNND 3W98C 3AZKA 1TAFA 5BS7C 5B0ZB 5B2IC 3VH5T 2CV5C 3REJB 5B0YA 3LELB 5B33D 5BO0B 5B31B 2Y2JA 3A6NB 1BH9A 3WTPC 5B40B 3X1VB 3B6GD 3W98B 2YFWA 4JJNB 3EPJA 5GSUC 1P3PC 3UTAD 2CV5B 3AZFA 2DF4C 3X1UC 3MGQD 3B6FD 2PYOD 3LZ1B 3WTPB 4Z5TC 1P3MC 1M18C 1U35A 1P3KA 4YS3D 5GSUB 5AVBD 3AYWD 1P3PB 4G91C 3C1BC 1F66A 3AL0C 5CPID 3MNNC 3O62D 5AV6D 5B1MD 3R45B 3AZGA 4Z5TB 5B1LA 2AROA 1M18B 5BNVA 3KWQA 4G91B 3C1BB 3X1UA 1KX5D 5CP6D 3MGSB 3AN2B 5B33C 2RVQD 3MNNB 3W97D 1P3OD 3B6GC 3AZHC 2Y2MA 1P3AD 3UTAC 1P3BD 4WNNA 5B33B 5GT0A 3MGQC 1TZYC 1HTAA 2PYOC 5B24D 5KDMA 3B6FC 4YM6C 3B6GB 3AZJD 4YS3C 5AVBC 3REHC 3AYWC 3UTAB 1ZLAD 3NQJA 2F8NG 5CPIC 3MGQB 3O62C 3B6FB 5AV6C 2PYOB 4Z2MG 5B1MC 4E44A 3C1CC 3AYWB 5AVBB 4YS3B 1KX4C 1KX5C 5CP6C 3B0CT 1ULYA 3UT9D 5CPIB 1KX3D 3AV2A 2FJ7D 3O62B 3REHA 5AV6B 3W97C 1P3OC 1M1AD 5B1MB 3AZEC 1P3AC 2BYKB 3NQUA 1KX5B 4KGCD 5CP6B 4CAYA 4H9OA 3W97B 5B24C 3VH6A 1KX4A 1P3OB 3AZJC 1P3AB 5GXQD 1P3BB 2ZY5A 5AV5D 3KXBA 1ZLAC 4UUZA 3AZEA 5B24B 2Y2KA 2Y2IA 1KU5A 1H3OA 3AZJB 5CHLB 3LJAA 3WKJC 1ZLAB 3H0LC 4H9SA 3AZKD 4KHAB 3UT9C 2FJ7C 5JA4A 4Z66A 5B0YD 5CPJA 4KGCC 2G5IC 4ZUXD 3UT9B 5B31D 1KX3B 4XZQC 2FJ7B 3AZFD 1M1AB 3WKJA 5GXQC 3X1TC 1JFIA 5AV5C 4KGCB 5B2ID 3EPHA 2W8SA 1U35D 1P3KD 1F66D 3RELC 1P3IA 3AZNA 1AOIA 2F8NK 5GXQB 5AV5B 1P3PD 3AZKC 3AZGD 4J8XA 5F99A 5B1LD 4J8UA 4WV4B 5FUGB 3X1TA 4H9NA 3KWQD 3X1UD 5B0YC 2IO5C 1BH8B 3WA9C 4X23A 3EG5B 1P3MD 1A7WA 3AZKB 3AZFC 3VH5W 5B0YB 4NFTA 2IO5B 4R8PC 4AWLC 3P5JB 1N1JA 2UWXA 5BNXA 2YFWB 4ZUXB 3LZ0A 1U35C 1P3KC 1P3FC 3WA9A 4KUDA 1F66C 3AZFB 5B31G 4AWLB 1P3GA 3AZHD 4WU8A 3WAAA 5B2IB 3AZLA 3AZGC 5B1LC 2AROC 4R8PA 1U35B 1P3KB 3AFAA 3KWQC 5AVCA 1F66B 1TZYD 4YM6D 1P3FA 2JCHA 3X1SA 4QLCC 3REHD 3MGRA 3AZGB 4NE6A 4H9PA 5B1LB 5E5AC 3H0RC 3KWQB 3X1UB 5GT0C 3C1CD 4J8VC 1P3MB 5G49A 1KX4D 3FDDA 2J8PA 2ZM5A 5DNNA 3KXBD 4QLCA 4WNNB 5B40A 4JJNA 3AZED 5E5AA 5KDMB 4J8WA 2Y2QA 5GT3A 3KFUG 3LJAD 4J8VA 1M19A 3LZ1A 3NQJB 4HGAC 5AY8A 3REKC 1WWSA 3AZHB 3AV2C 4ZBJC 4LD9A 4XUJA 5CPJD 2BYMA 5B32A 1TZYB 4HGAB 3B0CW 4YM6B 3WTPE 1EQZC 3REHB 3MGSA 4ZBJB 4DQYB 3AN2A 3WKJD 3A1KA 3REKA 3AZMA 3NQUB 3KXBC 4CAYB 3C1CB 4H9OB 3MGPA 1ID3A 1KX4B 3AZND 1AOID 2F8NH 3KUYC 5CPKA 3LJAC 1EQZA 3KXBB 4XZQD 4H9SC 2Y2GA 4J8XD 4J8UD 5B2JA 4UUZB 3AZEB 3X1TD 3W96A 3EPLA 2F8NA 4M6BA 4Z66C 3TU4A 1S32A 1H3OB 5CPJC 4X23D 3LJAB 3W99A 5AV9C 3RELD 2G5HC 3KUYA 5JA4B 1P3LA 5CPJB 2FFFB 5BT1D 3VH5A 3AV1A 3WA9D 4KUDD 1P3IC 3UTBC 3AZNC 1AOIC 3WKJB 5AV9A 1P3GD 2HIOA 4WU8D 3WAAD 3AZLD 5DNMA 4J8XC 5F99C 4J8UC 4R8PD 3AFAD 3REIA 5AVCD 3AZNB 1AOIB 1HQ3A 4X23C 3V9RA 1P3FD 2Y2NA 1B6WA 4CSRA 4XZQB 3MGRD 4J8XB 2Y2PA 2ZY4A 2HUEC 4WZSB 4J8UB 3UTBA 3B0DC 3X1TB 4H9NB 1P34A 2JSSA 4X23B 2AROD 5BT1C 5AV8A 4EO5C 3RELB 3A1IA 3LZ0C 3B0DB 4WJ3C 4KUDC 4WU9A 5DNND 4QLCD 1P3GC 1TAFB 3WAAC 4WU8C 1N1JB 5E5AD 4G92C 1KX3A 3AZLC 2DQNC 5BNXB 4J8WD 4UPKA 3AZIA 3AFAC 1F1EA 4H9QA 5GT3D 5GT0D 3WA9B 1BH9B 5AVCC 4J8VD 4KUDB 2RIQA 5JRGC 1M19D 5AY8D 1P3GB 4WU8B 3MVDA 3X1SC 3WAAB 1PZRA 3AZLB 3MGRC 3VH6T 2NZDA 4LD9D 4XUJD 4R8PB 3AFAB 5AVCB 5B32D 4NE5A 2Y2HA 3F6TA 1R4VA 3X1SB 1P3FB 3MGRB 5JRGA 4H9PB 3REKD 3AZMD 5DNNC 3AV2D 3X1VC 5B40C 4H9RA 2YFVA 3H0MC 3MGPD 4JJNC 2NQBA 2AROB 5G49B 5BNVB 1ID3D 4J8WC 5GT3C 5CPKD 1EQZD 5B0ZA 5DNNB 1M19C 4QLCB 3LZ1C 5AY8C 3REJA 2L5AA 5B2JD 4ZUXA 3LELA 5E5AB 5BO0A 5B31A 3A6NA 2F8ND 3W96D 3TU4D 4LD9C 4XUJC 1S32D 4J8WB 3X1VA 3W98A 5GT3B 5GT0B 5BS7A 4J8VB 3W99D 5B32C 1M19B 5B2IA 2CV5A 5AY8B 3KUYD 3EPKA 2ZY2A 2ZY3A 1P3LD 3MGSC 3AN2C 4LD9B 4XUJB 3KSYA 1Q9CA 2BYMB 3WTPA 3AZMC 1P3PA 5GSUA 5B32B 4Z66D 3AV1D 4E45A 3MGPC 5B32G 1ID3C 4NE3A 5AV9D 3R45A 2HIOD 4DRAA 4Z5TA 3REKB 3AZMB 5CPKC 1P3MA 1M18A 3AV2B 5DNMD 3C1BA 5B2JC 3IP4C 3MGPB 3W96C 3REID 1ID3B 3MNNA 3TU4C 3B0BA 1S32C 1HQ3D 5CPKB 3W99C 1EQZB 1P3ID 3UTBD 5B2JB 5B33A 3W96B 2F8NB 1B67A 3TU4B 1P34D 1P3LC 1S32B 4Z2MH 3B6GA 5F99D 3AZHA 3W99B 2BG1A 5AV8D 3UTAA 3AV1C 3KUYB 4WU9D 1P3LB 3MGQA 1TZYA 2CWEA 2PYOA 3B6FA 4YM6A 2HIOC 2RVQC 3AYWA 5AVBA 4YS3A 5DNMC 2VQRA 4Z66B 3AV1B 3AZID 5C3IC 1P3BC 3REIC 5CPIA 1W2EA 3O62A 1HQ3C 5AV6A 5AV9B 5B1MA 3C1CA 2HIOB 3LZ0D 3MVDD 2BYKA 2NZDD 5DNMB 1KX5A 5CP6A 5C3IB 1JFIB 3REIB 2JE5A 1P34C 3W97A 1HQ3B 1P3OA 3V9RB 1P3AA 4CSRB 5AV8C 1P3BA 1P3IB 5JRGD 3UTBB 2Y2OA 1Z2CB 4WU9C 1P34B 3X1SD 2F2AC 5B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 B;  3AZJ A;  2NQB D;  1KX3 C;  5AV8 B;  1M1A C;  1ZLA A;  3AZI C;  4KHA A;  4WU9 B;  5B0Z D;  3REJ D;  3LEL D;  2HUE B;  3MVD C;  3A6N D;  2NZD C;  3X1V D;  5B40 D;  3AZI B;  3W98 D;  4H9Q B;  4JJN D;  3UT9 A;  2FJ7 A;  2CV5 D;  1M1A A;  4EO5 B;  3LZ0 B;  3MVD B;  2NZD B;  4KGC A;  3VH6 W;  3LZ1 D;  3WTP D;  2LY8 A;  4DRB A;  5GSU D;  4G92 B;  4XZQ A;  1WWI A;  1BFM A;  2NQB C;  5GXQ A;  5AV5 A;  5JRG B;  4Z5T D;  5B0Z C;  1M18 D;  5FUG A;  3C1B D;  4H9R B;  3REJ C;  3MGS D;  2YFV B;  4ZUX C;  3LEL C;  3REL A;  1BH8 A;  3AN2 D;  5B31 C;  3A6N C;  2NQB B;  3MNN D;  3W98 C;  3AZK A;  1TAF A;  5BS7 C;  5B0Z B;  5B2I C;  3VH5 T;  2CV5 C;  3REJ B;  5B0Y A;  3LEL B;  5B33 D;  5BO0 B;  5B31 B;  3A6N B;  1BH9 A;  3WTP C;  5B40 B;  3X1V B;  3B6G D;  3W98 B;  2YFW A;  4JJN B;  1P3P C;  5GSU C;  3UTA D;  2CV5 B;  3AZF A;  3X1U C;  3MGQ D;  3B6F D;  2PYO D;  3LZ1 B;  3WTP B;  4Z5T C;  1P3M C;  1M18 C;  1U35 A;  1P3K A;  4YS3 D;  5GSU B;  5AVB D;  3AYW D;  1P3P B;  4G91 C;  3C1B C;  1F66 A;  5CPI D;  3MNN C;  3O62 D;  5AV6 D;  5B1M D;  3R45 B;  3AZG A;  4Z5T B;  5B1L A;  2ARO A;  1M18 B;  5BNV A;  3KWQ A;  4G91 B;  3C1B B;  3X1U A;  1KX5 D;  5CP6 D;  3MGS B;  3AN2 B;  5B33 C;  2RVQ D;  3MNN B;  3W97 D;  1P3O D;  3B6G C;  3AZH C;  1P3A D;  3UTA C;  1P3B D;  4WNN A;  5B33 B;  5GT0 A;  3MGQ C;  1TZY C;  1HTA A;  2PYO C;  5B24 D;  5KDM A;  3B6F C;  4YM6 C;  3B6G B;  3AZJ D;  4YS3 C;  5AVB C;  3REH C;  3AYW C;  3UTA B;  1ZLA D;  3NQJ A;  2F8N G;  5CPI C;  3MGQ B;  3O62 C;  3B6F B;  5AV6 C;  2PYO B;  4Z2M G;  5B1M C;  4E44 A;  3C1C C;  3AYW B;  5AVB B;  4YS3 B;  1KX4 C;  1KX5 C;  5CP6 C;  3B0C T;  1ULY A;  3UT9 D;  5CPI B;  1KX3 D;  3AV2 A;  2FJ7 D;  3O62 B;  3REH A;  5AV6 B;  3W97 C;  1P3O C;  1M1A D;  5B1M B;  3AZE C;  1P3A C;  2BYK B;  3NQU A;  1KX5 B;  4KGC D;  5CP6 B;  4CAY A;  4H9O A;  3W97 B;  5B24 C;  3VH6 A;  1KX4 A;  1P3O B;  3AZJ C;  1P3A B;  5GXQ D;  1P3B B;  5AV5 D;  3KXB A;  1ZLA C;  4UUZ A;  3AZE A;  5B24 B;  1KU5 A;  1H3O A;  3AZJ B;  5CHL B;  3LJA A;  3WKJ C;  1ZLA B;  4H9S A;  3AZK D;  4KHA B;  3UT9 C;  2FJ7 C;  5JA4 A;  4Z66 A;  5B0Y D;  5CPJ A;  4KGC C;  4ZUX D;  3UT9 B;  5B31 D;  1KX3 B;  4XZQ C;  2FJ7 B;  3AZF D;  1M1A B;  3WKJ A;  5GXQ C;  3X1T C;  1JFI A;  5AV5 C;  4KGC B;  5B2I D;  1U35 D;  1P3K D;  1F66 D;  3REL C;  1P3I A;  3AZN A;  1AOI A;  2F8N K;  5GXQ B;  5AV5 B;  1P3P D;  3AZK C;  3AZG D;  4J8X A;  5F99 A;  5B1L D;  4J8U A;  4WV4 B;  5FUG B;  3X1T A;  4H9N A;  3KWQ D;  3X1U D;  5B0Y C;  2IO5 C;  1BH8 B;  3WA9 C;  4X23 A;  1P3M D;  1A7W A;  3AZK B;  3AZF C;  3VH5 W;  5B0Y B;  4NFT A;  2IO5 B;  4R8P C;  4AWL C;  1N1J A;  5BNX A;  2YFW B;  4ZUX B;  3LZ0 A;  1U35 C;  1P3K C;  1P3F C;  3WA9 A;  4KUD A;  1F66 C;  3AZF B;  5B31 G;  4AWL B;  1P3G A;  3AZH D;  4WU8 A;  3WAA A;  5B2I B;  3AZL A;  3AZG C;  5B1L C;  2ARO C;  4R8P A;  1U35 B;  1P3K B;  3AFA A;  3KWQ C;  5AVC A;  1F66 B;  1TZY D;  4YM6 D;  1P3F A;  3X1S A;  4QLC C;  3REH D;  3MGR A;  3AZG B;  4NE6 A;  4H9P A;  5B1L B;  5E5A C;  3KWQ B;  3X1U B;  5GT0 C;  3C1C D;  4J8V C;  1P3M B;  5G49 A;  1KX4 D;  5DNN A;  3KXB D;  4QLC A;  4WNN B;  5B40 A;  4JJN A;  3AZE D;  5E5A A;  5KDM B;  4J8W A;  5GT3 A;  3LJA D;  4J8V A;  1M19 A;  3LZ1 A;  3NQJ B;  4HGA C;  5AY8 A;  3REK C;  1WWS A;  3AZH B;  3AV2 C;  4ZBJ C;  4LD9 A;  4XUJ A;  5CPJ D;  2BYM A;  5B32 A;  1TZY B;  4HGA B;  3B0C W;  4YM6 B;  3WTP E;  1EQZ C;  3REH B;  3MGS A;  4ZBJ B;  3AN2 A;  3WKJ D;  3REK A;  3AZM A;  3NQU B;  3KXB C;  4CAY B;  3C1C B;  4H9O B;  3MGP A;  1ID3 A;  1KX4 B;  3AZN D;  1AOI D;  2F8N H;  3KUY C;  5CPK A;  3LJA C;  1EQZ A;  3KXB B;  4XZQ D;  4H9S C;  4J8X D;  4J8U D;  5B2J A;  4UUZ B;  3AZE B;  3X1T D;  3W96 A;  2F8N A;  4M6B A;  4Z66 C;  3TU4 A;  1S32 A;  1H3O B;  5CPJ C;  4X23 D;  3LJA B;  3W99 A;  5AV9 C;  3REL D;  3KUY A;  5JA4 B;  1P3L A;  5CPJ B;  5BT1 D;  3VH5 A;  3AV1 A;  3WA9 D;  4KUD D;  1P3I C;  3UTB C;  3AZN C;  1AOI C;  3WKJ B;  5AV9 A;  1P3G D;  2HIO A;  4WU8 D;  3WAA D;  3AZL D;  5DNM A;  4J8X C;  5F99 C;  4J8U C;  4R8P D;  3AFA D;  3REI A;  5AVC D;  3AZN B;  1AOI B;  1HQ3 A;  4X23 C;  3V9R A;  1P3F D;  1B6W A;  4CSR A;  4XZQ B;  3MGR D;  4J8X B;  2HUE C;  4WZS B;  4J8U B;  3UTB A;  3B0D C;  3X1T B;  4H9N B;  1P34 A;  2JSS A;  4X23 B;  2ARO D;  5BT1 C;  5AV8 A;  4EO5 C;  3REL B;  3LZ0 C;  3B0D B;  4KUD C;  4WU9 A;  5DNN D;  4QLC D;  1P3G C;  1TAF B;  3WAA C;  4WU8 C;  1N1J B;  5E5A D;  4G92 C;  1KX3 A;  3AZL C;  5BNX B;  4J8W D;  3AZI A;  3AFA C;  1F1E A;  5GT0 D;  4H9Q A;  5GT3 D;  3WA9 B;  1BH9 B;  5AVC C;  4J8V D;  4KUD B;  1M19 D;  5JRG C;  5AY8 D;  1P3G B;  4WU8 B;  3MVD A;  3X1S C;  3WAA B;  3AZL B;  3MGR C;  3VH6 T;  2NZD A;  4LD9 D;  4XUJ D;  4R8P B;  3AFA B;  5AVC B;  5B32 D;  4NE5 A;  1P3F B;  1R4V A;  3X1S B;  3MGR B;  5JRG A;  4H9P B;  3REK D;  3AZM D;  5DNN C;  3AV2 D;  3X1V C;  5B40 C;  4H9R A;  2YFV A;  3MGP D;  4JJN C;  2NQB A;  2ARO B;  5G49 B;  5BNV B;  1ID3 D;  4J8W C;  5GT3 C;  5CPK D;  1EQZ D;  5B0Z A;  5DNN B;  1M19 C;  4QLC B;  3LZ1 C;  5AY8 C;  3REJ A;  2L5A A;  5B2J D;  4ZUX A;  3LEL A;  5E5A B;  5BO0 A;  5B31 A;  3A6N A;  2F8N D;  3W96 D;  3TU4 D;  4LD9 C;  4XUJ C;  1S32 D;  4J8W B;  3X1V A;  3W98 A;  5GT3 B;  5GT0 B;  5BS7 A;  4J8V B;  3W99 D;  5B32 C;  1M19 B;  5B2I A;  2CV5 A;  5AY8 B;  3KUY D;  1P3L D;  3MGS C;  3AN2 C;  4LD9 B;  4XUJ B;  3KSY A;  1Q9C A;  2BYM B;  3WTP A;  3AZM C;  1P3P A;  5GSU A;  5B32 B;  4Z66 D;  3AV1 D;  4E45 A;  3MGP C;  5B32 G;  1ID3 C;  4NE3 A;  5AV9 D;  3R45 A;  2HIO D;  4DRA A;  4Z5T A;  3REK B;  3AZM B;  5CPK C;  1P3M A;  1M18 A;  3AV2 B;  5DNM D;  3C1B A;  5B2J C;  3MGP B;  3W96 C;  3REI D;  1ID3 B;  3MNN A;  3TU4 C;  3B0B A;  1S32 C;  1HQ3 D;  5CPK B;  3W99 C;  1EQZ B;  1P3I D;  3UTB D;  5B2J B;  5B33 A;  3W96 B;  2F8N B;  1B67 A;  3TU4 B;  1P34 D;  1P3L C;  1S32 B;  4Z2M H;  3B6G A;  5F99 D;  3AZH A;  3W99 B;  5AV8 D;  3UTA A;  3AV1 C;  3KUY B;  4WU9 D;  1P3L B;  3MGQ A;  1TZY A;  2CWE A;  2PYO A;  3B6F A;  4YM6 A;  2HIO C;  2RVQ C;  3AYW A;  5AVB A;  4YS3 A;  5DNM C;  4Z66 B;  3AV1 B;  3AZI D;  5C3I C;  1P3B C;  3REI C;  5CPI A;  3O62 A;  1HQ3 C;  5AV6 A;  5AV9 B;  5B1M A;  3C1C A;  2HIO B;  3LZ0 D;  3MVD D;  2BYK A;  2NZD D;  5DNM B;  1KX5 A;  5CP6 A;  5C3I B;  1JFI B;  3REI B;  1P34 C;  3W97 A;  1HQ3 B;  1P3O A;  3V9R B;  1P3A A;  4CSR B;  5AV8 C;  1P3B A;  1P3I B;  5JRG D;  3UTB B;  4WU9 C;  1P34 B;  3X1S D;  5B24 A; 
#chains in the Genus database with same CATH topology
 5F99 B;  3AZJ A;  2NQB D;  1KX3 C;  5AV8 B;  1M1A C;  1ZLA A;  3AZI C;  4KHA A;  4WU9 B;  5B0Z D;  3REJ D;  3LEL D;  2HUE B;  2XD1 A;  3MVD C;  3A6N D;  2NZD C;  3X1V D;  5B40 D;  3AZI B;  3W98 D;  4H9Q B;  4JJN D;  3UT9 A;  2FJ7 A;  2CV5 D;  1M1A A;  2Y2L A;  4EO5 B;  3LZ0 B;  1T3U A;  3MVD B;  2NZD B;  4KGC A;  3VH6 W;  3LZ1 D;  3WTP D;  2LY8 A;  4DRB A;  5GSU D;  4G92 B;  4XZQ A;  1WWI A;  2XD5 A;  1BFM A;  2NQB C;  5GXQ A;  5AV5 A;  5JRG B;  4Z5T D;  5B0Z C;  1M18 D;  5FUG A;  3C1B D;  4H9R B;  3REJ C;  3MGS D;  2YFV B;  4ZUX C;  3LEL C;  3REL A;  1BH8 A;  3AN2 D;  5B31 C;  3A6N C;  2NQB B;  3MNN D;  3W98 C;  3AZK A;  1TAF A;  5BS7 C;  5B0Z B;  5B2I C;  3VH5 T;  2CV5 C;  3REJ B;  5B0Y A;  3LEL B;  5B33 D;  5BO0 B;  5B31 B;  2Y2J A;  3A6N B;  1BH9 A;  3WTP C;  5B40 B;  3X1V B;  3B6G D;  3W98 B;  2YFW A;  4JJN B;  3EPJ A;  5GSU C;  1P3P C;  3UTA D;  2CV5 B;  3AZF A;  2DF4 C;  3X1U C;  3MGQ D;  3B6F D;  2PYO D;  3LZ1 B;  3WTP B;  4Z5T C;  1P3M C;  1M18 C;  1U35 A;  1P3K A;  4YS3 D;  5GSU B;  5AVB D;  3AYW D;  1P3P B;  4G91 C;  3C1B C;  1F66 A;  3AL0 C;  5CPI D;  3MNN C;  3O62 D;  5AV6 D;  5B1M D;  3R45 B;  3AZG A;  4Z5T B;  5B1L A;  2ARO A;  1M18 B;  5BNV A;  3KWQ A;  4G91 B;  3C1B B;  3X1U A;  1KX5 D;  5CP6 D;  3MGS B;  3AN2 B;  5B33 C;  2RVQ D;  3MNN B;  3W97 D;  1P3O D;  3B6G C;  3AZH C;  2Y2M A;  1P3A D;  3UTA C;  1P3B D;  4WNN A;  5B33 B;  5GT0 A;  3MGQ C;  1TZY C;  1HTA A;  2PYO C;  5B24 D;  5KDM A;  3B6F C;  4YM6 C;  3B6G B;  3AZJ D;  4YS3 C;  5AVB C;  3REH C;  3AYW C;  3UTA B;  1ZLA D;  3NQJ A;  2F8N G;  5CPI C;  3MGQ B;  3O62 C;  3B6F B;  5AV6 C;  2PYO B;  4Z2M G;  5B1M C;  4E44 A;  3C1C C;  3AYW B;  5AVB B;  4YS3 B;  1KX4 C;  1KX5 C;  5CP6 C;  3B0C T;  1ULY A;  3UT9 D;  5CPI B;  1KX3 D;  3AV2 A;  2FJ7 D;  3O62 B;  3REH A;  5AV6 B;  3W97 C;  1P3O C;  1M1A D;  5B1M B;  3AZE C;  1P3A C;  2BYK B;  3NQU A;  1KX5 B;  4KGC D;  5CP6 B;  4CAY A;  4H9O A;  3W97 B;  5B24 C;  3VH6 A;  1KX4 A;  1P3O B;  3AZJ C;  1P3A B;  5GXQ D;  1P3B B;  2ZY5 A;  5AV5 D;  3KXB A;  1ZLA C;  4UUZ A;  3AZE A;  5B24 B;  2Y2K A;  2Y2I A;  1KU5 A;  1H3O A;  3AZJ B;  5CHL B;  3LJA A;  3WKJ C;  1ZLA B;  3H0L C;  4H9S A;  3AZK D;  4KHA B;  3UT9 C;  2FJ7 C;  5JA4 A;  4Z66 A;  5B0Y D;  5CPJ A;  4KGC C;  2G5I C;  4ZUX D;  3UT9 B;  5B31 D;  1KX3 B;  4XZQ C;  2FJ7 B;  3AZF D;  1M1A B;  3WKJ A;  5GXQ C;  3X1T C;  1JFI A;  5AV5 C;  4KGC B;  5B2I D;  3EPH A;  2W8S A;  1U35 D;  1P3K D;  1F66 D;  3REL C;  1P3I A;  3AZN A;  1AOI A;  2F8N K;  5GXQ B;  5AV5 B;  1P3P D;  3AZK C;  3AZG D;  4J8X A;  5F99 A;  5B1L D;  4J8U A;  4WV4 B;  5FUG B;  3X1T A;  4H9N A;  3KWQ D;  3X1U D;  5B0Y C;  2IO5 C;  1BH8 B;  3WA9 C;  4X23 A;  3EG5 B;  1P3M D;  1A7W A;  3AZK B;  3AZF C;  3VH5 W;  5B0Y B;  4NFT A;  2IO5 B;  4R8P C;  4AWL C;  3P5J B;  1N1J A;  2UWX A;  5BNX A;  2YFW B;  4ZUX B;  3LZ0 A;  1U35 C;  1P3K C;  1P3F C;  3WA9 A;  4KUD A;  1F66 C;  3AZF B;  5B31 G;  4AWL B;  1P3G A;  3AZH D;  4WU8 A;  3WAA A;  5B2I B;  3AZL A;  3AZG C;  5B1L C;  2ARO C;  4R8P A;  1U35 B;  1P3K B;  3AFA A;  3KWQ C;  5AVC A;  1F66 B;  1TZY D;  4YM6 D;  1P3F A;  2JCH A;  3X1S A;  4QLC C;  3REH D;  3MGR A;  3AZG B;  4NE6 A;  4H9P A;  5B1L B;  5E5A C;  3H0R C;  3KWQ B;  3X1U B;  5GT0 C;  3C1C D;  4J8V C;  1P3M B;  5G49 A;  1KX4 D;  3FDD A;  2J8P A;  2ZM5 A;  5DNN A;  3KXB D;  4QLC A;  4WNN B;  5B40 A;  4JJN A;  3AZE D;  5E5A A;  5KDM B;  4J8W A;  2Y2Q A;  5GT3 A;  3KFU G;  3LJA D;  4J8V A;  1M19 A;  3LZ1 A;  3NQJ B;  4HGA C;  5AY8 A;  3REK C;  1WWS A;  3AZH B;  3AV2 C;  4ZBJ C;  4LD9 A;  4XUJ A;  5CPJ D;  2BYM A;  5B32 A;  1TZY B;  4HGA B;  3B0C W;  4YM6 B;  3WTP E;  1EQZ C;  3REH B;  3MGS A;  4ZBJ B;  4DQY B;  3AN2 A;  3WKJ D;  3A1K A;  3REK A;  3AZM A;  3NQU B;  3KXB C;  4CAY B;  3C1C B;  4H9O B;  3MGP A;  1ID3 A;  1KX4 B;  3AZN D;  1AOI D;  2F8N H;  3KUY C;  5CPK A;  3LJA C;  1EQZ A;  3KXB B;  4XZQ D;  4H9S C;  2Y2G A;  4J8X D;  4J8U D;  5B2J A;  4UUZ B;  3AZE B;  3X1T D;  3W96 A;  3EPL A;  2F8N A;  4M6B A;  4Z66 C;  3TU4 A;  1S32 A;  1H3O B;  5CPJ C;  4X23 D;  3LJA B;  3W99 A;  5AV9 C;  3REL D;  2G5H C;  3KUY A;  5JA4 B;  1P3L A;  5CPJ B;  2FFF B;  5BT1 D;  3VH5 A;  3AV1 A;  3WA9 D;  4KUD D;  1P3I C;  3UTB C;  3AZN C;  1AOI C;  3WKJ B;  5AV9 A;  1P3G D;  2HIO A;  4WU8 D;  3WAA D;  3AZL D;  5DNM A;  4J8X C;  5F99 C;  4J8U C;  4R8P D;  3AFA D;  3REI A;  5AVC D;  3AZN B;  1AOI B;  1HQ3 A;  4X23 C;  3V9R A;  1P3F D;  2Y2N A;  1B6W A;  4CSR A;  4XZQ B;  3MGR D;  4J8X B;  2Y2P A;  2ZY4 A;  2HUE C;  4WZS B;  4J8U B;  3UTB A;  3B0D C;  3X1T B;  4H9N B;  1P34 A;  2JSS A;  4X23 B;  2ARO D;  5BT1 C;  5AV8 A;  4EO5 C;  3REL B;  3A1I A;  3LZ0 C;  3B0D B;  4WJ3 C;  4KUD C;  4WU9 A;  5DNN D;  4QLC D;  1P3G C;  1TAF B;  3WAA C;  4WU8 C;  1N1J B;  5E5A D;  4G92 C;  1KX3 A;  3AZL C;  2DQN C;  5BNX B;  4J8W D;  4UPK A;  3AZI A;  3AFA C;  1F1E A;  4H9Q A;  5GT3 D;  5GT0 D;  3WA9 B;  1BH9 B;  5AVC C;  4J8V D;  4KUD B;  2RIQ A;  5JRG C;  1M19 D;  5AY8 D;  1P3G B;  4WU8 B;  3MVD A;  3X1S C;  3WAA B;  1PZR A;  3AZL B;  3MGR C;  3VH6 T;  2NZD A;  4LD9 D;  4XUJ D;  4R8P B;  3AFA B;  5AVC B;  5B32 D;  4NE5 A;  2Y2H A;  3F6T A;  1R4V A;  3X1S B;  1P3F B;  3MGR B;  5JRG A;  4H9P B;  3REK D;  3AZM D;  5DNN C;  3AV2 D;  3X1V C;  5B40 C;  4H9R A;  2YFV A;  3H0M C;  3MGP D;  4JJN C;  2NQB A;  2ARO B;  5G49 B;  5BNV B;  1ID3 D;  4J8W C;  5GT3 C;  5CPK D;  1EQZ D;  5B0Z A;  5DNN B;  1M19 C;  4QLC B;  3LZ1 C;  5AY8 C;  3REJ A;  2L5A A;  5B2J D;  4ZUX A;  3LEL A;  5E5A B;  5BO0 A;  5B31 A;  3A6N A;  2F8N D;  3W96 D;  3TU4 D;  4LD9 C;  4XUJ C;  1S32 D;  4J8W B;  3X1V A;  3W98 A;  5GT3 B;  5GT0 B;  5BS7 A;  4J8V B;  3W99 D;  5B32 C;  1M19 B;  5B2I A;  2CV5 A;  5AY8 B;  3KUY D;  3EPK A;  2ZY2 A;  2ZY3 A;  1P3L D;  3MGS C;  3AN2 C;  4LD9 B;  4XUJ B;  3KSY A;  1Q9C A;  2BYM B;  3WTP A;  3AZM C;  1P3P A;  5GSU A;  5B32 B;  4Z66 D;  3AV1 D;  4E45 A;  3MGP C;  5B32 G;  1ID3 C;  4NE3 A;  5AV9 D;  3R45 A;  2HIO D;  4DRA A;  4Z5T A;  3REK B;  3AZM B;  5CPK C;  1P3M A;  1M18 A;  3AV2 B;  5DNM D;  3C1B A;  5B2J C;  3IP4 C;  3MGP B;  3W96 C;  3REI D;  1ID3 B;  3MNN A;  3TU4 C;  3B0B A;  1S32 C;  1HQ3 D;  5CPK B;  3W99 C;  1EQZ B;  1P3I D;  3UTB D;  5B2J B;  5B33 A;  3W96 B;  2F8N B;  1B67 A;  3TU4 B;  1P34 D;  1P3L C;  1S32 B;  4Z2M H;  3B6G A;  5F99 D;  3AZH A;  3W99 B;  2BG1 A;  5AV8 D;  3UTA A;  3AV1 C;  3KUY B;  4WU9 D;  1P3L B;  3MGQ A;  1TZY A;  2CWE A;  2PYO A;  3B6F A;  4YM6 A;  2HIO C;  2RVQ C;  3AYW A;  5AVB A;  4YS3 A;  5DNM C;  2VQR A;  4Z66 B;  3AV1 B;  3AZI D;  5C3I C;  1P3B C;  3REI C;  5CPI A;  1W2E A;  3O62 A;  1HQ3 C;  5AV6 A;  5AV9 B;  5B1M A;  3C1C A;  2HIO B;  3LZ0 D;  3MVD D;  2BYK A;  2NZD D;  5DNM B;  1KX5 A;  5CP6 A;  5C3I B;  1JFI B;  3REI B;  2JE5 A;  1P34 C;  3W97 A;  1HQ3 B;  1P3O A;  3V9R B;  1P3A A;  4CSR B;  5AV8 C;  1P3B A;  1P3I B;  5JRG D;  3UTB B;  2Y2O A;  1Z2C B;  4WU9 C;  1P34 B;  3X1S D;  2F2A C;  5B24 A; 
#chains in the Genus database with same CATH homology
 5F99 B;  3AZJ A;  2NQB D;  1KX3 C;  5AV8 B;  1M1A C;  1ZLA A;  3AZI C;  4KHA A;  4WU9 B;  5B0Z D;  3REJ D;  3LEL D;  2HUE B;  2XD1 A;  3MVD C;  3A6N D;  2NZD C;  3X1V D;  5B40 D;  3AZI B;  3W98 D;  4H9Q B;  4JJN D;  3UT9 A;  2FJ7 A;  2CV5 D;  1M1A A;  2Y2L A;  4EO5 B;  3LZ0 B;  1T3U A;  3MVD B;  2NZD B;  4KGC A;  3VH6 W;  3LZ1 D;  3WTP D;  2LY8 A;  4DRB A;  5GSU D;  4G92 B;  4XZQ A;  1WWI A;  2XD5 A;  1BFM A;  2NQB C;  5GXQ A;  5AV5 A;  5JRG B;  4Z5T D;  5B0Z C;  1M18 D;  5FUG A;  3C1B D;  4H9R B;  3REJ C;  3MGS D;  2YFV B;  4ZUX C;  3LEL C;  3REL A;  1BH8 A;  3AN2 D;  5B31 C;  3A6N C;  2NQB B;  3MNN D;  3W98 C;  3AZK A;  1TAF A;  5BS7 C;  5B0Z B;  5B2I C;  3VH5 T;  2CV5 C;  3REJ B;  5B0Y A;  3LEL B;  5B33 D;  5BO0 B;  5B31 B;  2Y2J A;  3A6N B;  1BH9 A;  3WTP C;  5B40 B;  3X1V B;  3B6G D;  3W98 B;  2YFW A;  4JJN B;  3EPJ A;  5GSU C;  1P3P C;  3UTA D;  2CV5 B;  3AZF A;  2DF4 C;  3X1U C;  3MGQ D;  3B6F D;  2PYO D;  3LZ1 B;  3WTP B;  4Z5T C;  1P3M C;  1M18 C;  1U35 A;  1P3K A;  4YS3 D;  5GSU B;  5AVB D;  3AYW D;  1P3P B;  4G91 C;  3C1B C;  1F66 A;  3AL0 C;  5CPI D;  3MNN C;  3O62 D;  5AV6 D;  5B1M D;  3R45 B;  3AZG A;  4Z5T B;  5B1L A;  2ARO A;  1M18 B;  5BNV A;  3KWQ A;  4G91 B;  3C1B B;  3X1U A;  1KX5 D;  5CP6 D;  3MGS B;  3AN2 B;  5B33 C;  2RVQ D;  3MNN B;  3W97 D;  1P3O D;  3B6G C;  3AZH C;  2Y2M A;  1P3A D;  3UTA C;  1P3B D;  4WNN A;  5B33 B;  5GT0 A;  3MGQ C;  1TZY C;  1HTA A;  2PYO C;  5B24 D;  5KDM A;  3B6F C;  4YM6 C;  3B6G B;  3AZJ D;  4YS3 C;  5AVB C;  3REH C;  3AYW C;  3UTA B;  1ZLA D;  3NQJ A;  2F8N G;  5CPI C;  3MGQ B;  3O62 C;  3B6F B;  5AV6 C;  2PYO B;  4Z2M G;  5B1M C;  4E44 A;  3C1C C;  3AYW B;  5AVB B;  4YS3 B;  1KX4 C;  1KX5 C;  5CP6 C;  3B0C T;  1ULY A;  3UT9 D;  5CPI B;  1KX3 D;  3AV2 A;  2FJ7 D;  3O62 B;  3REH A;  5AV6 B;  3W97 C;  1P3O C;  1M1A D;  5B1M B;  3AZE C;  1P3A C;  2BYK B;  3NQU A;  1KX5 B;  4KGC D;  5CP6 B;  4CAY A;  4H9O A;  3W97 B;  5B24 C;  3VH6 A;  1KX4 A;  1P3O B;  3AZJ C;  1P3A B;  5GXQ D;  1P3B B;  2ZY5 A;  5AV5 D;  3KXB A;  1ZLA C;  4UUZ A;  3AZE A;  5B24 B;  2Y2K A;  2Y2I A;  1KU5 A;  1H3O A;  3AZJ B;  5CHL B;  3LJA A;  3WKJ C;  1ZLA B;  3H0L C;  4H9S A;  3AZK D;  4KHA B;  3UT9 C;  2FJ7 C;  5JA4 A;  4Z66 A;  5B0Y D;  5CPJ A;  4KGC C;  2G5I C;  4ZUX D;  3UT9 B;  5B31 D;  1KX3 B;  4XZQ C;  2FJ7 B;  3AZF D;  1M1A B;  3WKJ A;  5GXQ C;  3X1T C;  1JFI A;  5AV5 C;  4KGC B;  5B2I D;  3EPH A;  2W8S A;  1U35 D;  1P3K D;  1F66 D;  3REL C;  1P3I A;  3AZN A;  1AOI A;  2F8N K;  5GXQ B;  5AV5 B;  1P3P D;  3AZK C;  3AZG D;  4J8X A;  5F99 A;  5B1L D;  4J8U A;  4WV4 B;  5FUG B;  3X1T A;  4H9N A;  3KWQ D;  3X1U D;  5B0Y C;  2IO5 C;  1BH8 B;  3WA9 C;  4X23 A;  3EG5 B;  1P3M D;  1A7W A;  3AZK B;  3AZF C;  3VH5 W;  5B0Y B;  4NFT A;  2IO5 B;  4R8P C;  4AWL C;  3P5J B;  1N1J A;  2UWX A;  5BNX A;  2YFW B;  4ZUX B;  3LZ0 A;  1U35 C;  1P3K C;  1P3F C;  3WA9 A;  4KUD A;  1F66 C;  3AZF B;  5B31 G;  4AWL B;  1P3G A;  3AZH D;  4WU8 A;  3WAA A;  5B2I B;  3AZL A;  3AZG C;  5B1L C;  2ARO C;  4R8P A;  1U35 B;  1P3K B;  3AFA A;  3KWQ C;  5AVC A;  1F66 B;  1TZY D;  4YM6 D;  1P3F A;  2JCH A;  3X1S A;  4QLC C;  3REH D;  3MGR A;  3AZG B;  4NE6 A;  4H9P A;  5B1L B;  5E5A C;  3H0R C;  3KWQ B;  3X1U B;  5GT0 C;  3C1C D;  4J8V C;  1P3M B;  5G49 A;  1KX4 D;  3FDD A;  2J8P A;  2ZM5 A;  5DNN A;  3KXB D;  4QLC A;  4WNN B;  5B40 A;  4JJN A;  3AZE D;  5E5A A;  5KDM B;  4J8W A;  2Y2Q A;  5GT3 A;  3KFU G;  3LJA D;  4J8V A;  1M19 A;  3LZ1 A;  3NQJ B;  4HGA C;  5AY8 A;  3REK C;  1WWS A;  3AZH B;  3AV2 C;  4ZBJ C;  4LD9 A;  4XUJ A;  5CPJ D;  2BYM A;  5B32 A;  1TZY B;  4HGA B;  3B0C W;  4YM6 B;  3WTP E;  1EQZ C;  3REH B;  3MGS A;  4ZBJ B;  4DQY B;  3AN2 A;  3WKJ D;  3A1K A;  3REK A;  3AZM A;  3NQU B;  3KXB C;  4CAY B;  3C1C B;  4H9O B;  3MGP A;  1ID3 A;  1KX4 B;  3AZN D;  1AOI D;  2F8N H;  3KUY C;  5CPK A;  3LJA C;  1EQZ A;  3KXB B;  4XZQ D;  4H9S C;  2Y2G A;  4J8X D;  4J8U D;  5B2J A;  4UUZ B;  3AZE B;  3X1T D;  3W96 A;  3EPL A;  2F8N A;  4M6B A;  4Z66 C;  3TU4 A;  1S32 A;  1H3O B;  5CPJ C;  4X23 D;  3LJA B;  3W99 A;  5AV9 C;  3REL D;  2G5H C;  3KUY A;  5JA4 B;  1P3L A;  5CPJ B;  2FFF B;  5BT1 D;  3VH5 A;  3AV1 A;  3WA9 D;  4KUD D;  1P3I C;  3UTB C;  3AZN C;  1AOI C;  3WKJ B;  5AV9 A;  1P3G D;  2HIO A;  4WU8 D;  3WAA D;  3AZL D;  5DNM A;  4J8X C;  5F99 C;  4J8U C;  4R8P D;  3AFA D;  3REI A;  5AVC D;  3AZN B;  1AOI B;  1HQ3 A;  4X23 C;  3V9R A;  1P3F D;  2Y2N A;  1B6W A;  4CSR A;  4XZQ B;  3MGR D;  4J8X B;  2Y2P A;  2ZY4 A;  2HUE C;  4WZS B;  4J8U B;  3UTB A;  3B0D C;  3X1T B;  4H9N B;  1P34 A;  2JSS A;  4X23 B;  2ARO D;  5BT1 C;  5AV8 A;  4EO5 C;  3REL B;  3A1I A;  3LZ0 C;  3B0D B;  4WJ3 C;  4KUD C;  4WU9 A;  5DNN D;  4QLC D;  1P3G C;  1TAF B;  3WAA C;  4WU8 C;  1N1J B;  5E5A D;  4G92 C;  1KX3 A;  3AZL C;  2DQN C;  5BNX B;  4J8W D;  4UPK A;  3AZI A;  3AFA C;  1F1E A;  4H9Q A;  5GT3 D;  5GT0 D;  3WA9 B;  1BH9 B;  5AVC C;  4J8V D;  4KUD B;  2RIQ A;  5JRG C;  1M19 D;  5AY8 D;  1P3G B;  4WU8 B;  3MVD A;  3X1S C;  3WAA B;  1PZR A;  3AZL B;  3MGR C;  3VH6 T;  2NZD A;  4LD9 D;  4XUJ D;  4R8P B;  3AFA B;  5AVC B;  5B32 D;  4NE5 A;  2Y2H A;  3F6T A;  1R4V A;  3X1S B;  1P3F B;  3MGR B;  5JRG A;  4H9P B;  3REK D;  3AZM D;  5DNN C;  3AV2 D;  3X1V C;  5B40 C;  4H9R A;  2YFV A;  3H0M C;  3MGP D;  4JJN C;  2NQB A;  2ARO B;  5G49 B;  5BNV B;  1ID3 D;  4J8W C;  5GT3 C;  5CPK D;  1EQZ D;  5B0Z A;  5DNN B;  1M19 C;  4QLC B;  3LZ1 C;  5AY8 C;  3REJ A;  2L5A A;  5B2J D;  4ZUX A;  3LEL A;  5E5A B;  5BO0 A;  5B31 A;  3A6N A;  2F8N D;  3W96 D;  3TU4 D;  4LD9 C;  4XUJ C;  1S32 D;  4J8W B;  3X1V A;  3W98 A;  5GT3 B;  5GT0 B;  5BS7 A;  4J8V B;  3W99 D;  5B32 C;  1M19 B;  5B2I A;  2CV5 A;  5AY8 B;  3KUY D;  3EPK A;  2ZY2 A;  2ZY3 A;  1P3L D;  3MGS C;  3AN2 C;  4LD9 B;  4XUJ B;  3KSY A;  1Q9C A;  2BYM B;  3WTP A;  3AZM C;  1P3P A;  5GSU A;  5B32 B;  4Z66 D;  3AV1 D;  4E45 A;  3MGP C;  5B32 G;  1ID3 C;  4NE3 A;  5AV9 D;  3R45 A;  2HIO D;  4DRA A;  4Z5T A;  3REK B;  3AZM B;  5CPK C;  1P3M A;  1M18 A;  3AV2 B;  5DNM D;  3C1B A;  5B2J C;  3IP4 C;  3MGP B;  3W96 C;  3REI D;  1ID3 B;  3MNN A;  3TU4 C;  3B0B A;  1S32 C;  1HQ3 D;  5CPK B;  3W99 C;  1EQZ B;  1P3I D;  3UTB D;  5B2J B;  5B33 A;  3W96 B;  2F8N B;  1B67 A;  3TU4 B;  1P34 D;  1P3L C;  1S32 B;  4Z2M H;  3B6G A;  5F99 D;  3AZH A;  3W99 B;  2BG1 A;  5AV8 D;  3UTA A;  3AV1 C;  3KUY B;  4WU9 D;  1P3L B;  3MGQ A;  1TZY A;  2CWE A;  2PYO A;  3B6F A;  4YM6 A;  2HIO C;  2RVQ C;  3AYW A;  5AVB A;  4YS3 A;  5DNM C;  2VQR A;  4Z66 B;  3AV1 B;  3AZI D;  5C3I C;  1P3B C;  3REI C;  5CPI A;  1W2E A;  3O62 A;  1HQ3 C;  5AV6 A;  5AV9 B;  5B1M A;  3C1C A;  2HIO B;  3LZ0 D;  3MVD D;  2BYK A;  2NZD D;  5DNM B;  1KX5 A;  5CP6 A;  5C3I B;  1JFI B;  3REI B;  2JE5 A;  1P34 C;  3W97 A;  1HQ3 B;  1P3O A;  3V9R B;  1P3A A;  4CSR B;  5AV8 C;  1P3B A;  1P3I B;  5JRG D;  3UTB B;  2Y2O A;  1Z2C B;  4WU9 C;  1P34 B;  3X1S D;  2F2A C;  5B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...