3VH5A

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
100
structure length
100
Chain Sequence
b'AGGEQRELLIQRLRAAVHYTTGALAQDVAEDKGVLFSKQTVAAISEITFRQAENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CENP-S
molecule tags Dna binding protein
source organism Gallus gallus
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
total genus 42
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh5A00
1P3OA 1P3GA 3B0DC 3LZ1D 1HQ3C 3UT9C 3MGRC 5CPJC 3UT9B 3KUYA 3MGRB 5CPJB 3W98D 1P3LB 5CPIB 2RVQC 5B40B 3LJAC 2JSSA 5AV9A 1KX4C 1ID3D 3AZMD 4KGCC 2YFVA 4X23A 4XUJA 5DNNB 5AY8B 4J8XC 4J8VD 3A6NB 4KGCB 5AV5A 4J8XB 3A6NC 5KDMA 3REKC 1BH9B 3VH5T 3VH5A 4ZUXD 4CAYB 3RELA 3REHA 1F66A 5B2IA 4H9SC 3LZ0C 4J8XD 3AN2B 1P3MA 2NQBB 5B1MB 5CPID 3AZKD 3X1SD 5CHLB 1P3BD 4WU9B 3AZNB 5AV6C 4JJNC 1M18C 4XZQA 5B1MA 3LELA 3X1SA 5GSUB 2PYOB 3MGSD 3AV1B 1AOIA 2CV5D 4H9RA 5BNXA 3AZIC 5GXQA 4Z66A 3X1VD 5AV6D 4JJND 1M18D 3AN2D 2HIOD 3MGSC 3AZND 1P3LA 3WAAB 1P3MB 2NQBA 3UTBC 1P3AC 1U35A 3UTBB 3B0BA 4LD9D 5F99A 3X1VC 1F1EA 2HIOB 5C3IC 3RELB 1F66B 2BYKA 4KUDD 5CPKC 5BNVA 4E45A 3W97C 3C1CA 5CP6D 3UTAB 5B2JC 3AZJB 3LJAB 5B40C 3AZMA 1ID3A 5B2JB 3AFAA 4H9NA 2IO5C 4H9QB 4NE5A 5B33A 4YM6A 4LD9C 1P34A 1KX5D 3MNNA 4J8WD 3UTAD 1P3PA 1P3KD 5B0YA 3MGPD 1BFMA 5B2JD 4R8PB 3WTPA 5CP6A 1KX3B 5B0ZC 3MNND 3WTPC 5BT1C 5GT3A 5CP6B 5AVCA 3WKJB 5B0YC 5B33B 1B6WA 1P3PC 3V9RA 4YS3C 5B0YB 5B1LD 4YS3B 5AVBC 1P3KC 1M19A 4LD9A 3AZGA 5B33C 4HGAC 4Z5TD 2AROD 4G91C 2HIOA 5GSUC 2PYOC 1M1AD 3WTPD 5BT1D 1N1JB 5FUGA 5B0YD 4R8PD 4Z66D 4HGAB 5B31A 5B1LC 3REIA 4ZUXB 5AVBD 1U35C 1KX4B 4WU9A 1M1AB 1P3LC 2CWEA 5GSUD 2PYOD 1M1AC 3WAAA 3VH5W 3AZKB 4Z66B 3X1TA 5GT0C 5DNMA 3AZLB 4WU9D 1P3AB 4Z5TB 3X1VB 3REID 5B2ID 5DNMB 3REHD 3LELB 1ZLAD 4QLCA 2CV5B 4Z5TA 3VH6A 3X1TC 2FJ7B 4WZSB 4H9OA 5B1MC 3REIB 5B2IB 5BO0B 4AWLB 1JFIA 3AV1C 1BH9A 3LZ0A 3AZJD 2FJ7D 3B6GD 5AV8B 5B1MD 5FUGB 5E5AC 5JRGA 3NQJA 3C1BC 3MGPB 3AYWA 5AVBA 5AY8A 5DNNA 3W99B 1KX4A 4YS3A 2L5AA 2HUEB 3WA9A 3AFAD 3LJAA 3AZMB 1KX5B 5GT3C 5E5AD 3MGRA 5CPJA 3W96A 5GT3B 5B0ZA 3W96C 1P3GC 1P34B 5JRGD 3WA9B 3NQUB 3C1BD 1P3GB 1KX3D 5AV8D 3WA9C 2IO5B 3VH6T 5AY8C 5DNNC 5B24C 3W96B 5BO0A 3C1BA 4UUZA 3KWQA 5BNVB 5GT3D 3B6FB 1HTAA 1EQZC 2YFWB 3O62D 4WU8A 5AVCB 5B24B 1EQZB 3NQUA 5JRGC 5B2JA 3AFAB 1KX3C 3LZ1C 1TAFA 5GXQD 3WTPB 5JA4B 3AZED 1JFIB 3X1VA 3AV1A 1H3OB 3B0CT 1P3AA 3UTBA 2NQBC 5AVBB 3AZHD 3X1TB 3MGSA 4EO5B 3A6ND 1P3BA 1P3KB 4EO5C 4H9RB 5BNXB 3AV2D 1P3ID 2FJ7A 4NE6A 3TU4D 1U35B 1TZYD 3X1SC 3KXBD 5B1LB 3REJD 1P3BC 5BS7A 1P3FB 5GT0A 5AV5D 3WAAC 1M1AA 3AZHB 4XUJB 1P3IA 1WWSA 5GT0B 4X23D 3AZLC 3TU4C 5B1LA 1TZYC 5B31C 5KDMB 3KSYA 3RELC 1F66C 4WNNA 1KX3A 4WU8B 3KUYD 3WAAD 2HIOC 5C3IB 4WU8C 5AV9B 2NZDD 3MVDB 3MNNB 3KWQC 1Q9CA 3AZLD 5AV5B 4X23C 4J8XA 1P3KA 1M19C 4KGCA 5B24A 1P3AD 4AWLC 5AVCC 4YM6D 4UUZB 3KWQB 5B0ZB 3KUYC 4LD9B 2BYMA 3REHB 4KUDC 4CAYA 3UT9A 3W97D 1N1JA 5CP6C 1P3PB 1M19D 3UT9D 1HQ3D 3AZGB 5CPJD 3MGRD 3AYWC 4YM6C 5AVCD 3W98A 4H9NB 4J8WC 1KX4D 5AV8A 1ID3C 3MGPC 5B40A 3AZMC 4J8VB 4CSRB 4KGCD 1WWIA 5E5AA 3AZEB 3W99C 3W97A 5B0ZD 1ULYA 5G49A 5CPKA 4Z2MG 2NZDA 3REKD 1ID3B 4QLCD 3B0DB 3AYWD 3UTAA 1P3PD 4ZUXC 2BYMB 1KX5A 3LZ0D 2LY8A 5B31G 1P3IB 3W99D 4H9QA 3AZFB 4Z5TC 5CPIC 3AZKC 3WTPE 3B6FC 4QLCC 3LZ1B 3TU4B 4Z66C 4Z2MH 5JRGB 2BYKB 4J8UB 3REKB 2CV5C 1ZLAA 3AZID 5DNMC 3AZNA 3LELC 1S32C 3B6FD 5GT0D 1S32B 3AN2C 3AV2A 4WU9C 4H9OB 4XUJD 1S32A 3REIC 3KUYB 3AZNC 5GXQB 5B2IC 3REHC 4ZBJB 1ZLAC 3UTBD 5DNMD 3LELD 1ZLAB 1S32D 5GSUA 3X1SB 3AZEA 2PYOA 3B0CW 3A6NA 3X1TD 5CPKD 3AZGC 4XZQB 4G92C 2YFWA 3X1UC 2F8NH 4XUJC 3V9RB 3X1UB 5B32B 5B40D 3AZKA 3MGSB 3AV1D 1KX5C 4R8PA 3B6GC 1HQ3A 4ZUXA 2HUEC 3B6GB 3UTAC 3O62B 3AZGD 5B31B 3WKJA 3X1UD 3C1CD 3KXBB 3REJB 2AROA 3MNNC 5F99D 1P34C 3W99A 3WKJD 5G49B 4E44A 5CPKB 4NE3A 4YS3D 3AFAC 4J8WA 3NQJB 2F8NB 3C1CC 4H9PA 4KUDB 3R45B 3W96D 5B33D 5F99B 1BH8B 2AROC 1P3OB 4J8UC 5F99C 1P34D 3WKJC 3LZ0B 3WA9D 3C1CB 5B24D 4KUDA 4R8PC 3B6GA 4KHAA 1AOID 3MVDA 4J8WB 1U35D 4YM6B 1P3LD 4J8UD 3X1UA 3AZFD 1R4VA 1KU5A 4WNNB 2F8ND 5GXQC 3AZJA 3AZIA 1AOIB 1P3MD 3AZEC 3KXBA 3REJA 4WV4B 1AOIC 1HQ3B 5B32G 2NQBD 3AZHC 1TZYA 3TU4A 1P3BB 4XZQC 4G92B 5AV6A 4JJNA 3AZLA 1M18A 3AZFC 1P3FA 3AV2C 3AN2A 1P3IC 1P3FC 3AZFA 1P3MC 3AV2B 3AZHA 4H9SA 5BS7C 4M6BA 4QLCB 2CV5A 1TAFB 4XZQD 4DRAA 3KXBC 3REJC 1TZYB 3REKA 1BH8A 3AZJC 2FJ7C 5AV5C 4X23B 1P3FD 3W97B 2F8NG 3B6FA 4CSRA 1M19B 5CPIA 3VH6W 5AV9C 5AV6B 3MVDC 4JJNB 1M18B 4DRBA 5B32D 5B31D 3MGQD 2YFVB 3RELD 1F66D 1B67A 2AROB 1P3OC 4J8VA 1H3OA 4ZBJC 4J8UA 4WU8D 3R45A 3O62A 3AZIB 4KHAB 2NZDC 5JA4A 4NFTA 1A7WA 2F8NA 3KWQD 3LZ1A 5AV9D 3C1BB 1P3GD 2NZDB 3MVDD 5B32C 3MGPA 3MGQC 3AYWB 5E5AB 5AV8C 1EQZA 3MGQA 5AY8D 5B32A 5DNND 4H9PB 3W98C 4G91B 2RVQD 3LJAD 1P3OD 3W98B 3MGQB 1EQZD 3O62C 2F8NK 4J8VC
chains in the Genus database with same CATH superfamily
1P3OA 1P3GA 3B0DC 3LZ1D 1HQ3C 3UT9C 2Y2IA 3MGRC 5CPJC 3UT9B 3KUYA 3MGRB 5CPJB 3W98D 1P3LB 5CPIB 2RVQC 5B40B 3LJAC 3EPHA 2JSSA 5AV9A 1KX4C 1ID3D 3AZMD 4KGCC 2YFVA 4X23A 4XUJA 5DNNB 5AY8B 4J8XC 4J8VD 3A6NB 4KGCB 5AV5A 4J8XB 3A6NC 5KDMA 2XD5A 3REKC 1BH9B 3VH5T 3VH5A 4ZUXD 4CAYB 3RELA 3REHA 1F66A 1PZRA 4H9SC 5B2IA 3LZ0C 4DQYB 4J8XD 3AN2B 1P3MA 2NQBB 5B1MB 3H0MC 5CPID 3AZKD 3X1SD 5CHLB 1P3BD 4WU9B 3AZNB 5AV6C 4JJNC 1M18C 4XZQA 5B1MA 3LELA 3X1SA 5GSUB 2PYOB 3MGSD 3AV1B 1AOIA 2CV5D 4H9RA 5BNXA 3AZIC 5GXQA 4Z66A 3X1VD 5AV6D 4JJND 1M18D 3AN2D 2HIOD 3A1KA 3MGSC 3AZND 1P3LA 3WAAB 1P3MB 2NQBA 3UTBC 1P3AC 1U35A 3H0RC 3B0BA 3UTBB 4LD9D 5F99A 3X1VC 1F1EA 2HIOB 5C3IC 3RELB 1F66B 2BYKA 4KUDD 5CPKC 5BNVA 4E45A 3W97C 3C1CA 5CP6D 3UTAB 5B2JC 3AZJB 3LJAB 5B40C 3AZMA 1ID3A 5B2JB 4H9NA 2IO5C 3AFAA 4H9QB 4NE5A 5B33A 4YM6A 4LD9C 1P34A 1KX5D 3MNNA 4J8WD 3UTAD 1P3PA 1P3KD 5B0YA 3MGPD 1BFMA 5B2JD 4R8PB 3WTPA 5CP6A 1KX3B 5B0ZC 3MNND 3WTPC 5BT1C 5GT3A 2Y2GA 5CP6B 5AVCA 3WKJB 5B0YC 5B33B 1B6WA 1P3PC 3V9RA 4YS3C 5B0YB 5B1LD 4YS3B 5AVBC 1P3KC 1M19A 4LD9A 3AZGA 5B33C 4HGAC 4Z5TD 2AROD 4G91C 2HIOA 5GSUC 2PYOC 1M1AD 3WTPD 5BT1D 1N1JB 5FUGA 5B0YD 4R8PD 4Z66D 4HGAB 2ZY2A 5B31A 5B1LC 3REIA 4ZUXB 5AVBD 1U35C 1KX4B 4WU9A 1M1AB 1P3LC 2CWEA 5GSUD 2PYOD 1M1AC 3WAAA 3VH5W 3AZKB 4Z66B 3X1TA 5GT0C 5DNMA 3AZLB 4WU9D 1P3AB 4Z5TB 2ZY4A 3X1VB 3REID 5B2ID 5DNMB 3REHD 2G5HC 3LELB 1ZLAD 4QLCA 2CV5B 2BG1A 4Z5TA 3VH6A 3X1TC 2FJ7B 4WZSB 2Y2PA 4H9OA 5B1MC 3REIB 5B2IB 5BO0B 4AWLB 1JFIA 3AV1C 1BH9A 3LZ0A 3AZJD 2FJ7D 3B6GD 5AV8B 5B1MD 5FUGB 5E5AC 5JRGA 3EPKA 3NQJA 3C1BC 3MGPB 3AYWA 5AVBA 5AY8A 5DNNA 3W99B 1KX4A 4YS3A 2L5AA 2HUEB 3WA9A 3AFAD 3LJAA 3AZMB 2Y2HA 1KX5B 5GT3C 5E5AD 3MGRA 5CPJA 3W96A 5GT3B 5B0ZA 3W96C 1P3GC 1P34B 5JRGD 3WA9B 3NQUB 3C1BD 1P3GB 1KX3D 5AV8D 3WA9C 2IO5B 2DF4C 3VH6T 5AY8C 5DNNC 5B24C 3W96B 5BO0A 3C1BA 3EG5B 4UUZA 1Z2CB 5BNVB 5GT3D 3KWQA 3B6FB 1HTAA 1EQZC 2YFWB 3O62D 4WU8A 5AVCB 5B24B 1EQZB 3NQUA 5JRGC 5B2JA 3AFAB 1KX3C 3LZ1C 1TAFA 5GXQD 2JCHA 2FFFB 3WTPB 5JA4B 3AZED 1JFIB 3X1VA 1T3UA 3AV1A 2XD1A 1H3OB 3B0CT 1P3AA 3UTBA 2NQBC 5AVBB 3AZHD 3X1TB 3MGSA 2RIQA 4EO5B 3A6ND 1P3BA 1P3KB 4EO5C 4H9RB 5BNXB 3AV2D 1P3ID 2FJ7A 4NE6A 3TU4D 1U35B 1TZYD 3X1SC 3KXBD 5B1LB 3REJD 1P3BC 5BS7A 1P3FB 5GT0A 5AV5D 3WAAC 1M1AA 3AZHB 4XUJB 1P3IA 1WWSA 5GT0B 4X23D 3AZLC 3TU4C 5B1LA 1TZYC 5B31C 5KDMB 3KSYA 3RELC 1F66C 4WNNA 1KX3A 4WU8B 3KUYD 3WAAD 2HIOC 5C3IB 4WU8C 5AV9B 2NZDD 2VQRA 2Y2NA 3MNNB 3MVDB 3KWQC 1Q9CA 3AZLD 5AV5B 4X23C 4J8XA 1P3KA 1M19C 4KGCA 5B24A 3A1IA 1P3AD 4AWLC 3KFUG 5AVCC 4YM6D 2JE5A 4UUZB 3KWQB 5B0ZB 3KUYC 4LD9B 2BYMA 3REHB 4KUDC 4CAYA 3UT9A 3W97D 1N1JA 5CP6C 1P3PB 1M19D 2F2AC 3UT9D 1HQ3D 3AZGB 3H0LC 5CPJD 3MGRD 3AYWC 4YM6C 5AVCD 3W98A 4H9NB 4J8WC 1KX4D 5AV8A 1ID3C 2Y2MA 3MGPC 5B40A 3AZMC 2ZM5A 4CSRB 4J8VB 1WWIA 4KGCD 5E5AA 3AZEB 3W99C 3W97A 5B0ZD 1ULYA 5G49A 5CPKA 4Z2MG 2NZDA 3REKD 1ID3B 4QLCD 3B0DB 3AYWD 3UTAA 1P3PD 4ZUXC 2Y2OA 2BYMB 1KX5A 3LZ0D 2LY8A 5B31G 1P3IB 3W99D 4H9QA 3AZFB 4Z5TC 5CPIC 3AZKC 3WTPE 3B6FC 3EPLA 4QLCC 3LZ1B 3TU4B 4Z66C 3F6TA 4Z2MH 5JRGB 2BYKB 4J8UB 3REKB 2CV5C 1ZLAA 3AZID 5DNMC 3AZNA 2G5IC 3LELC 1S32C 3B6FD 5GT0D 1S32B 3AN2C 3AV2A 4WU9C 4H9OB 3AL0C 4XUJD 1S32A 3REIC 3KUYB 3AZNC 5GXQB 5B2IC 3REHC 4ZBJB 1ZLAC 3UTBD 5DNMD 2ZY3A 3LELD 1ZLAB 1S32D 3FDDA 5GSUA 3X1SB 3AZEA 2PYOA 3B0CW 3A6NA 3X1TD 5CPKD 3AZGC 4XZQB 4G92C 2YFWA 3X1UC 2F8NH 4XUJC 3V9RB 3X1UB 5B32B 5B40D 3AZKA 2UWXA 3MGSB 3AV1D 2DQNC 1KX5C 4R8PA 3B6GC 1HQ3A 4ZUXA 2HUEC 3B6GB 3UTAC 3O62B 3AZGD 5B31B 3WKJA 3X1UD 3C1CD 3KXBB 3REJB 2AROA 2Y2JA 3MNNC 5F99D 1P34C 3W99A 3WKJD 5G49B 4E44A 5CPKB 4NE3A 4YS3D 3AFAC 4J8WA 4WJ3C 3NQJB 2F8NB 3EPJA 3C1CC 4H9PA 4KUDB 3R45B 3W96D 5B33D 5F99B 1BH8B 2AROC 1P3OB 4J8UC 5F99C 1P34D 3WKJC 3LZ0B 3WA9D 3C1CB 5B24D 4KUDA 4R8PC 3B6GA 4KHAA 1AOID 3P5JB 3MVDA 4J8WB 1U35D 4YM6B 1P3LD 4J8UD 3X1UA 3AZFD 1R4VA 1KU5A 2Y2QA 4WNNB 2F8ND 5GXQC 3AZJA 3AZIA 1AOIB 1P3MD 3AZEC 3KXBA 3REJA 4WV4B 1AOIC 1HQ3B 5B32G 2NQBD 1W2EA 3AZHC 1TZYA 3TU4A 1P3BB 4XZQC 4G92B 2Y2LA 5AV6A 4JJNA 3AZLA 1M18A 3AZFC 1P3FA 3AV2C 3AN2A 1P3IC 1P3FC 3AZFA 1P3MC 3AV2B 3AZHA 4H9SA 2ZY5A 5BS7C 2Y2KA 4M6BA 4QLCB 2J8PA 2CV5A 1TAFB 4XZQD 4DRAA 3KXBC 3REJC 1TZYB 3REKA 1BH8A 3AZJC 2FJ7C 5AV5C 4X23B 1P3FD 3W97B 2F8NG 3B6FA 4CSRA 1M19B 5CPIA 3VH6W 5AV9C 5AV6B 3MVDC 4JJNB 1M18B 4DRBA 5B32D 5B31D 3MGQD 2YFVB 3RELD 1F66D 1B67A 2AROB 1P3OC 4J8VA 1H3OA 4ZBJC 4J8UA 4WU8D 3R45A 3O62A 4UPKA 4KHAB 3AZIB 2NZDC 5JA4A 4NFTA 1A7WA 2F8NA 3KWQD 3LZ1A 5AV9D 3C1BB 1P3GD 2NZDB 3MVDD 2W8SA 3IP4C 5B32C 3MGPA 3MGQC 3AYWB 5E5AB 5AV8C 1EQZA 3MGQA 5AY8D 5B32A 5DNND 4H9PB 3W98C 4G91B 2RVQD 3LJAD 1P3OD 3W98B 3MGQB 1EQZD 3O62C 2F8NK 4J8VC
chains in the Genus database with same CATH topology
1P3OA 1P3GA 3B0DC 3LZ1D 1HQ3C 3UT9C 2Y2IA 3MGRC 5CPJC 3UT9B 3KUYA 3MGRB 5CPJB 3W98D 1P3LB 5CPIB 2RVQC 5B40B 3LJAC 3EPHA 2JSSA 5AV9A 1KX4C 1ID3D 3AZMD 4KGCC 2YFVA 4X23A 4XUJA 5DNNB 5AY8B 4J8XC 4J8VD 3A6NB 4KGCB 5AV5A 4J8XB 3A6NC 5KDMA 2XD5A 3REKC 1BH9B 3VH5T 3VH5A 4ZUXD 4CAYB 3RELA 3REHA 1F66A 1PZRA 4H9SC 5B2IA 3LZ0C 4DQYB 4J8XD 3AN2B 1P3MA 2NQBB 5B1MB 3H0MC 5CPID 3AZKD 3X1SD 5CHLB 1P3BD 4WU9B 3AZNB 5AV6C 4JJNC 1M18C 4XZQA 5B1MA 3LELA 3X1SA 5GSUB 2PYOB 3MGSD 3AV1B 1AOIA 2CV5D 4H9RA 5BNXA 3AZIC 5GXQA 4Z66A 3X1VD 5AV6D 4JJND 1M18D 3AN2D 2HIOD 3A1KA 3MGSC 3AZND 1P3LA 3WAAB 1P3MB 2NQBA 3UTBC 1P3AC 1U35A 3H0RC 3B0BA 3UTBB 4LD9D 5F99A 3X1VC 1F1EA 2HIOB 5C3IC 3RELB 1F66B 2BYKA 4KUDD 5CPKC 5BNVA 4E45A 3W97C 3C1CA 5CP6D 3UTAB 5B2JC 3AZJB 3LJAB 5B40C 3AZMA 1ID3A 5B2JB 4H9NA 2IO5C 3AFAA 4H9QB 4NE5A 5B33A 4YM6A 4LD9C 1P34A 1KX5D 3MNNA 4J8WD 3UTAD 1P3PA 1P3KD 5B0YA 3MGPD 1BFMA 5B2JD 4R8PB 3WTPA 5CP6A 1KX3B 5B0ZC 3MNND 3WTPC 5BT1C 5GT3A 2Y2GA 5CP6B 5AVCA 3WKJB 5B0YC 5B33B 1B6WA 1P3PC 3V9RA 4YS3C 5B0YB 5B1LD 4YS3B 5AVBC 1P3KC 1M19A 4LD9A 3AZGA 5B33C 4HGAC 4Z5TD 2AROD 4G91C 2HIOA 5GSUC 2PYOC 1M1AD 3WTPD 5BT1D 1N1JB 5FUGA 5B0YD 4R8PD 4Z66D 4HGAB 2ZY2A 5B31A 5B1LC 3REIA 4ZUXB 5AVBD 1U35C 1KX4B 4WU9A 1M1AB 1P3LC 2CWEA 5GSUD 2PYOD 1M1AC 3WAAA 3VH5W 3AZKB 4Z66B 3X1TA 5GT0C 5DNMA 3AZLB 4WU9D 1P3AB 4Z5TB 2ZY4A 3X1VB 3REID 5B2ID 5DNMB 3REHD 2G5HC 3LELB 1ZLAD 4QLCA 2CV5B 2BG1A 4Z5TA 3VH6A 3X1TC 2FJ7B 4WZSB 2Y2PA 4H9OA 5B1MC 3REIB 5B2IB 5BO0B 4AWLB 1JFIA 3AV1C 1BH9A 3LZ0A 3AZJD 2FJ7D 3B6GD 5AV8B 5B1MD 5FUGB 5E5AC 5JRGA 3EPKA 3NQJA 3C1BC 3MGPB 3AYWA 5AVBA 5AY8A 5DNNA 3W99B 1KX4A 4YS3A 2L5AA 2HUEB 3WA9A 3AFAD 3LJAA 3AZMB 2Y2HA 1KX5B 5GT3C 5E5AD 3MGRA 5CPJA 3W96A 5GT3B 5B0ZA 3W96C 1P3GC 1P34B 5JRGD 3WA9B 3NQUB 3C1BD 1P3GB 1KX3D 5AV8D 3WA9C 2IO5B 2DF4C 3VH6T 5AY8C 5DNNC 5B24C 3W96B 5BO0A 3C1BA 3EG5B 4UUZA 1Z2CB 5BNVB 5GT3D 3KWQA 3B6FB 1HTAA 1EQZC 2YFWB 3O62D 4WU8A 5AVCB 5B24B 1EQZB 3NQUA 5JRGC 5B2JA 3AFAB 1KX3C 3LZ1C 1TAFA 5GXQD 2JCHA 2FFFB 3WTPB 5JA4B 3AZED 1JFIB 3X1VA 1T3UA 3AV1A 2XD1A 1H3OB 3B0CT 1P3AA 3UTBA 2NQBC 5AVBB 3AZHD 3X1TB 3MGSA 2RIQA 4EO5B 3A6ND 1P3BA 1P3KB 4EO5C 4H9RB 5BNXB 3AV2D 1P3ID 2FJ7A 4NE6A 3TU4D 1U35B 1TZYD 3X1SC 3KXBD 5B1LB 3REJD 1P3BC 5BS7A 1P3FB 5GT0A 5AV5D 3WAAC 1M1AA 3AZHB 4XUJB 1P3IA 1WWSA 5GT0B 4X23D 3AZLC 3TU4C 5B1LA 1TZYC 5B31C 5KDMB 3KSYA 3RELC 1F66C 4WNNA 1KX3A 4WU8B 3KUYD 3WAAD 2HIOC 5C3IB 4WU8C 5AV9B 2NZDD 2VQRA 2Y2NA 3MNNB 3MVDB 3KWQC 1Q9CA 3AZLD 5AV5B 4X23C 4J8XA 1P3KA 1M19C 4KGCA 5B24A 3A1IA 1P3AD 4AWLC 3KFUG 5AVCC 4YM6D 2JE5A 4UUZB 3KWQB 5B0ZB 3KUYC 4LD9B 2BYMA 3REHB 4KUDC 4CAYA 3UT9A 3W97D 1N1JA 5CP6C 1P3PB 1M19D 2F2AC 3UT9D 1HQ3D 3AZGB 3H0LC 5CPJD 3MGRD 3AYWC 4YM6C 5AVCD 3W98A 4H9NB 4J8WC 1KX4D 5AV8A 1ID3C 2Y2MA 3MGPC 5B40A 3AZMC 2ZM5A 4CSRB 4J8VB 1WWIA 4KGCD 5E5AA 3AZEB 3W99C 3W97A 5B0ZD 1ULYA 5G49A 5CPKA 4Z2MG 2NZDA 3REKD 1ID3B 4QLCD 3B0DB 3AYWD 3UTAA 1P3PD 4ZUXC 2Y2OA 2BYMB 1KX5A 3LZ0D 2LY8A 5B31G 1P3IB 3W99D 4H9QA 3AZFB 4Z5TC 5CPIC 3AZKC 3WTPE 3B6FC 3EPLA 4QLCC 3LZ1B 3TU4B 4Z66C 3F6TA 4Z2MH 5JRGB 2BYKB 4J8UB 3REKB 2CV5C 1ZLAA 3AZID 5DNMC 3AZNA 2G5IC 3LELC 1S32C 3B6FD 5GT0D 1S32B 3AN2C 3AV2A 4WU9C 4H9OB 3AL0C 4XUJD 1S32A 3REIC 3KUYB 3AZNC 5GXQB 5B2IC 3REHC 4ZBJB 1ZLAC 3UTBD 5DNMD 2ZY3A 3LELD 1ZLAB 1S32D 3FDDA 5GSUA 3X1SB 3AZEA 2PYOA 3B0CW 3A6NA 3X1TD 5CPKD 3AZGC 4XZQB 4G92C 2YFWA 3X1UC 2F8NH 4XUJC 3V9RB 3X1UB 5B32B 5B40D 3AZKA 2UWXA 3MGSB 3AV1D 2DQNC 1KX5C 4R8PA 3B6GC 1HQ3A 4ZUXA 2HUEC 3B6GB 3UTAC 3O62B 3AZGD 5B31B 3WKJA 3X1UD 3C1CD 3KXBB 3REJB 2AROA 2Y2JA 3MNNC 5F99D 1P34C 3W99A 3WKJD 5G49B 4E44A 5CPKB 4NE3A 4YS3D 3AFAC 4J8WA 4WJ3C 3NQJB 2F8NB 3EPJA 3C1CC 4H9PA 4KUDB 3R45B 3W96D 5B33D 5F99B 1BH8B 2AROC 1P3OB 4J8UC 5F99C 1P34D 3WKJC 3LZ0B 3WA9D 3C1CB 5B24D 4KUDA 4R8PC 3B6GA 4KHAA 1AOID 3P5JB 3MVDA 4J8WB 1U35D 4YM6B 1P3LD 4J8UD 3X1UA 3AZFD 1R4VA 1KU5A 2Y2QA 4WNNB 2F8ND 5GXQC 3AZJA 3AZIA 1AOIB 1P3MD 3AZEC 3KXBA 3REJA 4WV4B 1AOIC 1HQ3B 5B32G 2NQBD 1W2EA 3AZHC 1TZYA 3TU4A 1P3BB 4XZQC 4G92B 2Y2LA 5AV6A 4JJNA 3AZLA 1M18A 3AZFC 1P3FA 3AV2C 3AN2A 1P3IC 1P3FC 3AZFA 1P3MC 3AV2B 3AZHA 4H9SA 2ZY5A 5BS7C 2Y2KA 4M6BA 4QLCB 2J8PA 2CV5A 1TAFB 4XZQD 4DRAA 3KXBC 3REJC 1TZYB 3REKA 1BH8A 3AZJC 2FJ7C 5AV5C 4X23B 1P3FD 3W97B 2F8NG 3B6FA 4CSRA 1M19B 5CPIA 3VH6W 5AV9C 5AV6B 3MVDC 4JJNB 1M18B 4DRBA 5B32D 5B31D 3MGQD 2YFVB 3RELD 1F66D 1B67A 2AROB 1P3OC 4J8VA 1H3OA 4ZBJC 4J8UA 4WU8D 3R45A 3O62A 4UPKA 4KHAB 3AZIB 2NZDC 5JA4A 4NFTA 1A7WA 2F8NA 3KWQD 3LZ1A 5AV9D 3C1BB 1P3GD 2NZDB 3MVDD 2W8SA 3IP4C 5B32C 3MGPA 3MGQC 3AYWB 5E5AB 5AV8C 1EQZA 3MGQA 5AY8D 5B32A 5DNND 4H9PB 3W98C 4G91B 2RVQD 3LJAD 1P3OD 3W98B 3MGQB 1EQZD 3O62C 2F8NK 4J8VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O A;  1P3G A;  3B0D C;  3LZ1 D;  1HQ3 C;  3UT9 C;  3MGR C;  5CPJ C;  3UT9 B;  3KUY A;  3MGR B;  5CPJ B;  3W98 D;  1P3L B;  5CPI B;  2RVQ C;  5B40 B;  3LJA C;  2JSS A;  5AV9 A;  1KX4 C;  1ID3 D;  3AZM D;  4KGC C;  2YFV A;  4X23 A;  4XUJ A;  5DNN B;  5AY8 B;  4J8X C;  4J8V D;  3A6N B;  4KGC B;  5AV5 A;  4J8X B;  3A6N C;  5KDM A;  3REK C;  1BH9 B;  3VH5 T;  3VH5 A;  4ZUX D;  4CAY B;  3REL A;  3REH A;  1F66 A;  5B2I A;  4H9S C;  3LZ0 C;  4J8X D;  3AN2 B;  1P3M A;  2NQB B;  5B1M B;  5CPI D;  3AZK D;  3X1S D;  5CHL B;  1P3B D;  4WU9 B;  3AZN B;  5AV6 C;  4JJN C;  1M18 C;  4XZQ A;  5B1M A;  3LEL A;  3X1S A;  5GSU B;  2PYO B;  3MGS D;  3AV1 B;  1AOI A;  2CV5 D;  4H9R A;  5BNX A;  3AZI C;  5GXQ A;  4Z66 A;  3X1V D;  5AV6 D;  4JJN D;  1M18 D;  3AN2 D;  2HIO D;  3MGS C;  3AZN D;  1P3L A;  3WAA B;  1P3M B;  2NQB A;  3UTB C;  1P3A C;  1U35 A;  3UTB B;  3B0B A;  4LD9 D;  5F99 A;  3X1V C;  1F1E A;  2HIO B;  5C3I C;  3REL B;  1F66 B;  2BYK A;  4KUD D;  5CPK C;  5BNV A;  4E45 A;  3W97 C;  3C1C A;  5CP6 D;  3UTA B;  5B2J C;  3AZJ B;  3LJA B;  5B40 C;  3AZM A;  1ID3 A;  5B2J B;  3AFA A;  4H9N A;  2IO5 C;  4H9Q B;  4NE5 A;  5B33 A;  4YM6 A;  4LD9 C;  1P34 A;  1KX5 D;  3MNN A;  4J8W D;  3UTA D;  1P3P A;  1P3K D;  5B0Y A;  3MGP D;  1BFM A;  5B2J D;  4R8P B;  3WTP A;  5CP6 A;  1KX3 B;  5B0Z C;  3MNN D;  3WTP C;  5BT1 C;  5GT3 A;  5CP6 B;  5AVC A;  3WKJ B;  5B0Y C;  5B33 B;  1B6W A;  1P3P C;  3V9R A;  4YS3 C;  5B0Y B;  5B1L D;  4YS3 B;  5AVB C;  1P3K C;  1M19 A;  4LD9 A;  3AZG A;  5B33 C;  4HGA C;  4Z5T D;  2ARO D;  4G91 C;  2HIO A;  5GSU C;  2PYO C;  1M1A D;  3WTP D;  5BT1 D;  1N1J B;  5FUG A;  5B0Y D;  4R8P D;  4Z66 D;  4HGA B;  5B31 A;  5B1L C;  3REI A;  4ZUX B;  5AVB D;  1U35 C;  1KX4 B;  4WU9 A;  1M1A B;  1P3L C;  2CWE A;  5GSU D;  2PYO D;  1M1A C;  3WAA A;  3VH5 W;  3AZK B;  4Z66 B;  3X1T A;  5GT0 C;  5DNM A;  3AZL B;  4WU9 D;  1P3A B;  4Z5T B;  3X1V B;  3REI D;  5B2I D;  5DNM B;  3REH D;  3LEL B;  1ZLA D;  4QLC A;  2CV5 B;  4Z5T A;  3VH6 A;  3X1T C;  2FJ7 B;  4WZS B;  4H9O A;  5B1M C;  3REI B;  5B2I B;  5BO0 B;  4AWL B;  1JFI A;  3AV1 C;  1BH9 A;  3LZ0 A;  3AZJ D;  2FJ7 D;  3B6G D;  5AV8 B;  5B1M D;  5FUG B;  5E5A C;  5JRG A;  3NQJ A;  3C1B C;  3MGP B;  3AYW A;  5AVB A;  5AY8 A;  5DNN A;  3W99 B;  1KX4 A;  4YS3 A;  2L5A A;  2HUE B;  3WA9 A;  3AFA D;  3LJA A;  3AZM B;  1KX5 B;  5GT3 C;  5E5A D;  3MGR A;  5CPJ A;  3W96 A;  5GT3 B;  5B0Z A;  3W96 C;  1P3G C;  1P34 B;  5JRG D;  3WA9 B;  3NQU B;  3C1B D;  1P3G B;  1KX3 D;  5AV8 D;  3WA9 C;  2IO5 B;  3VH6 T;  5AY8 C;  5DNN C;  5B24 C;  3W96 B;  5BO0 A;  3C1B A;  4UUZ A;  3KWQ A;  5BNV B;  5GT3 D;  3B6F B;  1HTA A;  1EQZ C;  2YFW B;  3O62 D;  4WU8 A;  5AVC B;  5B24 B;  1EQZ B;  3NQU A;  5JRG C;  5B2J A;  3AFA B;  1KX3 C;  3LZ1 C;  1TAF A;  5GXQ D;  3WTP B;  5JA4 B;  3AZE D;  1JFI B;  3X1V A;  3AV1 A;  1H3O B;  3B0C T;  1P3A A;  3UTB A;  2NQB C;  5AVB B;  3AZH D;  3X1T B;  3MGS A;  4EO5 B;  3A6N D;  1P3B A;  1P3K B;  4EO5 C;  4H9R B;  5BNX B;  3AV2 D;  1P3I D;  2FJ7 A;  4NE6 A;  3TU4 D;  1U35 B;  1TZY D;  3X1S C;  3KXB D;  5B1L B;  3REJ D;  1P3B C;  5BS7 A;  1P3F B;  5GT0 A;  5AV5 D;  3WAA C;  1M1A A;  3AZH B;  4XUJ B;  1P3I A;  1WWS A;  5GT0 B;  4X23 D;  3AZL C;  3TU4 C;  5B1L A;  1TZY C;  5B31 C;  5KDM B;  3KSY A;  3REL C;  1F66 C;  4WNN A;  1KX3 A;  4WU8 B;  3KUY D;  3WAA D;  2HIO C;  5C3I B;  4WU8 C;  5AV9 B;  2NZD D;  3MVD B;  3MNN B;  3KWQ C;  1Q9C A;  3AZL D;  5AV5 B;  4X23 C;  4J8X A;  1P3K A;  1M19 C;  4KGC A;  5B24 A;  1P3A D;  4AWL C;  5AVC C;  4YM6 D;  4UUZ B;  3KWQ B;  5B0Z B;  3KUY C;  4LD9 B;  2BYM A;  3REH B;  4KUD C;  4CAY A;  3UT9 A;  3W97 D;  1N1J A;  5CP6 C;  1P3P B;  1M19 D;  3UT9 D;  1HQ3 D;  3AZG B;  5CPJ D;  3MGR D;  3AYW C;  4YM6 C;  5AVC D;  3W98 A;  4H9N B;  4J8W C;  1KX4 D;  5AV8 A;  1ID3 C;  3MGP C;  5B40 A;  3AZM C;  4J8V B;  4CSR B;  4KGC D;  1WWI A;  5E5A A;  3AZE B;  3W99 C;  3W97 A;  5B0Z D;  1ULY A;  5G49 A;  5CPK A;  4Z2M G;  2NZD A;  3REK D;  1ID3 B;  4QLC D;  3B0D B;  3AYW D;  3UTA A;  1P3P D;  4ZUX C;  2BYM B;  1KX5 A;  3LZ0 D;  2LY8 A;  5B31 G;  1P3I B;  3W99 D;  4H9Q A;  3AZF B;  4Z5T C;  5CPI C;  3AZK C;  3WTP E;  3B6F C;  4QLC C;  3LZ1 B;  3TU4 B;  4Z66 C;  4Z2M H;  5JRG B;  2BYK B;  4J8U B;  3REK B;  2CV5 C;  1ZLA A;  3AZI D;  5DNM C;  3AZN A;  3LEL C;  1S32 C;  3B6F D;  5GT0 D;  1S32 B;  3AN2 C;  3AV2 A;  4WU9 C;  4H9O B;  4XUJ D;  1S32 A;  3REI C;  3KUY B;  3AZN C;  5GXQ B;  5B2I C;  3REH C;  4ZBJ B;  1ZLA C;  3UTB D;  5DNM D;  3LEL D;  1ZLA B;  1S32 D;  5GSU A;  3X1S B;  3AZE A;  2PYO A;  3B0C W;  3A6N A;  3X1T D;  5CPK D;  3AZG C;  4XZQ B;  4G92 C;  2YFW A;  3X1U C;  2F8N H;  4XUJ C;  3V9R B;  3X1U B;  5B32 B;  5B40 D;  3AZK A;  3MGS B;  3AV1 D;  1KX5 C;  4R8P A;  3B6G C;  1HQ3 A;  4ZUX A;  2HUE C;  3B6G B;  3UTA C;  3O62 B;  3AZG D;  5B31 B;  3WKJ A;  3X1U D;  3C1C D;  3KXB B;  3REJ B;  2ARO A;  3MNN C;  5F99 D;  1P34 C;  3W99 A;  3WKJ D;  5G49 B;  4E44 A;  5CPK B;  4NE3 A;  4YS3 D;  3AFA C;  4J8W A;  3NQJ B;  2F8N B;  3C1C C;  4H9P A;  4KUD B;  3R45 B;  3W96 D;  5B33 D;  5F99 B;  1BH8 B;  2ARO C;  1P3O B;  4J8U C;  5F99 C;  1P34 D;  3WKJ C;  3LZ0 B;  3WA9 D;  3C1C B;  5B24 D;  4KUD A;  4R8P C;  3B6G A;  4KHA A;  1AOI D;  3MVD A;  4J8W B;  1U35 D;  4YM6 B;  1P3L D;  4J8U D;  3X1U A;  3AZF D;  1R4V A;  1KU5 A;  4WNN B;  2F8N D;  5GXQ C;  3AZJ A;  3AZI A;  1AOI B;  1P3M D;  3AZE C;  3KXB A;  3REJ A;  4WV4 B;  1AOI C;  1HQ3 B;  5B32 G;  2NQB D;  3AZH C;  1TZY A;  3TU4 A;  1P3B B;  4XZQ C;  4G92 B;  5AV6 A;  4JJN A;  3AZL A;  1M18 A;  3AZF C;  1P3F A;  3AV2 C;  3AN2 A;  1P3I C;  1P3F C;  3AZF A;  1P3M C;  3AV2 B;  3AZH A;  4H9S A;  5BS7 C;  4M6B A;  4QLC B;  2CV5 A;  1TAF B;  4XZQ D;  4DRA A;  3KXB C;  3REJ C;  1TZY B;  3REK A;  1BH8 A;  3AZJ C;  2FJ7 C;  5AV5 C;  4X23 B;  1P3F D;  3W97 B;  2F8N G;  3B6F A;  4CSR A;  1M19 B;  5CPI A;  3VH6 W;  5AV9 C;  5AV6 B;  3MVD C;  4JJN B;  1M18 B;  4DRB A;  5B32 D;  5B31 D;  3MGQ D;  2YFV B;  3REL D;  1F66 D;  1B67 A;  2ARO B;  1P3O C;  4J8V A;  1H3O A;  4ZBJ C;  4J8U A;  4WU8 D;  3R45 A;  3O62 A;  3AZI B;  4KHA B;  2NZD C;  5JA4 A;  4NFT A;  1A7W A;  2F8N A;  3KWQ D;  3LZ1 A;  5AV9 D;  3C1B B;  1P3G D;  2NZD B;  3MVD D;  5B32 C;  3MGP A;  3MGQ C;  3AYW B;  5E5A B;  5AV8 C;  1EQZ A;  3MGQ A;  5AY8 D;  5B32 A;  5DNN D;  4H9P B;  3W98 C;  4G91 B;  2RVQ D;  3LJA D;  1P3O D;  3W98 B;  3MGQ B;  1EQZ D;  3O62 C;  2F8N K;  4J8V C; 
#chains in the Genus database with same CATH topology
 1P3O A;  1P3G A;  3B0D C;  3LZ1 D;  1HQ3 C;  3UT9 C;  2Y2I A;  3MGR C;  5CPJ C;  3UT9 B;  3KUY A;  3MGR B;  5CPJ B;  3W98 D;  1P3L B;  5CPI B;  2RVQ C;  5B40 B;  3LJA C;  3EPH A;  2JSS A;  5AV9 A;  1KX4 C;  1ID3 D;  3AZM D;  4KGC C;  2YFV A;  4X23 A;  4XUJ A;  5DNN B;  5AY8 B;  4J8X C;  4J8V D;  3A6N B;  4KGC B;  5AV5 A;  4J8X B;  3A6N C;  5KDM A;  2XD5 A;  3REK C;  1BH9 B;  3VH5 T;  3VH5 A;  4ZUX D;  4CAY B;  3REL A;  3REH A;  1F66 A;  1PZR A;  4H9S C;  5B2I A;  3LZ0 C;  4DQY B;  4J8X D;  3AN2 B;  1P3M A;  2NQB B;  5B1M B;  3H0M C;  5CPI D;  3AZK D;  3X1S D;  5CHL B;  1P3B D;  4WU9 B;  3AZN B;  5AV6 C;  4JJN C;  1M18 C;  4XZQ A;  5B1M A;  3LEL A;  3X1S A;  5GSU B;  2PYO B;  3MGS D;  3AV1 B;  1AOI A;  2CV5 D;  4H9R A;  5BNX A;  3AZI C;  5GXQ A;  4Z66 A;  3X1V D;  5AV6 D;  4JJN D;  1M18 D;  3AN2 D;  2HIO D;  3A1K A;  3MGS C;  3AZN D;  1P3L A;  3WAA B;  1P3M B;  2NQB A;  3UTB C;  1P3A C;  1U35 A;  3H0R C;  3B0B A;  3UTB B;  4LD9 D;  5F99 A;  3X1V C;  1F1E A;  2HIO B;  5C3I C;  3REL B;  1F66 B;  2BYK A;  4KUD D;  5CPK C;  5BNV A;  4E45 A;  3W97 C;  3C1C A;  5CP6 D;  3UTA B;  5B2J C;  3AZJ B;  3LJA B;  5B40 C;  3AZM A;  1ID3 A;  5B2J B;  4H9N A;  2IO5 C;  3AFA A;  4H9Q B;  4NE5 A;  5B33 A;  4YM6 A;  4LD9 C;  1P34 A;  1KX5 D;  3MNN A;  4J8W D;  3UTA D;  1P3P A;  1P3K D;  5B0Y A;  3MGP D;  1BFM A;  5B2J D;  4R8P B;  3WTP A;  5CP6 A;  1KX3 B;  5B0Z C;  3MNN D;  3WTP C;  5BT1 C;  5GT3 A;  2Y2G A;  5CP6 B;  5AVC A;  3WKJ B;  5B0Y C;  5B33 B;  1B6W A;  1P3P C;  3V9R A;  4YS3 C;  5B0Y B;  5B1L D;  4YS3 B;  5AVB C;  1P3K C;  1M19 A;  4LD9 A;  3AZG A;  5B33 C;  4HGA C;  4Z5T D;  2ARO D;  4G91 C;  2HIO A;  5GSU C;  2PYO C;  1M1A D;  3WTP D;  5BT1 D;  1N1J B;  5FUG A;  5B0Y D;  4R8P D;  4Z66 D;  4HGA B;  2ZY2 A;  5B31 A;  5B1L C;  3REI A;  4ZUX B;  5AVB D;  1U35 C;  1KX4 B;  4WU9 A;  1M1A B;  1P3L C;  2CWE A;  5GSU D;  2PYO D;  1M1A C;  3WAA A;  3VH5 W;  3AZK B;  4Z66 B;  3X1T A;  5GT0 C;  5DNM A;  3AZL B;  4WU9 D;  1P3A B;  4Z5T B;  2ZY4 A;  3X1V B;  3REI D;  5B2I D;  5DNM B;  3REH D;  2G5H C;  3LEL B;  1ZLA D;  4QLC A;  2CV5 B;  2BG1 A;  4Z5T A;  3VH6 A;  3X1T C;  2FJ7 B;  4WZS B;  2Y2P A;  4H9O A;  5B1M C;  3REI B;  5B2I B;  5BO0 B;  4AWL B;  1JFI A;  3AV1 C;  1BH9 A;  3LZ0 A;  3AZJ D;  2FJ7 D;  3B6G D;  5AV8 B;  5B1M D;  5FUG B;  5E5A C;  5JRG A;  3EPK A;  3NQJ A;  3C1B C;  3MGP B;  3AYW A;  5AVB A;  5AY8 A;  5DNN A;  3W99 B;  1KX4 A;  4YS3 A;  2L5A A;  2HUE B;  3WA9 A;  3AFA D;  3LJA A;  3AZM B;  2Y2H A;  1KX5 B;  5GT3 C;  5E5A D;  3MGR A;  5CPJ A;  3W96 A;  5GT3 B;  5B0Z A;  3W96 C;  1P3G C;  1P34 B;  5JRG D;  3WA9 B;  3NQU B;  3C1B D;  1P3G B;  1KX3 D;  5AV8 D;  3WA9 C;  2IO5 B;  2DF4 C;  3VH6 T;  5AY8 C;  5DNN C;  5B24 C;  3W96 B;  5BO0 A;  3C1B A;  3EG5 B;  4UUZ A;  1Z2C B;  5BNV B;  5GT3 D;  3KWQ A;  3B6F B;  1HTA A;  1EQZ C;  2YFW B;  3O62 D;  4WU8 A;  5AVC B;  5B24 B;  1EQZ B;  3NQU A;  5JRG C;  5B2J A;  3AFA B;  1KX3 C;  3LZ1 C;  1TAF A;  5GXQ D;  2JCH A;  2FFF B;  3WTP B;  5JA4 B;  3AZE D;  1JFI B;  3X1V A;  1T3U A;  3AV1 A;  2XD1 A;  1H3O B;  3B0C T;  1P3A A;  3UTB A;  2NQB C;  5AVB B;  3AZH D;  3X1T B;  3MGS A;  2RIQ A;  4EO5 B;  3A6N D;  1P3B A;  1P3K B;  4EO5 C;  4H9R B;  5BNX B;  3AV2 D;  1P3I D;  2FJ7 A;  4NE6 A;  3TU4 D;  1U35 B;  1TZY D;  3X1S C;  3KXB D;  5B1L B;  3REJ D;  1P3B C;  5BS7 A;  1P3F B;  5GT0 A;  5AV5 D;  3WAA C;  1M1A A;  3AZH B;  4XUJ B;  1P3I A;  1WWS A;  5GT0 B;  4X23 D;  3AZL C;  3TU4 C;  5B1L A;  1TZY C;  5B31 C;  5KDM B;  3KSY A;  3REL C;  1F66 C;  4WNN A;  1KX3 A;  4WU8 B;  3KUY D;  3WAA D;  2HIO C;  5C3I B;  4WU8 C;  5AV9 B;  2NZD D;  2VQR A;  2Y2N A;  3MNN B;  3MVD B;  3KWQ C;  1Q9C A;  3AZL D;  5AV5 B;  4X23 C;  4J8X A;  1P3K A;  1M19 C;  4KGC A;  5B24 A;  3A1I A;  1P3A D;  4AWL C;  3KFU G;  5AVC C;  4YM6 D;  2JE5 A;  4UUZ B;  3KWQ B;  5B0Z B;  3KUY C;  4LD9 B;  2BYM A;  3REH B;  4KUD C;  4CAY A;  3UT9 A;  3W97 D;  1N1J A;  5CP6 C;  1P3P B;  1M19 D;  2F2A C;  3UT9 D;  1HQ3 D;  3AZG B;  3H0L C;  5CPJ D;  3MGR D;  3AYW C;  4YM6 C;  5AVC D;  3W98 A;  4H9N B;  4J8W C;  1KX4 D;  5AV8 A;  1ID3 C;  2Y2M A;  3MGP C;  5B40 A;  3AZM C;  2ZM5 A;  4CSR B;  4J8V B;  1WWI A;  4KGC D;  5E5A A;  3AZE B;  3W99 C;  3W97 A;  5B0Z D;  1ULY A;  5G49 A;  5CPK A;  4Z2M G;  2NZD A;  3REK D;  1ID3 B;  4QLC D;  3B0D B;  3AYW D;  3UTA A;  1P3P D;  4ZUX C;  2Y2O A;  2BYM B;  1KX5 A;  3LZ0 D;  2LY8 A;  5B31 G;  1P3I B;  3W99 D;  4H9Q A;  3AZF B;  4Z5T C;  5CPI C;  3AZK C;  3WTP E;  3B6F C;  3EPL A;  4QLC C;  3LZ1 B;  3TU4 B;  4Z66 C;  3F6T A;  4Z2M H;  5JRG B;  2BYK B;  4J8U B;  3REK B;  2CV5 C;  1ZLA A;  3AZI D;  5DNM C;  3AZN A;  2G5I C;  3LEL C;  1S32 C;  3B6F D;  5GT0 D;  1S32 B;  3AN2 C;  3AV2 A;  4WU9 C;  4H9O B;  3AL0 C;  4XUJ D;  1S32 A;  3REI C;  3KUY B;  3AZN C;  5GXQ B;  5B2I C;  3REH C;  4ZBJ B;  1ZLA C;  3UTB D;  5DNM D;  2ZY3 A;  3LEL D;  1ZLA B;  1S32 D;  3FDD A;  5GSU A;  3X1S B;  3AZE A;  2PYO A;  3B0C W;  3A6N A;  3X1T D;  5CPK D;  3AZG C;  4XZQ B;  4G92 C;  2YFW A;  3X1U C;  2F8N H;  4XUJ C;  3V9R B;  3X1U B;  5B32 B;  5B40 D;  3AZK A;  2UWX A;  3MGS B;  3AV1 D;  2DQN C;  1KX5 C;  4R8P A;  3B6G C;  1HQ3 A;  4ZUX A;  2HUE C;  3B6G B;  3UTA C;  3O62 B;  3AZG D;  5B31 B;  3WKJ A;  3X1U D;  3C1C D;  3KXB B;  3REJ B;  2ARO A;  2Y2J A;  3MNN C;  5F99 D;  1P34 C;  3W99 A;  3WKJ D;  5G49 B;  4E44 A;  5CPK B;  4NE3 A;  4YS3 D;  3AFA C;  4J8W A;  4WJ3 C;  3NQJ B;  2F8N B;  3EPJ A;  3C1C C;  4H9P A;  4KUD B;  3R45 B;  3W96 D;  5B33 D;  5F99 B;  1BH8 B;  2ARO C;  1P3O B;  4J8U C;  5F99 C;  1P34 D;  3WKJ C;  3LZ0 B;  3WA9 D;  3C1C B;  5B24 D;  4KUD A;  4R8P C;  3B6G A;  4KHA A;  1AOI D;  3P5J B;  3MVD A;  4J8W B;  1U35 D;  4YM6 B;  1P3L D;  4J8U D;  3X1U A;  3AZF D;  1R4V A;  1KU5 A;  2Y2Q A;  4WNN B;  2F8N D;  5GXQ C;  3AZJ A;  3AZI A;  1AOI B;  1P3M D;  3AZE C;  3KXB A;  3REJ A;  4WV4 B;  1AOI C;  1HQ3 B;  5B32 G;  2NQB D;  1W2E A;  3AZH C;  1TZY A;  3TU4 A;  1P3B B;  4XZQ C;  4G92 B;  2Y2L A;  5AV6 A;  4JJN A;  3AZL A;  1M18 A;  3AZF C;  1P3F A;  3AV2 C;  3AN2 A;  1P3I C;  1P3F C;  3AZF A;  1P3M C;  3AV2 B;  3AZH A;  4H9S A;  2ZY5 A;  5BS7 C;  2Y2K A;  4M6B A;  4QLC B;  2J8P A;  2CV5 A;  1TAF B;  4XZQ D;  4DRA A;  3KXB C;  3REJ C;  1TZY B;  3REK A;  1BH8 A;  3AZJ C;  2FJ7 C;  5AV5 C;  4X23 B;  1P3F D;  3W97 B;  2F8N G;  3B6F A;  4CSR A;  1M19 B;  5CPI A;  3VH6 W;  5AV9 C;  5AV6 B;  3MVD C;  4JJN B;  1M18 B;  4DRB A;  5B32 D;  5B31 D;  3MGQ D;  2YFV B;  3REL D;  1F66 D;  1B67 A;  2ARO B;  1P3O C;  4J8V A;  1H3O A;  4ZBJ C;  4J8U A;  4WU8 D;  3R45 A;  3O62 A;  4UPK A;  4KHA B;  3AZI B;  2NZD C;  5JA4 A;  4NFT A;  1A7W A;  2F8N A;  3KWQ D;  3LZ1 A;  5AV9 D;  3C1B B;  1P3G D;  2NZD B;  3MVD D;  2W8S A;  3IP4 C;  5B32 C;  3MGP A;  3MGQ C;  3AYW B;  5E5A B;  5AV8 C;  1EQZ A;  3MGQ A;  5AY8 D;  5B32 A;  5DNN D;  4H9P B;  3W98 C;  4G91 B;  2RVQ D;  3LJA D;  1P3O D;  3W98 B;  3MGQ B;  1EQZ D;  3O62 C;  2F8N K;  4J8V C; 
#chains in the Genus database with same CATH homology
 1P3O A;  1P3G A;  3B0D C;  3LZ1 D;  1HQ3 C;  3UT9 C;  2Y2I A;  3MGR C;  5CPJ C;  3UT9 B;  3KUY A;  3MGR B;  5CPJ B;  3W98 D;  1P3L B;  5CPI B;  2RVQ C;  5B40 B;  3LJA C;  3EPH A;  2JSS A;  5AV9 A;  1KX4 C;  1ID3 D;  3AZM D;  4KGC C;  2YFV A;  4X23 A;  4XUJ A;  5DNN B;  5AY8 B;  4J8X C;  4J8V D;  3A6N B;  4KGC B;  5AV5 A;  4J8X B;  3A6N C;  5KDM A;  2XD5 A;  3REK C;  1BH9 B;  3VH5 T;  3VH5 A;  4ZUX D;  4CAY B;  3REL A;  3REH A;  1F66 A;  1PZR A;  4H9S C;  5B2I A;  3LZ0 C;  4DQY B;  4J8X D;  3AN2 B;  1P3M A;  2NQB B;  5B1M B;  3H0M C;  5CPI D;  3AZK D;  3X1S D;  5CHL B;  1P3B D;  4WU9 B;  3AZN B;  5AV6 C;  4JJN C;  1M18 C;  4XZQ A;  5B1M A;  3LEL A;  3X1S A;  5GSU B;  2PYO B;  3MGS D;  3AV1 B;  1AOI A;  2CV5 D;  4H9R A;  5BNX A;  3AZI C;  5GXQ A;  4Z66 A;  3X1V D;  5AV6 D;  4JJN D;  1M18 D;  3AN2 D;  2HIO D;  3A1K A;  3MGS C;  3AZN D;  1P3L A;  3WAA B;  1P3M B;  2NQB A;  3UTB C;  1P3A C;  1U35 A;  3H0R C;  3B0B A;  3UTB B;  4LD9 D;  5F99 A;  3X1V C;  1F1E A;  2HIO B;  5C3I C;  3REL B;  1F66 B;  2BYK A;  4KUD D;  5CPK C;  5BNV A;  4E45 A;  3W97 C;  3C1C A;  5CP6 D;  3UTA B;  5B2J C;  3AZJ B;  3LJA B;  5B40 C;  3AZM A;  1ID3 A;  5B2J B;  4H9N A;  2IO5 C;  3AFA A;  4H9Q B;  4NE5 A;  5B33 A;  4YM6 A;  4LD9 C;  1P34 A;  1KX5 D;  3MNN A;  4J8W D;  3UTA D;  1P3P A;  1P3K D;  5B0Y A;  3MGP D;  1BFM A;  5B2J D;  4R8P B;  3WTP A;  5CP6 A;  1KX3 B;  5B0Z C;  3MNN D;  3WTP C;  5BT1 C;  5GT3 A;  2Y2G A;  5CP6 B;  5AVC A;  3WKJ B;  5B0Y C;  5B33 B;  1B6W A;  1P3P C;  3V9R A;  4YS3 C;  5B0Y B;  5B1L D;  4YS3 B;  5AVB C;  1P3K C;  1M19 A;  4LD9 A;  3AZG A;  5B33 C;  4HGA C;  4Z5T D;  2ARO D;  4G91 C;  2HIO A;  5GSU C;  2PYO C;  1M1A D;  3WTP D;  5BT1 D;  1N1J B;  5FUG A;  5B0Y D;  4R8P D;  4Z66 D;  4HGA B;  2ZY2 A;  5B31 A;  5B1L C;  3REI A;  4ZUX B;  5AVB D;  1U35 C;  1KX4 B;  4WU9 A;  1M1A B;  1P3L C;  2CWE A;  5GSU D;  2PYO D;  1M1A C;  3WAA A;  3VH5 W;  3AZK B;  4Z66 B;  3X1T A;  5GT0 C;  5DNM A;  3AZL B;  4WU9 D;  1P3A B;  4Z5T B;  2ZY4 A;  3X1V B;  3REI D;  5B2I D;  5DNM B;  3REH D;  2G5H C;  3LEL B;  1ZLA D;  4QLC A;  2CV5 B;  2BG1 A;  4Z5T A;  3VH6 A;  3X1T C;  2FJ7 B;  4WZS B;  2Y2P A;  4H9O A;  5B1M C;  3REI B;  5B2I B;  5BO0 B;  4AWL B;  1JFI A;  3AV1 C;  1BH9 A;  3LZ0 A;  3AZJ D;  2FJ7 D;  3B6G D;  5AV8 B;  5B1M D;  5FUG B;  5E5A C;  5JRG A;  3EPK A;  3NQJ A;  3C1B C;  3MGP B;  3AYW A;  5AVB A;  5AY8 A;  5DNN A;  3W99 B;  1KX4 A;  4YS3 A;  2L5A A;  2HUE B;  3WA9 A;  3AFA D;  3LJA A;  3AZM B;  2Y2H A;  1KX5 B;  5GT3 C;  5E5A D;  3MGR A;  5CPJ A;  3W96 A;  5GT3 B;  5B0Z A;  3W96 C;  1P3G C;  1P34 B;  5JRG D;  3WA9 B;  3NQU B;  3C1B D;  1P3G B;  1KX3 D;  5AV8 D;  3WA9 C;  2IO5 B;  2DF4 C;  3VH6 T;  5AY8 C;  5DNN C;  5B24 C;  3W96 B;  5BO0 A;  3C1B A;  3EG5 B;  4UUZ A;  1Z2C B;  5BNV B;  5GT3 D;  3KWQ A;  3B6F B;  1HTA A;  1EQZ C;  2YFW B;  3O62 D;  4WU8 A;  5AVC B;  5B24 B;  1EQZ B;  3NQU A;  5JRG C;  5B2J A;  3AFA B;  1KX3 C;  3LZ1 C;  1TAF A;  5GXQ D;  2JCH A;  2FFF B;  3WTP B;  5JA4 B;  3AZE D;  1JFI B;  3X1V A;  1T3U A;  3AV1 A;  2XD1 A;  1H3O B;  3B0C T;  1P3A A;  3UTB A;  2NQB C;  5AVB B;  3AZH D;  3X1T B;  3MGS A;  2RIQ A;  4EO5 B;  3A6N D;  1P3B A;  1P3K B;  4EO5 C;  4H9R B;  5BNX B;  3AV2 D;  1P3I D;  2FJ7 A;  4NE6 A;  3TU4 D;  1U35 B;  1TZY D;  3X1S C;  3KXB D;  5B1L B;  3REJ D;  1P3B C;  5BS7 A;  1P3F B;  5GT0 A;  5AV5 D;  3WAA C;  1M1A A;  3AZH B;  4XUJ B;  1P3I A;  1WWS A;  5GT0 B;  4X23 D;  3AZL C;  3TU4 C;  5B1L A;  1TZY C;  5B31 C;  5KDM B;  3KSY A;  3REL C;  1F66 C;  4WNN A;  1KX3 A;  4WU8 B;  3KUY D;  3WAA D;  2HIO C;  5C3I B;  4WU8 C;  5AV9 B;  2NZD D;  2VQR A;  2Y2N A;  3MNN B;  3MVD B;  3KWQ C;  1Q9C A;  3AZL D;  5AV5 B;  4X23 C;  4J8X A;  1P3K A;  1M19 C;  4KGC A;  5B24 A;  3A1I A;  1P3A D;  4AWL C;  3KFU G;  5AVC C;  4YM6 D;  2JE5 A;  4UUZ B;  3KWQ B;  5B0Z B;  3KUY C;  4LD9 B;  2BYM A;  3REH B;  4KUD C;  4CAY A;  3UT9 A;  3W97 D;  1N1J A;  5CP6 C;  1P3P B;  1M19 D;  2F2A C;  3UT9 D;  1HQ3 D;  3AZG B;  3H0L C;  5CPJ D;  3MGR D;  3AYW C;  4YM6 C;  5AVC D;  3W98 A;  4H9N B;  4J8W C;  1KX4 D;  5AV8 A;  1ID3 C;  2Y2M A;  3MGP C;  5B40 A;  3AZM C;  2ZM5 A;  4CSR B;  4J8V B;  1WWI A;  4KGC D;  5E5A A;  3AZE B;  3W99 C;  3W97 A;  5B0Z D;  1ULY A;  5G49 A;  5CPK A;  4Z2M G;  2NZD A;  3REK D;  1ID3 B;  4QLC D;  3B0D B;  3AYW D;  3UTA A;  1P3P D;  4ZUX C;  2Y2O A;  2BYM B;  1KX5 A;  3LZ0 D;  2LY8 A;  5B31 G;  1P3I B;  3W99 D;  4H9Q A;  3AZF B;  4Z5T C;  5CPI C;  3AZK C;  3WTP E;  3B6F C;  3EPL A;  4QLC C;  3LZ1 B;  3TU4 B;  4Z66 C;  3F6T A;  4Z2M H;  5JRG B;  2BYK B;  4J8U B;  3REK B;  2CV5 C;  1ZLA A;  3AZI D;  5DNM C;  3AZN A;  2G5I C;  3LEL C;  1S32 C;  3B6F D;  5GT0 D;  1S32 B;  3AN2 C;  3AV2 A;  4WU9 C;  4H9O B;  3AL0 C;  4XUJ D;  1S32 A;  3REI C;  3KUY B;  3AZN C;  5GXQ B;  5B2I C;  3REH C;  4ZBJ B;  1ZLA C;  3UTB D;  5DNM D;  2ZY3 A;  3LEL D;  1ZLA B;  1S32 D;  3FDD A;  5GSU A;  3X1S B;  3AZE A;  2PYO A;  3B0C W;  3A6N A;  3X1T D;  5CPK D;  3AZG C;  4XZQ B;  4G92 C;  2YFW A;  3X1U C;  2F8N H;  4XUJ C;  3V9R B;  3X1U B;  5B32 B;  5B40 D;  3AZK A;  2UWX A;  3MGS B;  3AV1 D;  2DQN C;  1KX5 C;  4R8P A;  3B6G C;  1HQ3 A;  4ZUX A;  2HUE C;  3B6G B;  3UTA C;  3O62 B;  3AZG D;  5B31 B;  3WKJ A;  3X1U D;  3C1C D;  3KXB B;  3REJ B;  2ARO A;  2Y2J A;  3MNN C;  5F99 D;  1P34 C;  3W99 A;  3WKJ D;  5G49 B;  4E44 A;  5CPK B;  4NE3 A;  4YS3 D;  3AFA C;  4J8W A;  4WJ3 C;  3NQJ B;  2F8N B;  3EPJ A;  3C1C C;  4H9P A;  4KUD B;  3R45 B;  3W96 D;  5B33 D;  5F99 B;  1BH8 B;  2ARO C;  1P3O B;  4J8U C;  5F99 C;  1P34 D;  3WKJ C;  3LZ0 B;  3WA9 D;  3C1C B;  5B24 D;  4KUD A;  4R8P C;  3B6G A;  4KHA A;  1AOI D;  3P5J B;  3MVD A;  4J8W B;  1U35 D;  4YM6 B;  1P3L D;  4J8U D;  3X1U A;  3AZF D;  1R4V A;  1KU5 A;  2Y2Q A;  4WNN B;  2F8N D;  5GXQ C;  3AZJ A;  3AZI A;  1AOI B;  1P3M D;  3AZE C;  3KXB A;  3REJ A;  4WV4 B;  1AOI C;  1HQ3 B;  5B32 G;  2NQB D;  1W2E A;  3AZH C;  1TZY A;  3TU4 A;  1P3B B;  4XZQ C;  4G92 B;  2Y2L A;  5AV6 A;  4JJN A;  3AZL A;  1M18 A;  3AZF C;  1P3F A;  3AV2 C;  3AN2 A;  1P3I C;  1P3F C;  3AZF A;  1P3M C;  3AV2 B;  3AZH A;  4H9S A;  2ZY5 A;  5BS7 C;  2Y2K A;  4M6B A;  4QLC B;  2J8P A;  2CV5 A;  1TAF B;  4XZQ D;  4DRA A;  3KXB C;  3REJ C;  1TZY B;  3REK A;  1BH8 A;  3AZJ C;  2FJ7 C;  5AV5 C;  4X23 B;  1P3F D;  3W97 B;  2F8N G;  3B6F A;  4CSR A;  1M19 B;  5CPI A;  3VH6 W;  5AV9 C;  5AV6 B;  3MVD C;  4JJN B;  1M18 B;  4DRB A;  5B32 D;  5B31 D;  3MGQ D;  2YFV B;  3REL D;  1F66 D;  1B67 A;  2ARO B;  1P3O C;  4J8V A;  1H3O A;  4ZBJ C;  4J8U A;  4WU8 D;  3R45 A;  3O62 A;  4UPK A;  4KHA B;  3AZI B;  2NZD C;  5JA4 A;  4NFT A;  1A7W A;  2F8N A;  3KWQ D;  3LZ1 A;  5AV9 D;  3C1B B;  1P3G D;  2NZD B;  3MVD D;  2W8S A;  3IP4 C;  5B32 C;  3MGP A;  3MGQ C;  3AYW B;  5E5A B;  5AV8 C;  1EQZ A;  3MGQ A;  5AY8 D;  5B32 A;  5DNN D;  4H9P B;  3W98 C;  4G91 B;  2RVQ D;  3LJA D;  1P3O D;  3W98 B;  3MGQ B;  1EQZ D;  3O62 C;  2F8N K;  4J8V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...