4XZQA

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHARVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 97
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqA00
3AZJC 5B32C 4H9RB 3AV1B 4J8XC 1KX3D 3W97C 3NQUB 5B2JA 1P3BD 2PYOC 3AFAD 4EO5C 3AN2A 3KXBA 5F99D 5DNNA 5E5AB 3LELB 4WU8D 1S32D 5AV6D 1ZLAB 1WWSA 3MNND 4X23D 2JSSA 5B0YB 3AZLC 3MGPC 4H9OA 1P3LB 3B6FA 3X1VD 5GXQB 1P3MD 3VH6T 3X1SA 2F8NG 3AZIC 5FUGA 4YM6D 3AZKD 3AZEA 3UTBA 1AOIA 5AV5A 2NQBC 4KGCA 5AVBB 5GSUB 5B31A 4AWLC 2BYMB 5B1LA 1F66A 1EQZB 2IO5B 5B2IC 3MGSD 4J8VC 5CPIB 5AV9C 3AYWC 4G91B 3X1TA 1P3GB 3WA9C 4Z66D 3W96B 3R45B 2PYOD 3W98C 3WKJD 3B0DC 4R8PA 3KXBC 1M19C 4G92C 4ZUXB 4XZQD 3REIA 1P3KA 3AZID 3RELA 1M18A 3WAAB 2CV5D 3REJA 3KUYD 4WNNA 2RVQD 3VH6A 1TZYB 3AZND 1ID3D 1BH8B 2NZDA 4CAYA 3WTPC 3C1BC 1AOIC 1BH9A 2F8NA 5B2ID 4LD9D 5AV9D 5AVCB 2AROD 5GT0D 3AZJB 5B40A 5B32B 2BYKB 4WU9D 3LJAA 4J8XB 4QLCA 3AV1C 3MGQA 5AY8D 3W97B 1U35D 5AV8C 4EO5B 1M19D 3LZ1D 4KHAB 4R8PC 5E5AC 3B0BA 1P3AC 1KX4D 3AZLB 3MGPB 5BS7A 3REIC 3X1UA 1H3OB 3AZIB 3AZFA 3RELC 1M18C 3O62A 1P3PA 1HQ3B 1TAFA 3C1BD 3UTAD 3AZMA 3W99D 4E45A 2NQBB 2YFWA 5CPKD 4AWLB 1P3ID 1KX3A 4J8VB 3AYWB 1P3BA 3AFAA 1A7WA 4NE3A 5F99A 3V9RA 5CPIC 4JJNA 3AV1D 3KSYA 2FJ7A 4H9PA 5AV8D 4X23A 3MGQC 3REHC 3W98B 3B0DB 4HGAC 1ZLAD 3LELD 5E5AD 3KXBB 1M19B 4G92B 5B24A 3AZKA 1P3OA 3AZGA 5B0YD 1P3FC 4ZUXC 4H9OB 3A6NA 3MGRC 1WWIA 5BNXA 3O62C 1P3PC 3B6GA 3WTPB 5CPJA 5C3IC 1AOIB 3LZ0A 5AV5B 4KGCB 5GSUD 5B1MC 1EQZD 3WKJA 1BFMA 5CPID 5AVCC 3AV2C 5DNMA 1P3GD 4UUZA 5CP6A 1P34C 3W96D 2FJ7C 4H9QB 5AV8B 4XZQA 2F8NH 3C1CA 4J8UA 4R8PB 1P3AB 3KWQC 4ZBJB 5B33A 4ZUXD 1M1AA 1P3OC 3REIB 5GT3A 3A6NC 3RELB 1M18B 1KX5A 3WAAD 2AROA 1TZYD 3TU4C 4WU9A 1HQ3C 5B0ZA 4XUJC 3LZ0C 4H9NA 5AY8A 5BT1C 5AVCD 1B6WA 3WA9A 3AZJD 5B32D 4J8XD 4Z5TA 1JFIA 3MGQB 3REHB 3W97D 4HGAB 5KDMA 3C1CC 5B2JC 4J8UC 3AN2C 5DNNC 1N1JA 1P3FB 3AZLD 3MGPD 3UT9A 3W99A 3MGRB 3B6FC 4KUDA 3O62B 1P3PB 3X1SC 1HQ3D 4XUJD 1TAFB 3AZMB 5C3IB 2NQBD 4H9RA 3AZEC 3UTBC 5BT1D 5B1MB 5AV5C 4KGCC 4J8VD 5B31C 5JRGA 5B1LC 3AYWD 4J8WA 3AZHA 3AV2B 1F66C 1ZLAA 2HIOA 1P34B 4JJNB 2FJ7B 2LY8A 3X1TC 4Z5TC 3W98D 5B0YA 1P3LA 5B2JD 5GXQA 3REKA 3KXBD 2CWEA 3MVDA 3KWQB 4NE5A 5BNVB 5B24B 1P3OB 4ZBJC 5B32G 3B6FD 3UT9C 3A6NB 5AVBA 1P3KC 1EQZA 4CSRA 4YS3A 3TU4B 4XUJB 3B6GB 3WTPD 3REJC 1AOID 5CPJB 1P3GA 5AV5D 3LZ0B 3NQJA 4KGCD 3W96A 2NZDC 5B31D 2HUEB 5JRGC 3AZHC 1S32A 4WU8A 3X1TD 2HIOC 5DNMB 5B40C 5AV6A 5CP6B 3LJAC 4QLCC 3MNNA 3C1CB 5B2JB 3X1VA 4J8UB 4R8PD 3REKC 3AN2B 1P3MA 5DNNB 1P3AD 3MVDC 5JA4A 4YM6A 4DRAA 3REID 1P3KD 5CHLB 3B6FB 5BS7C 3RELD 1M18D 5G49A 3X1UC 3X1SB 2YFVA 3AZFC 5FUGB 1Q9CA 3MGSA 3B0CT 5B32A 2BYKA 5B0ZB 2NZDD 3AZEB 3UTBB 3AZMC 4J8XA 4Z66A 5B31B 5B1LB 1F66B 2PYOA 1KX3C 3WA9B 4KHAA 1P3BC 3AFAC 1S32C 3VH5W 4WU8C 5F99C 3X1TB 1F1EA 4Z5TB 4QLCD 5AV6C 4JJNC 3MGQD 3REHD 3AZLA 1JFIB 4X23C 3AZIA 4NFTA 5B31G 3X1VC 1KU5A 1P3MC 1P3FD 2CV5A 5B24C 3UT9B 3KUYA 3AZKC 3MGRD 2NQBA 1ID3A 3AZNA 3AZGC 1P3KB 3AZFD 3O62D 5B2IA 1P3PD 4LD9A 5AV9A 3AYWA 5BO0A 3REJB 3AZMD 5GT0A 3MGSC 4WNNB 3B6GC 2NZDB 5B1MD 4CAYB 5CPJC 4Z2MG 1BH9B 4Z66C 2F8NB 3W98A 3AV2D 1U35A 5JRGB 4J8WB 3AZHB 3WKJC 2HIOB 1B67A 2HUEC 5B40B 4M6BA 3LZ1A 4JJND 1P34D 1M19A 2FJ7D 3LJAB 5DNMC 4QLCB 5CP6C 3B0CW 1KX4A 4XZQC 3REKB 3KWQD 3MVDB 5B24D 4H9SA 1P3OD 2F8NK 3AZGD 5B33C 3UTAA 3C1BA 3WTPA 2CV5C 1M1AC 3A6ND 3KUYC 2RVQC 1ID3C 3X1UB 4NE6A 3AZNC 5CPKA 5GT3C 1P3IA 3AZFB 1KX5C 4CSRB 4YS3B 4LD9C 3TU4D 3B6GD 2AROC 5CPJD 5GT0C 3LZ0D 3NQJB 5B0ZC 2YFWB 3AV1A 4WU9C 4H9QA 5AV8A 4DRBA 1KX3B 3NQUA 5AY8C 1U35C 1P3BB 4WZSB 3AFAB 3LELA 4WU8B 5E5AA 5DNMD 5F99B 3V9RB 1S32B 3LZ1C 5CP6D 5AV6B 1P3AA 4H9PB 3MNNB 4X23B 1KX4C 3C1CD 4J8UD 3X1VB 3AN2D 5DNND 1P3MB 5JA4B 5B33D 1M1AD 4YM6B 4H9SC 3AZKB 3AZGB 5GT3D 3UTAC 3W99C 5G49B 1KX5D 5GSUA 3X1SD 5CPKC 2BYMA 2YFVB 5BNXB 1P3IC 3VH5T 1HTAA 4KUDC 3MGSB 5CPIA 5B0ZD 3VH6W 3AZED 3UTBD 4Z66B 3REHA 3R45A 5B1LD 1F66D 2PYOB 4E44A 3WA9D 3WKJB 4J8WC 4WV4B 1ZLAC 3LELC 4Z5TD 4UUZB 1P3FA 2L5AA 4ZUXA 1ULYA 4XZQB 3MGRA 5B0YC 1P3LC 5GXQC 3WAAA 5B33B 3UT9D 2CV5B 1M1AB 3KUYB 1TZYA 1BH8A 3AZNB 1ID3B 5GT3B 5B1MA 1KX5B 5AVBC 4KUDD 5GSUC 5B2IB 4LD9B 5AVCA 3AV2A 5AV9B 1EQZC 5BO0B 2IO5C 4YS3C 3REJD 2AROB 5GT0B 3AZJA 1P34A 4WU9B 4G91C 3VH5A 1P3GC 2F8ND 4H9NB 3W96C 3W97A 5AY8B 5JRGD 1U35B 4J8WD 3AZHD 2HIOD 5B40D 3KWQA 5BNVA 3LZ1B 3LJAD 1R4VA 1KX4B 3MGPA 1P3LD 5GXQD 3MNNC 1H3OA 3REKD 5KDMB 3MVDD 3WAAC 1N1JB 3TU4A 1HQ3A 4XUJA 4Z2MH 4YM6C 3C1BB 3UTAB 3W99B 1TZYC 3X1UD 5AVBD 3WTPE 5CPKB 1P3IB 4YS3D 4J8VA 4KUDB
chains in the Genus database with same CATH superfamily
3AZJC 5B32C 4H9RB 3AV1B 4J8XC 1KX3D 3W97C 3NQUB 5B2JA 1P3BD 2PYOC 3AFAD 4EO5C 3AN2A 2JCHA 5F99D 5DNNA 5E5AB 3KXBA 3LELB 4WU8D 5AV6D 1ZLAB 1WWSA 3MNND 4X23D 2JSSA 2Y2HA 5B0YB 3AZLC 3MGPC 4H9OA 1P3LB 3B6FA 3X1VD 5GXQB 1P3MD 3VH6T 3X1SA 2F8NG 3AZIC 3A1IA 5FUGA 4YM6D 3AZKD 3AZEA 3UTBA 1AOIA 2XD5A 5AV5A 2NQBC 4KGCA 5AVBB 5GSUB 5B31A 4AWLC 2BYMB 5B1LA 1F66A 1EQZB 2IO5B 5B2IC 3MGSD 4J8VC 5CPIB 5AV9C 3AYWC 4G91B 3X1TA 1P3GB 3WA9C 4Z66D 3W96B 3R45B 2PYOD 3A1KA 1PZRA 3W98C 3WKJD 3B0DC 4R8PA 3KXBC 2DQNC 1M19C 4G92C 4ZUXB 4XZQD 3REIA 1P3KA 2Y2PA 2VQRA 3AZID 3RELA 1M18A 3WAAB 2CV5D 3REJA 3KUYD 4WNNA 2RVQD 3VH6A 1TZYB 3AZND 1ID3D 1BH8B 2NZDA 4CAYA 3WTPC 3C1BC 1AOIC 1BH9A 2F8NA 5B2ID 4LD9D 5AV9D 5AVCB 2Y2OA 2AROD 5GT0D 3AZJB 5B40A 5B32B 2BYKB 4WU9D 3LJAA 1T3UA 2JE5A 4J8XB 4QLCA 3AV1C 3MGQA 5AY8D 3W97B 1U35D 2Y2LA 5AV8C 4EO5B 1M19D 3LZ1D 4KHAB 4R8PC 5E5AC 3B0BA 1P3AC 1W2EA 1KX4D 3AZLB 3MGPB 5BS7A 3REIC 3X1UA 1H3OB 3AZIB 3AZFA 3RELC 1M18C 3O62A 1P3PA 2W8SA 1HQ3B 1TAFA 3C1BD 3UTAD 3AZMA 3W99D 3EPHA 4E45A 2NQBB 2YFWA 5CPKD 4AWLB 1P3ID 3EPKA 1KX3A 4J8VB 3AYWB 1P3BA 3AFAA 1A7WA 4NE3A 5F99A 3V9RA 5CPIC 4JJNA 3AV1D 3KSYA 2FJ7A 4H9PA 5AV8D 4X23A 3MGQC 3REHC 3W98B 3B0DB 4HGAC 1ZLAD 3LELD 5E5AD 3KXBB 1M19B 4G92B 5B24A 3AZKA 1P3OA 3AZGA 5B0YD 3EPLA 1P3FC 4ZUXC 4H9OB 3A6NA 3MGRC 1WWIA 5BNXA 3O62C 1P3PC 3B6GA 3WTPB 5CPJA 5C3IC 1AOIB 3LZ0A 5AV5B 4KGCB 5GSUD 5B1MC 1EQZD 3WKJA 1BFMA 5CPID 5AVCC 3AV2C 5DNMA 1P3GD 4UUZA 5CP6A 1P34C 3W96D 2FJ7C 4H9QB 5AV8B 4XZQA 2F8NH 3C1CA 4J8UA 4R8PB 4UPKA 1P3AB 3KWQC 4ZBJB 5B33A 4ZUXD 1M1AA 1P3OC 3REIB 3EPJA 5GT3A 3A6NC 3RELB 1M18B 1KX5A 2Y2JA 3WAAD 2AROA 2F2AC 1TZYD 3H0RC 3TU4C 1HQ3C 5B0ZA 4XUJC 4WU9A 3LZ0C 4H9NA 5AY8A 2BG1A 5BT1C 5AVCD 1B6WA 3WA9A 3AZJD 5B32D 4J8XD 4Z5TA 1JFIA 3MGQB 3REHB 3W97D 4HGAB 5KDMA 3C1CC 5B2JC 4J8UC 3AN2C 2RIQA 5DNNC 1N1JA 1P3FB 3AZLD 3MGPD 2Y2QA 3UT9A 3W99A 3MGRB 3B6FC 4KUDA 3O62B 1P3PB 3X1SC 1HQ3D 4XUJD 1TAFB 3AZMB 5C3IB 2NQBD 4H9RA 3AZEC 3UTBC 5BT1D 5B1MB 5AV5C 4KGCC 4J8VD 5B31C 5JRGA 5B1LC 3AYWD 4J8WA 3AZHA 3AV2B 1F66C 1ZLAA 2HIOA 1P34B 4JJNB 2FJ7B 2LY8A 1S32D 3X1TC 4Z5TC 3W98D 5B0YA 2J8PA 1P3LA 5B2JD 5GXQA 1Z2CB 3REKA 3KXBD 2CWEA 3MVDA 3KWQB 4NE5A 5BNVB 5B24B 1P3OB 4ZBJC 5B32G 3B6FD 3UT9C 3A6NB 5AVBA 2XD1A 1P3KC 1EQZA 4CSRA 4YS3A 3TU4B 4XUJB 3B6GB 2ZY2A 3WTPD 3REJC 1AOID 5CPJB 1P3GA 5AV5D 3LZ0B 3NQJA 4KGCD 3W96A 2NZDC 5B31D 2G5IC 2HUEB 5JRGC 3AZHC 1S32A 4WU8A 3X1TD 2HIOC 5DNMB 5B40C 5AV6A 5CP6B 3LJAC 4QLCC 3MNNA 3C1CB 5B2JB 3X1VA 4J8UB 4R8PD 3REKC 3AN2B 1P3MA 5DNNB 1P3AD 3MVDC 5JA4A 4YM6A 4DRAA 3REID 3IP4C 5CHLB 1P3KD 3B6FB 2Y2KA 3H0LC 5BS7C 3RELD 1M18D 5G49A 3X1UC 3X1SB 2Y2MA 2YFVA 3AZFC 5FUGB 1Q9CA 3MGSA 3B0CT 5B32A 2BYKA 5B0ZB 2NZDD 3AZEB 3UTBB 3AZMC 4J8XA 4Z66A 5B31B 5B1LB 1F66B 2PYOA 1KX3C 4WJ3C 3WA9B 4KHAA 1P3BC 3AFAC 1S32C 3VH5W 4WU8C 5F99C 3X1TB 1F1EA 4Z5TB 4QLCD 3AL0C 5AV6C 4JJNC 3MGQD 3REHD 2ZY3A 3AZLA 1JFIB 4X23C 3AZIA 4NFTA 5B31G 3X1VC 1KU5A 2ZM5A 1P3MC 1P3FD 2CV5A 5B24C 3UT9B 3KUYA 3FDDA 3AZKC 3MGRD 2NQBA 1ID3A 3AZNA 3AZGC 1P3KB 3AZFD 3O62D 5B2IA 1P3PD 4LD9A 5AV9A 3AYWA 5BO0A 3REJB 2ZY4A 5GT0A 3MGSC 3AZMD 4WNNB 3B6GC 2NZDB 5B1MD 4CAYB 5CPJC 4Z2MG 1BH9B 4Z66C 3F6TA 2F8NB 3W98A 3H0MC 3AV2D 1U35A 5JRGB 4J8WB 3AZHB 3WKJC 2HIOB 1B67A 2HUEC 5B40B 4M6BA 3LZ1A 4JJND 1P34D 1M19A 2FJ7D 3LJAB 5DNMC 4QLCB 5CP6C 3B0CW 1KX4A 4XZQC 3REKB 3KWQD 3MVDB 5B24D 4H9SA 1P3OD 2F8NK 3AZGD 5B33C 3UTAA 3C1BA 3WTPA 2CV5C 1M1AC 3A6ND 3KUYC 2RVQC 1ID3C 3X1UB 4NE6A 3AZNC 5CPKA 5GT3C 1P3IA 3AZFB 1KX5C 4CSRB 4YS3B 4LD9C 3TU4D 3B6GD 2Y2IA 2AROC 5CPJD 5GT0C 3LZ0D 3NQJB 5B0ZC 2YFWB 3AV1A 4WU9C 4H9QA 5AV8A 4DRBA 2UWXA 1KX3B 3NQUA 5AY8C 1U35C 1P3BB 4WZSB 3AFAB 3LELA 4WU8B 5E5AA 5DNMD 5F99B 3V9RB 1S32B 3LZ1C 5CP6D 5AV6B 1P3AA 4H9PB 3MNNB 4X23B 1KX4C 3C1CD 4J8UD 3X1VB 2FFFB 3AN2D 5DNND 1P3MB 3KFUG 5JA4B 5B33D 1M1AD 4YM6B 4H9SC 3AZKB 2ZY5A 3AZGB 5GT3D 3UTAC 3W99C 5G49B 1KX5D 5GSUA 3X1SD 5CPKC 2BYMA 2YFVB 5BNXB 1P3IC 3VH5T 2G5HC 1HTAA 4KUDC 3MGSB 5CPIA 5B0ZD 3VH6W 3AZED 3P5JB 3UTBD 4Z66B 3REHA 2DF4C 3R45A 5B1LD 1F66D 2PYOB 4E44A 3WA9D 3WKJB 3EG5B 4J8WC 4WV4B 1ZLAC 3LELC 4Z5TD 4UUZB 1P3FA 2L5AA 4ZUXA 1ULYA 4XZQB 3MGRA 5B0YC 1P3LC 5GXQC 3WAAA 5B33B 3UT9D 2CV5B 1M1AB 3KUYB 1TZYA 1BH8A 3AZNB 1ID3B 5GT3B 5B1MA 1KX5B 5AVBC 4KUDD 5GSUC 5B2IB 4LD9B 5AVCA 3AV2A 5AV9B 1EQZC 5BO0B 2IO5C 4YS3C 3REJD 2AROB 5GT0B 3AZJA 1P34A 4WU9B 4G91C 3VH5A 2Y2NA 1P3GC 2F8ND 4H9NB 3W96C 3W97A 5AY8B 5JRGD 1U35B 4J8WD 3AZHD 2HIOD 5B40D 3KWQA 5BNVA 3LZ1B 3LJAD 1R4VA 1KX4B 3MGPA 1P3LD 2Y2GA 5GXQD 3MNNC 1H3OA 3REKD 5KDMB 3MVDD 3WAAC 1N1JB 3TU4A 1HQ3A 4XUJA 4Z2MH 4YM6C 3C1BB 3UTAB 3W99B 1TZYC 3X1UD 5AVBD 3WTPE 5CPKB 1P3IB 4DQYB 4YS3D 4J8VA 4KUDB
chains in the Genus database with same CATH topology
3AZJC 5B32C 4H9RB 3AV1B 4J8XC 1KX3D 3W97C 3NQUB 5B2JA 1P3BD 2PYOC 3AFAD 4EO5C 3AN2A 2JCHA 5F99D 5DNNA 5E5AB 3KXBA 3LELB 4WU8D 5AV6D 1ZLAB 1WWSA 3MNND 4X23D 2JSSA 2Y2HA 5B0YB 3AZLC 3MGPC 4H9OA 1P3LB 3B6FA 3X1VD 5GXQB 1P3MD 3VH6T 3X1SA 2F8NG 3AZIC 3A1IA 5FUGA 4YM6D 3AZKD 3AZEA 3UTBA 1AOIA 2XD5A 5AV5A 2NQBC 4KGCA 5AVBB 5GSUB 5B31A 4AWLC 2BYMB 5B1LA 1F66A 1EQZB 2IO5B 5B2IC 3MGSD 4J8VC 5CPIB 5AV9C 3AYWC 4G91B 3X1TA 1P3GB 3WA9C 4Z66D 3W96B 3R45B 2PYOD 3A1KA 1PZRA 3W98C 3WKJD 3B0DC 4R8PA 3KXBC 2DQNC 1M19C 4G92C 4ZUXB 4XZQD 3REIA 1P3KA 2Y2PA 2VQRA 3AZID 3RELA 1M18A 3WAAB 2CV5D 3REJA 3KUYD 4WNNA 2RVQD 3VH6A 1TZYB 3AZND 1ID3D 1BH8B 2NZDA 4CAYA 3WTPC 3C1BC 1AOIC 1BH9A 2F8NA 5B2ID 4LD9D 5AV9D 5AVCB 2Y2OA 2AROD 5GT0D 3AZJB 5B40A 5B32B 2BYKB 4WU9D 3LJAA 1T3UA 2JE5A 4J8XB 4QLCA 3AV1C 3MGQA 5AY8D 3W97B 1U35D 2Y2LA 5AV8C 4EO5B 1M19D 3LZ1D 4KHAB 4R8PC 5E5AC 3B0BA 1P3AC 1W2EA 1KX4D 3AZLB 3MGPB 5BS7A 3REIC 3X1UA 1H3OB 3AZIB 3AZFA 3RELC 1M18C 3O62A 1P3PA 2W8SA 1HQ3B 1TAFA 3C1BD 3UTAD 3AZMA 3W99D 3EPHA 4E45A 2NQBB 2YFWA 5CPKD 4AWLB 1P3ID 3EPKA 1KX3A 4J8VB 3AYWB 1P3BA 3AFAA 1A7WA 4NE3A 5F99A 3V9RA 5CPIC 4JJNA 3AV1D 3KSYA 2FJ7A 4H9PA 5AV8D 4X23A 3MGQC 3REHC 3W98B 3B0DB 4HGAC 1ZLAD 3LELD 5E5AD 3KXBB 1M19B 4G92B 5B24A 3AZKA 1P3OA 3AZGA 5B0YD 3EPLA 1P3FC 4ZUXC 4H9OB 3A6NA 3MGRC 1WWIA 5BNXA 3O62C 1P3PC 3B6GA 3WTPB 5CPJA 5C3IC 1AOIB 3LZ0A 5AV5B 4KGCB 5GSUD 5B1MC 1EQZD 3WKJA 1BFMA 5CPID 5AVCC 3AV2C 5DNMA 1P3GD 4UUZA 5CP6A 1P34C 3W96D 2FJ7C 4H9QB 5AV8B 4XZQA 2F8NH 3C1CA 4J8UA 4R8PB 4UPKA 1P3AB 3KWQC 4ZBJB 5B33A 4ZUXD 1M1AA 1P3OC 3REIB 3EPJA 5GT3A 3A6NC 3RELB 1M18B 1KX5A 2Y2JA 3WAAD 2AROA 2F2AC 1TZYD 3H0RC 3TU4C 1HQ3C 5B0ZA 4XUJC 4WU9A 3LZ0C 4H9NA 5AY8A 2BG1A 5BT1C 5AVCD 1B6WA 3WA9A 3AZJD 5B32D 4J8XD 4Z5TA 1JFIA 3MGQB 3REHB 3W97D 4HGAB 5KDMA 3C1CC 5B2JC 4J8UC 3AN2C 2RIQA 5DNNC 1N1JA 1P3FB 3AZLD 3MGPD 2Y2QA 3UT9A 3W99A 3MGRB 3B6FC 4KUDA 3O62B 1P3PB 3X1SC 1HQ3D 4XUJD 1TAFB 3AZMB 5C3IB 2NQBD 4H9RA 3AZEC 3UTBC 5BT1D 5B1MB 5AV5C 4KGCC 4J8VD 5B31C 5JRGA 5B1LC 3AYWD 4J8WA 3AZHA 3AV2B 1F66C 1ZLAA 2HIOA 1P34B 4JJNB 2FJ7B 2LY8A 1S32D 3X1TC 4Z5TC 3W98D 5B0YA 2J8PA 1P3LA 5B2JD 5GXQA 1Z2CB 3REKA 3KXBD 2CWEA 3MVDA 3KWQB 4NE5A 5BNVB 5B24B 1P3OB 4ZBJC 5B32G 3B6FD 3UT9C 3A6NB 5AVBA 2XD1A 1P3KC 1EQZA 4CSRA 4YS3A 3TU4B 4XUJB 3B6GB 2ZY2A 3WTPD 3REJC 1AOID 5CPJB 1P3GA 5AV5D 3LZ0B 3NQJA 4KGCD 3W96A 2NZDC 5B31D 2G5IC 2HUEB 5JRGC 3AZHC 1S32A 4WU8A 3X1TD 2HIOC 5DNMB 5B40C 5AV6A 5CP6B 3LJAC 4QLCC 3MNNA 3C1CB 5B2JB 3X1VA 4J8UB 4R8PD 3REKC 3AN2B 1P3MA 5DNNB 1P3AD 3MVDC 5JA4A 4YM6A 4DRAA 3REID 3IP4C 5CHLB 1P3KD 3B6FB 2Y2KA 3H0LC 5BS7C 3RELD 1M18D 5G49A 3X1UC 3X1SB 2Y2MA 2YFVA 3AZFC 5FUGB 1Q9CA 3MGSA 3B0CT 5B32A 2BYKA 5B0ZB 2NZDD 3AZEB 3UTBB 3AZMC 4J8XA 4Z66A 5B31B 5B1LB 1F66B 2PYOA 1KX3C 4WJ3C 3WA9B 4KHAA 1P3BC 3AFAC 1S32C 3VH5W 4WU8C 5F99C 3X1TB 1F1EA 4Z5TB 4QLCD 3AL0C 5AV6C 4JJNC 3MGQD 3REHD 2ZY3A 3AZLA 1JFIB 4X23C 3AZIA 4NFTA 5B31G 3X1VC 1KU5A 2ZM5A 1P3MC 1P3FD 2CV5A 5B24C 3UT9B 3KUYA 3FDDA 3AZKC 3MGRD 2NQBA 1ID3A 3AZNA 3AZGC 1P3KB 3AZFD 3O62D 5B2IA 1P3PD 4LD9A 5AV9A 3AYWA 5BO0A 3REJB 2ZY4A 5GT0A 3MGSC 3AZMD 4WNNB 3B6GC 2NZDB 5B1MD 4CAYB 5CPJC 4Z2MG 1BH9B 4Z66C 3F6TA 2F8NB 3W98A 3H0MC 3AV2D 1U35A 5JRGB 4J8WB 3AZHB 3WKJC 2HIOB 1B67A 2HUEC 5B40B 4M6BA 3LZ1A 4JJND 1P34D 1M19A 2FJ7D 3LJAB 5DNMC 4QLCB 5CP6C 3B0CW 1KX4A 4XZQC 3REKB 3KWQD 3MVDB 5B24D 4H9SA 1P3OD 2F8NK 3AZGD 5B33C 3UTAA 3C1BA 3WTPA 2CV5C 1M1AC 3A6ND 3KUYC 2RVQC 1ID3C 3X1UB 4NE6A 3AZNC 5CPKA 5GT3C 1P3IA 3AZFB 1KX5C 4CSRB 4YS3B 4LD9C 3TU4D 3B6GD 2Y2IA 2AROC 5CPJD 5GT0C 3LZ0D 3NQJB 5B0ZC 2YFWB 3AV1A 4WU9C 4H9QA 5AV8A 4DRBA 2UWXA 1KX3B 3NQUA 5AY8C 1U35C 1P3BB 4WZSB 3AFAB 3LELA 4WU8B 5E5AA 5DNMD 5F99B 3V9RB 1S32B 3LZ1C 5CP6D 5AV6B 1P3AA 4H9PB 3MNNB 4X23B 1KX4C 3C1CD 4J8UD 3X1VB 2FFFB 3AN2D 5DNND 1P3MB 3KFUG 5JA4B 5B33D 1M1AD 4YM6B 4H9SC 3AZKB 2ZY5A 3AZGB 5GT3D 3UTAC 3W99C 5G49B 1KX5D 5GSUA 3X1SD 5CPKC 2BYMA 2YFVB 5BNXB 1P3IC 3VH5T 2G5HC 1HTAA 4KUDC 3MGSB 5CPIA 5B0ZD 3VH6W 3AZED 3P5JB 3UTBD 4Z66B 3REHA 2DF4C 3R45A 5B1LD 1F66D 2PYOB 4E44A 3WA9D 3WKJB 3EG5B 4J8WC 4WV4B 1ZLAC 3LELC 4Z5TD 4UUZB 1P3FA 2L5AA 4ZUXA 1ULYA 4XZQB 3MGRA 5B0YC 1P3LC 5GXQC 3WAAA 5B33B 3UT9D 2CV5B 1M1AB 3KUYB 1TZYA 1BH8A 3AZNB 1ID3B 5GT3B 5B1MA 1KX5B 5AVBC 4KUDD 5GSUC 5B2IB 4LD9B 5AVCA 3AV2A 5AV9B 1EQZC 5BO0B 2IO5C 4YS3C 3REJD 2AROB 5GT0B 3AZJA 1P34A 4WU9B 4G91C 3VH5A 2Y2NA 1P3GC 2F8ND 4H9NB 3W96C 3W97A 5AY8B 5JRGD 1U35B 4J8WD 3AZHD 2HIOD 5B40D 3KWQA 5BNVA 3LZ1B 3LJAD 1R4VA 1KX4B 3MGPA 1P3LD 2Y2GA 5GXQD 3MNNC 1H3OA 3REKD 5KDMB 3MVDD 3WAAC 1N1JB 3TU4A 1HQ3A 4XUJA 4Z2MH 4YM6C 3C1BB 3UTAB 3W99B 1TZYC 3X1UD 5AVBD 3WTPE 5CPKB 1P3IB 4DQYB 4YS3D 4J8VA 4KUDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ C;  5B32 C;  4H9R B;  3AV1 B;  4J8X C;  1KX3 D;  3W97 C;  3NQU B;  5B2J A;  1P3B D;  2PYO C;  3AFA D;  4EO5 C;  3AN2 A;  3KXB A;  5F99 D;  5DNN A;  5E5A B;  3LEL B;  4WU8 D;  1S32 D;  5AV6 D;  1ZLA B;  1WWS A;  3MNN D;  4X23 D;  2JSS A;  5B0Y B;  3AZL C;  3MGP C;  4H9O A;  1P3L B;  3B6F A;  3X1V D;  5GXQ B;  1P3M D;  3VH6 T;  3X1S A;  2F8N G;  3AZI C;  5FUG A;  4YM6 D;  3AZK D;  3AZE A;  3UTB A;  1AOI A;  5AV5 A;  2NQB C;  4KGC A;  5AVB B;  5GSU B;  5B31 A;  4AWL C;  2BYM B;  5B1L A;  1F66 A;  1EQZ B;  2IO5 B;  5B2I C;  3MGS D;  4J8V C;  5CPI B;  5AV9 C;  3AYW C;  4G91 B;  3X1T A;  1P3G B;  3WA9 C;  4Z66 D;  3W96 B;  3R45 B;  2PYO D;  3W98 C;  3WKJ D;  3B0D C;  4R8P A;  3KXB C;  1M19 C;  4G92 C;  4ZUX B;  4XZQ D;  3REI A;  1P3K A;  3AZI D;  3REL A;  1M18 A;  3WAA B;  2CV5 D;  3REJ A;  3KUY D;  4WNN A;  2RVQ D;  3VH6 A;  1TZY B;  3AZN D;  1ID3 D;  1BH8 B;  2NZD A;  4CAY A;  3WTP C;  3C1B C;  1AOI C;  1BH9 A;  2F8N A;  5B2I D;  4LD9 D;  5AV9 D;  5AVC B;  2ARO D;  5GT0 D;  3AZJ B;  5B40 A;  5B32 B;  2BYK B;  4WU9 D;  3LJA A;  4J8X B;  4QLC A;  3AV1 C;  3MGQ A;  5AY8 D;  3W97 B;  1U35 D;  5AV8 C;  4EO5 B;  1M19 D;  3LZ1 D;  4KHA B;  4R8P C;  5E5A C;  3B0B A;  1P3A C;  1KX4 D;  3AZL B;  3MGP B;  5BS7 A;  3REI C;  3X1U A;  1H3O B;  3AZI B;  3AZF A;  3REL C;  1M18 C;  3O62 A;  1P3P A;  1HQ3 B;  1TAF A;  3C1B D;  3UTA D;  3AZM A;  3W99 D;  4E45 A;  2NQB B;  2YFW A;  5CPK D;  4AWL B;  1P3I D;  1KX3 A;  4J8V B;  3AYW B;  1P3B A;  3AFA A;  1A7W A;  4NE3 A;  5F99 A;  3V9R A;  5CPI C;  4JJN A;  3AV1 D;  3KSY A;  2FJ7 A;  4H9P A;  5AV8 D;  4X23 A;  3MGQ C;  3REH C;  3W98 B;  3B0D B;  4HGA C;  1ZLA D;  3LEL D;  5E5A D;  3KXB B;  1M19 B;  4G92 B;  5B24 A;  3AZK A;  1P3O A;  3AZG A;  5B0Y D;  1P3F C;  4ZUX C;  4H9O B;  3A6N A;  3MGR C;  1WWI A;  5BNX A;  3O62 C;  1P3P C;  3B6G A;  3WTP B;  5CPJ A;  5C3I C;  1AOI B;  3LZ0 A;  5AV5 B;  4KGC B;  5GSU D;  5B1M C;  1EQZ D;  3WKJ A;  1BFM A;  5CPI D;  5AVC C;  3AV2 C;  5DNM A;  1P3G D;  4UUZ A;  5CP6 A;  1P34 C;  3W96 D;  2FJ7 C;  4H9Q B;  5AV8 B;  4XZQ A;  2F8N H;  3C1C A;  4J8U A;  4R8P B;  1P3A B;  3KWQ C;  4ZBJ B;  5B33 A;  4ZUX D;  1M1A A;  1P3O C;  3REI B;  5GT3 A;  3A6N C;  3REL B;  1M18 B;  1KX5 A;  3WAA D;  2ARO A;  1TZY D;  3TU4 C;  4WU9 A;  1HQ3 C;  5B0Z A;  4XUJ C;  3LZ0 C;  4H9N A;  5AY8 A;  5BT1 C;  5AVC D;  1B6W A;  3WA9 A;  3AZJ D;  5B32 D;  4J8X D;  4Z5T A;  1JFI A;  3MGQ B;  3REH B;  3W97 D;  4HGA B;  5KDM A;  3C1C C;  5B2J C;  4J8U C;  3AN2 C;  5DNN C;  1N1J A;  1P3F B;  3AZL D;  3MGP D;  3UT9 A;  3W99 A;  3MGR B;  3B6F C;  4KUD A;  3O62 B;  1P3P B;  3X1S C;  1HQ3 D;  4XUJ D;  1TAF B;  3AZM B;  5C3I B;  2NQB D;  4H9R A;  3AZE C;  3UTB C;  5BT1 D;  5B1M B;  5AV5 C;  4KGC C;  4J8V D;  5B31 C;  5JRG A;  5B1L C;  3AYW D;  4J8W A;  3AZH A;  3AV2 B;  1F66 C;  1ZLA A;  2HIO A;  1P34 B;  4JJN B;  2FJ7 B;  2LY8 A;  3X1T C;  4Z5T C;  3W98 D;  5B0Y A;  1P3L A;  5B2J D;  5GXQ A;  3REK A;  3KXB D;  2CWE A;  3MVD A;  3KWQ B;  4NE5 A;  5BNV B;  5B24 B;  1P3O B;  4ZBJ C;  5B32 G;  3B6F D;  3UT9 C;  3A6N B;  5AVB A;  1P3K C;  1EQZ A;  4CSR A;  4YS3 A;  3TU4 B;  4XUJ B;  3B6G B;  3WTP D;  3REJ C;  1AOI D;  5CPJ B;  1P3G A;  5AV5 D;  3LZ0 B;  3NQJ A;  4KGC D;  3W96 A;  2NZD C;  5B31 D;  2HUE B;  5JRG C;  3AZH C;  1S32 A;  4WU8 A;  3X1T D;  2HIO C;  5DNM B;  5B40 C;  5AV6 A;  5CP6 B;  3LJA C;  4QLC C;  3MNN A;  3C1C B;  5B2J B;  3X1V A;  4J8U B;  4R8P D;  3REK C;  3AN2 B;  1P3M A;  5DNN B;  1P3A D;  3MVD C;  5JA4 A;  4YM6 A;  4DRA A;  3REI D;  1P3K D;  5CHL B;  3B6F B;  5BS7 C;  3REL D;  1M18 D;  5G49 A;  3X1U C;  3X1S B;  2YFV A;  3AZF C;  5FUG B;  1Q9C A;  3MGS A;  3B0C T;  5B32 A;  2BYK A;  5B0Z B;  2NZD D;  3AZE B;  3UTB B;  3AZM C;  4J8X A;  4Z66 A;  5B31 B;  5B1L B;  1F66 B;  2PYO A;  1KX3 C;  3WA9 B;  4KHA A;  1P3B C;  3AFA C;  1S32 C;  3VH5 W;  4WU8 C;  5F99 C;  3X1T B;  1F1E A;  4Z5T B;  4QLC D;  5AV6 C;  4JJN C;  3MGQ D;  3REH D;  3AZL A;  1JFI B;  4X23 C;  3AZI A;  4NFT A;  5B31 G;  3X1V C;  1KU5 A;  1P3M C;  1P3F D;  2CV5 A;  5B24 C;  3UT9 B;  3KUY A;  3AZK C;  3MGR D;  2NQB A;  1ID3 A;  3AZN A;  3AZG C;  1P3K B;  3AZF D;  3O62 D;  5B2I A;  1P3P D;  4LD9 A;  5AV9 A;  3AYW A;  5BO0 A;  3REJ B;  3AZM D;  5GT0 A;  3MGS C;  4WNN B;  3B6G C;  2NZD B;  5B1M D;  4CAY B;  5CPJ C;  4Z2M G;  1BH9 B;  4Z66 C;  2F8N B;  3W98 A;  3AV2 D;  1U35 A;  5JRG B;  4J8W B;  3AZH B;  3WKJ C;  2HIO B;  1B67 A;  2HUE C;  5B40 B;  4M6B A;  3LZ1 A;  4JJN D;  1P34 D;  1M19 A;  2FJ7 D;  3LJA B;  5DNM C;  4QLC B;  5CP6 C;  3B0C W;  1KX4 A;  4XZQ C;  3REK B;  3KWQ D;  3MVD B;  5B24 D;  4H9S A;  1P3O D;  2F8N K;  3AZG D;  5B33 C;  3UTA A;  3C1B A;  3WTP A;  2CV5 C;  1M1A C;  3A6N D;  3KUY C;  2RVQ C;  1ID3 C;  3X1U B;  4NE6 A;  3AZN C;  5CPK A;  5GT3 C;  1P3I A;  3AZF B;  1KX5 C;  4CSR B;  4YS3 B;  4LD9 C;  3TU4 D;  3B6G D;  2ARO C;  5CPJ D;  5GT0 C;  3LZ0 D;  3NQJ B;  5B0Z C;  2YFW B;  3AV1 A;  4WU9 C;  4H9Q A;  5AV8 A;  4DRB A;  1KX3 B;  3NQU A;  5AY8 C;  1U35 C;  1P3B B;  4WZS B;  3AFA B;  3LEL A;  4WU8 B;  5E5A A;  5DNM D;  5F99 B;  3V9R B;  1S32 B;  3LZ1 C;  5CP6 D;  5AV6 B;  1P3A A;  4H9P B;  3MNN B;  4X23 B;  1KX4 C;  3C1C D;  4J8U D;  3X1V B;  3AN2 D;  5DNN D;  1P3M B;  5JA4 B;  5B33 D;  1M1A D;  4YM6 B;  4H9S C;  3AZK B;  3AZG B;  5GT3 D;  3UTA C;  3W99 C;  5G49 B;  1KX5 D;  5GSU A;  3X1S D;  5CPK C;  2BYM A;  2YFV B;  5BNX B;  1P3I C;  3VH5 T;  1HTA A;  4KUD C;  3MGS B;  5CPI A;  5B0Z D;  3VH6 W;  3AZE D;  3UTB D;  4Z66 B;  3REH A;  3R45 A;  5B1L D;  1F66 D;  2PYO B;  4E44 A;  3WA9 D;  3WKJ B;  4J8W C;  4WV4 B;  1ZLA C;  3LEL C;  4Z5T D;  4UUZ B;  1P3F A;  2L5A A;  4ZUX A;  1ULY A;  4XZQ B;  3MGR A;  5B0Y C;  1P3L C;  5GXQ C;  3WAA A;  5B33 B;  3UT9 D;  2CV5 B;  1M1A B;  3KUY B;  1TZY A;  1BH8 A;  3AZN B;  1ID3 B;  5GT3 B;  5B1M A;  1KX5 B;  5AVB C;  4KUD D;  5GSU C;  5B2I B;  4LD9 B;  5AVC A;  3AV2 A;  5AV9 B;  1EQZ C;  5BO0 B;  2IO5 C;  4YS3 C;  3REJ D;  2ARO B;  5GT0 B;  3AZJ A;  1P34 A;  4WU9 B;  4G91 C;  3VH5 A;  1P3G C;  2F8N D;  4H9N B;  3W96 C;  3W97 A;  5AY8 B;  5JRG D;  1U35 B;  4J8W D;  3AZH D;  2HIO D;  5B40 D;  3KWQ A;  5BNV A;  3LZ1 B;  3LJA D;  1R4V A;  1KX4 B;  3MGP A;  1P3L D;  5GXQ D;  3MNN C;  1H3O A;  3REK D;  5KDM B;  3MVD D;  3WAA C;  1N1J B;  3TU4 A;  1HQ3 A;  4XUJ A;  4Z2M H;  4YM6 C;  3C1B B;  3UTA B;  3W99 B;  1TZY C;  3X1U D;  5AVB D;  3WTP E;  5CPK B;  1P3I B;  4YS3 D;  4J8V A;  4KUD B; 
#chains in the Genus database with same CATH topology
 3AZJ C;  5B32 C;  4H9R B;  3AV1 B;  4J8X C;  1KX3 D;  3W97 C;  3NQU B;  5B2J A;  1P3B D;  2PYO C;  3AFA D;  4EO5 C;  3AN2 A;  2JCH A;  5F99 D;  5DNN A;  5E5A B;  3KXB A;  3LEL B;  4WU8 D;  5AV6 D;  1ZLA B;  1WWS A;  3MNN D;  4X23 D;  2JSS A;  2Y2H A;  5B0Y B;  3AZL C;  3MGP C;  4H9O A;  1P3L B;  3B6F A;  3X1V D;  5GXQ B;  1P3M D;  3VH6 T;  3X1S A;  2F8N G;  3AZI C;  3A1I A;  5FUG A;  4YM6 D;  3AZK D;  3AZE A;  3UTB A;  1AOI A;  2XD5 A;  5AV5 A;  2NQB C;  4KGC A;  5AVB B;  5GSU B;  5B31 A;  4AWL C;  2BYM B;  5B1L A;  1F66 A;  1EQZ B;  2IO5 B;  5B2I C;  3MGS D;  4J8V C;  5CPI B;  5AV9 C;  3AYW C;  4G91 B;  3X1T A;  1P3G B;  3WA9 C;  4Z66 D;  3W96 B;  3R45 B;  2PYO D;  3A1K A;  1PZR A;  3W98 C;  3WKJ D;  3B0D C;  4R8P A;  3KXB C;  2DQN C;  1M19 C;  4G92 C;  4ZUX B;  4XZQ D;  3REI A;  1P3K A;  2Y2P A;  2VQR A;  3AZI D;  3REL A;  1M18 A;  3WAA B;  2CV5 D;  3REJ A;  3KUY D;  4WNN A;  2RVQ D;  3VH6 A;  1TZY B;  3AZN D;  1ID3 D;  1BH8 B;  2NZD A;  4CAY A;  3WTP C;  3C1B C;  1AOI C;  1BH9 A;  2F8N A;  5B2I D;  4LD9 D;  5AV9 D;  5AVC B;  2Y2O A;  2ARO D;  5GT0 D;  3AZJ B;  5B40 A;  5B32 B;  2BYK B;  4WU9 D;  3LJA A;  1T3U A;  2JE5 A;  4J8X B;  4QLC A;  3AV1 C;  3MGQ A;  5AY8 D;  3W97 B;  1U35 D;  2Y2L A;  5AV8 C;  4EO5 B;  1M19 D;  3LZ1 D;  4KHA B;  4R8P C;  5E5A C;  3B0B A;  1P3A C;  1W2E A;  1KX4 D;  3AZL B;  3MGP B;  5BS7 A;  3REI C;  3X1U A;  1H3O B;  3AZI B;  3AZF A;  3REL C;  1M18 C;  3O62 A;  1P3P A;  2W8S A;  1HQ3 B;  1TAF A;  3C1B D;  3UTA D;  3AZM A;  3W99 D;  3EPH A;  4E45 A;  2NQB B;  2YFW A;  5CPK D;  4AWL B;  1P3I D;  3EPK A;  1KX3 A;  4J8V B;  3AYW B;  1P3B A;  3AFA A;  1A7W A;  4NE3 A;  5F99 A;  3V9R A;  5CPI C;  4JJN A;  3AV1 D;  3KSY A;  2FJ7 A;  4H9P A;  5AV8 D;  4X23 A;  3MGQ C;  3REH C;  3W98 B;  3B0D B;  4HGA C;  1ZLA D;  3LEL D;  5E5A D;  3KXB B;  1M19 B;  4G92 B;  5B24 A;  3AZK A;  1P3O A;  3AZG A;  5B0Y D;  3EPL A;  1P3F C;  4ZUX C;  4H9O B;  3A6N A;  3MGR C;  1WWI A;  5BNX A;  3O62 C;  1P3P C;  3B6G A;  3WTP B;  5CPJ A;  5C3I C;  1AOI B;  3LZ0 A;  5AV5 B;  4KGC B;  5GSU D;  5B1M C;  1EQZ D;  3WKJ A;  1BFM A;  5CPI D;  5AVC C;  3AV2 C;  5DNM A;  1P3G D;  4UUZ A;  5CP6 A;  1P34 C;  3W96 D;  2FJ7 C;  4H9Q B;  5AV8 B;  4XZQ A;  2F8N H;  3C1C A;  4J8U A;  4R8P B;  4UPK A;  1P3A B;  3KWQ C;  4ZBJ B;  5B33 A;  4ZUX D;  1M1A A;  1P3O C;  3REI B;  3EPJ A;  5GT3 A;  3A6N C;  3REL B;  1M18 B;  1KX5 A;  2Y2J A;  3WAA D;  2ARO A;  2F2A C;  1TZY D;  3H0R C;  3TU4 C;  1HQ3 C;  5B0Z A;  4XUJ C;  4WU9 A;  3LZ0 C;  4H9N A;  5AY8 A;  2BG1 A;  5BT1 C;  5AVC D;  1B6W A;  3WA9 A;  3AZJ D;  5B32 D;  4J8X D;  4Z5T A;  1JFI A;  3MGQ B;  3REH B;  3W97 D;  4HGA B;  5KDM A;  3C1C C;  5B2J C;  4J8U C;  3AN2 C;  2RIQ A;  5DNN C;  1N1J A;  1P3F B;  3AZL D;  3MGP D;  2Y2Q A;  3UT9 A;  3W99 A;  3MGR B;  3B6F C;  4KUD A;  3O62 B;  1P3P B;  3X1S C;  1HQ3 D;  4XUJ D;  1TAF B;  3AZM B;  5C3I B;  2NQB D;  4H9R A;  3AZE C;  3UTB C;  5BT1 D;  5B1M B;  5AV5 C;  4KGC C;  4J8V D;  5B31 C;  5JRG A;  5B1L C;  3AYW D;  4J8W A;  3AZH A;  3AV2 B;  1F66 C;  1ZLA A;  2HIO A;  1P34 B;  4JJN B;  2FJ7 B;  2LY8 A;  1S32 D;  3X1T C;  4Z5T C;  3W98 D;  5B0Y A;  2J8P A;  1P3L A;  5B2J D;  5GXQ A;  1Z2C B;  3REK A;  3KXB D;  2CWE A;  3MVD A;  3KWQ B;  4NE5 A;  5BNV B;  5B24 B;  1P3O B;  4ZBJ C;  5B32 G;  3B6F D;  3UT9 C;  3A6N B;  5AVB A;  2XD1 A;  1P3K C;  1EQZ A;  4CSR A;  4YS3 A;  3TU4 B;  4XUJ B;  3B6G B;  2ZY2 A;  3WTP D;  3REJ C;  1AOI D;  5CPJ B;  1P3G A;  5AV5 D;  3LZ0 B;  3NQJ A;  4KGC D;  3W96 A;  2NZD C;  5B31 D;  2G5I C;  2HUE B;  5JRG C;  3AZH C;  1S32 A;  4WU8 A;  3X1T D;  2HIO C;  5DNM B;  5B40 C;  5AV6 A;  5CP6 B;  3LJA C;  4QLC C;  3MNN A;  3C1C B;  5B2J B;  3X1V A;  4J8U B;  4R8P D;  3REK C;  3AN2 B;  1P3M A;  5DNN B;  1P3A D;  3MVD C;  5JA4 A;  4YM6 A;  4DRA A;  3REI D;  3IP4 C;  5CHL B;  1P3K D;  3B6F B;  2Y2K A;  3H0L C;  5BS7 C;  3REL D;  1M18 D;  5G49 A;  3X1U C;  3X1S B;  2Y2M A;  2YFV A;  3AZF C;  5FUG B;  1Q9C A;  3MGS A;  3B0C T;  5B32 A;  2BYK A;  5B0Z B;  2NZD D;  3AZE B;  3UTB B;  3AZM C;  4J8X A;  4Z66 A;  5B31 B;  5B1L B;  1F66 B;  2PYO A;  1KX3 C;  4WJ3 C;  3WA9 B;  4KHA A;  1P3B C;  3AFA C;  1S32 C;  3VH5 W;  4WU8 C;  5F99 C;  3X1T B;  1F1E A;  4Z5T B;  4QLC D;  3AL0 C;  5AV6 C;  4JJN C;  3MGQ D;  3REH D;  2ZY3 A;  3AZL A;  1JFI B;  4X23 C;  3AZI A;  4NFT A;  5B31 G;  3X1V C;  1KU5 A;  2ZM5 A;  1P3M C;  1P3F D;  2CV5 A;  5B24 C;  3UT9 B;  3KUY A;  3FDD A;  3AZK C;  3MGR D;  2NQB A;  1ID3 A;  3AZN A;  3AZG C;  1P3K B;  3AZF D;  3O62 D;  5B2I A;  1P3P D;  4LD9 A;  5AV9 A;  3AYW A;  5BO0 A;  3REJ B;  2ZY4 A;  5GT0 A;  3MGS C;  3AZM D;  4WNN B;  3B6G C;  2NZD B;  5B1M D;  4CAY B;  5CPJ C;  4Z2M G;  1BH9 B;  4Z66 C;  3F6T A;  2F8N B;  3W98 A;  3H0M C;  3AV2 D;  1U35 A;  5JRG B;  4J8W B;  3AZH B;  3WKJ C;  2HIO B;  1B67 A;  2HUE C;  5B40 B;  4M6B A;  3LZ1 A;  4JJN D;  1P34 D;  1M19 A;  2FJ7 D;  3LJA B;  5DNM C;  4QLC B;  5CP6 C;  3B0C W;  1KX4 A;  4XZQ C;  3REK B;  3KWQ D;  3MVD B;  5B24 D;  4H9S A;  1P3O D;  2F8N K;  3AZG D;  5B33 C;  3UTA A;  3C1B A;  3WTP A;  2CV5 C;  1M1A C;  3A6N D;  3KUY C;  2RVQ C;  1ID3 C;  3X1U B;  4NE6 A;  3AZN C;  5CPK A;  5GT3 C;  1P3I A;  3AZF B;  1KX5 C;  4CSR B;  4YS3 B;  4LD9 C;  3TU4 D;  3B6G D;  2Y2I A;  2ARO C;  5CPJ D;  5GT0 C;  3LZ0 D;  3NQJ B;  5B0Z C;  2YFW B;  3AV1 A;  4WU9 C;  4H9Q A;  5AV8 A;  4DRB A;  2UWX A;  1KX3 B;  3NQU A;  5AY8 C;  1U35 C;  1P3B B;  4WZS B;  3AFA B;  3LEL A;  4WU8 B;  5E5A A;  5DNM D;  5F99 B;  3V9R B;  1S32 B;  3LZ1 C;  5CP6 D;  5AV6 B;  1P3A A;  4H9P B;  3MNN B;  4X23 B;  1KX4 C;  3C1C D;  4J8U D;  3X1V B;  2FFF B;  3AN2 D;  5DNN D;  1P3M B;  3KFU G;  5JA4 B;  5B33 D;  1M1A D;  4YM6 B;  4H9S C;  3AZK B;  2ZY5 A;  3AZG B;  5GT3 D;  3UTA C;  3W99 C;  5G49 B;  1KX5 D;  5GSU A;  3X1S D;  5CPK C;  2BYM A;  2YFV B;  5BNX B;  1P3I C;  3VH5 T;  2G5H C;  1HTA A;  4KUD C;  3MGS B;  5CPI A;  5B0Z D;  3VH6 W;  3AZE D;  3P5J B;  3UTB D;  4Z66 B;  3REH A;  2DF4 C;  3R45 A;  5B1L D;  1F66 D;  2PYO B;  4E44 A;  3WA9 D;  3WKJ B;  3EG5 B;  4J8W C;  4WV4 B;  1ZLA C;  3LEL C;  4Z5T D;  4UUZ B;  1P3F A;  2L5A A;  4ZUX A;  1ULY A;  4XZQ B;  3MGR A;  5B0Y C;  1P3L C;  5GXQ C;  3WAA A;  5B33 B;  3UT9 D;  2CV5 B;  1M1A B;  3KUY B;  1TZY A;  1BH8 A;  3AZN B;  1ID3 B;  5GT3 B;  5B1M A;  1KX5 B;  5AVB C;  4KUD D;  5GSU C;  5B2I B;  4LD9 B;  5AVC A;  3AV2 A;  5AV9 B;  1EQZ C;  5BO0 B;  2IO5 C;  4YS3 C;  3REJ D;  2ARO B;  5GT0 B;  3AZJ A;  1P34 A;  4WU9 B;  4G91 C;  3VH5 A;  2Y2N A;  1P3G C;  2F8N D;  4H9N B;  3W96 C;  3W97 A;  5AY8 B;  5JRG D;  1U35 B;  4J8W D;  3AZH D;  2HIO D;  5B40 D;  3KWQ A;  5BNV A;  3LZ1 B;  3LJA D;  1R4V A;  1KX4 B;  3MGP A;  1P3L D;  2Y2G A;  5GXQ D;  3MNN C;  1H3O A;  3REK D;  5KDM B;  3MVD D;  3WAA C;  1N1J B;  3TU4 A;  1HQ3 A;  4XUJ A;  4Z2M H;  4YM6 C;  3C1B B;  3UTA B;  3W99 B;  1TZY C;  3X1U D;  5AVB D;  3WTP E;  5CPK B;  1P3I B;  4DQY B;  4YS3 D;  4J8V A;  4KUD B; 
#chains in the Genus database with same CATH homology
 3AZJ C;  5B32 C;  4H9R B;  3AV1 B;  4J8X C;  1KX3 D;  3W97 C;  3NQU B;  5B2J A;  1P3B D;  2PYO C;  3AFA D;  4EO5 C;  3AN2 A;  2JCH A;  5F99 D;  5DNN A;  5E5A B;  3KXB A;  3LEL B;  4WU8 D;  5AV6 D;  1ZLA B;  1WWS A;  3MNN D;  4X23 D;  2JSS A;  2Y2H A;  5B0Y B;  3AZL C;  3MGP C;  4H9O A;  1P3L B;  3B6F A;  3X1V D;  5GXQ B;  1P3M D;  3VH6 T;  3X1S A;  2F8N G;  3AZI C;  3A1I A;  5FUG A;  4YM6 D;  3AZK D;  3AZE A;  3UTB A;  1AOI A;  2XD5 A;  5AV5 A;  2NQB C;  4KGC A;  5AVB B;  5GSU B;  5B31 A;  4AWL C;  2BYM B;  5B1L A;  1F66 A;  1EQZ B;  2IO5 B;  5B2I C;  3MGS D;  4J8V C;  5CPI B;  5AV9 C;  3AYW C;  4G91 B;  3X1T A;  1P3G B;  3WA9 C;  4Z66 D;  3W96 B;  3R45 B;  2PYO D;  3A1K A;  1PZR A;  3W98 C;  3WKJ D;  3B0D C;  4R8P A;  3KXB C;  2DQN C;  1M19 C;  4G92 C;  4ZUX B;  4XZQ D;  3REI A;  1P3K A;  2Y2P A;  2VQR A;  3AZI D;  3REL A;  1M18 A;  3WAA B;  2CV5 D;  3REJ A;  3KUY D;  4WNN A;  2RVQ D;  3VH6 A;  1TZY B;  3AZN D;  1ID3 D;  1BH8 B;  2NZD A;  4CAY A;  3WTP C;  3C1B C;  1AOI C;  1BH9 A;  2F8N A;  5B2I D;  4LD9 D;  5AV9 D;  5AVC B;  2Y2O A;  2ARO D;  5GT0 D;  3AZJ B;  5B40 A;  5B32 B;  2BYK B;  4WU9 D;  3LJA A;  1T3U A;  2JE5 A;  4J8X B;  4QLC A;  3AV1 C;  3MGQ A;  5AY8 D;  3W97 B;  1U35 D;  2Y2L A;  5AV8 C;  4EO5 B;  1M19 D;  3LZ1 D;  4KHA B;  4R8P C;  5E5A C;  3B0B A;  1P3A C;  1W2E A;  1KX4 D;  3AZL B;  3MGP B;  5BS7 A;  3REI C;  3X1U A;  1H3O B;  3AZI B;  3AZF A;  3REL C;  1M18 C;  3O62 A;  1P3P A;  2W8S A;  1HQ3 B;  1TAF A;  3C1B D;  3UTA D;  3AZM A;  3W99 D;  3EPH A;  4E45 A;  2NQB B;  2YFW A;  5CPK D;  4AWL B;  1P3I D;  3EPK A;  1KX3 A;  4J8V B;  3AYW B;  1P3B A;  3AFA A;  1A7W A;  4NE3 A;  5F99 A;  3V9R A;  5CPI C;  4JJN A;  3AV1 D;  3KSY A;  2FJ7 A;  4H9P A;  5AV8 D;  4X23 A;  3MGQ C;  3REH C;  3W98 B;  3B0D B;  4HGA C;  1ZLA D;  3LEL D;  5E5A D;  3KXB B;  1M19 B;  4G92 B;  5B24 A;  3AZK A;  1P3O A;  3AZG A;  5B0Y D;  3EPL A;  1P3F C;  4ZUX C;  4H9O B;  3A6N A;  3MGR C;  1WWI A;  5BNX A;  3O62 C;  1P3P C;  3B6G A;  3WTP B;  5CPJ A;  5C3I C;  1AOI B;  3LZ0 A;  5AV5 B;  4KGC B;  5GSU D;  5B1M C;  1EQZ D;  3WKJ A;  1BFM A;  5CPI D;  5AVC C;  3AV2 C;  5DNM A;  1P3G D;  4UUZ A;  5CP6 A;  1P34 C;  3W96 D;  2FJ7 C;  4H9Q B;  5AV8 B;  4XZQ A;  2F8N H;  3C1C A;  4J8U A;  4R8P B;  4UPK A;  1P3A B;  3KWQ C;  4ZBJ B;  5B33 A;  4ZUX D;  1M1A A;  1P3O C;  3REI B;  3EPJ A;  5GT3 A;  3A6N C;  3REL B;  1M18 B;  1KX5 A;  2Y2J A;  3WAA D;  2ARO A;  2F2A C;  1TZY D;  3H0R C;  3TU4 C;  1HQ3 C;  5B0Z A;  4XUJ C;  4WU9 A;  3LZ0 C;  4H9N A;  5AY8 A;  2BG1 A;  5BT1 C;  5AVC D;  1B6W A;  3WA9 A;  3AZJ D;  5B32 D;  4J8X D;  4Z5T A;  1JFI A;  3MGQ B;  3REH B;  3W97 D;  4HGA B;  5KDM A;  3C1C C;  5B2J C;  4J8U C;  3AN2 C;  2RIQ A;  5DNN C;  1N1J A;  1P3F B;  3AZL D;  3MGP D;  2Y2Q A;  3UT9 A;  3W99 A;  3MGR B;  3B6F C;  4KUD A;  3O62 B;  1P3P B;  3X1S C;  1HQ3 D;  4XUJ D;  1TAF B;  3AZM B;  5C3I B;  2NQB D;  4H9R A;  3AZE C;  3UTB C;  5BT1 D;  5B1M B;  5AV5 C;  4KGC C;  4J8V D;  5B31 C;  5JRG A;  5B1L C;  3AYW D;  4J8W A;  3AZH A;  3AV2 B;  1F66 C;  1ZLA A;  2HIO A;  1P34 B;  4JJN B;  2FJ7 B;  2LY8 A;  1S32 D;  3X1T C;  4Z5T C;  3W98 D;  5B0Y A;  2J8P A;  1P3L A;  5B2J D;  5GXQ A;  1Z2C B;  3REK A;  3KXB D;  2CWE A;  3MVD A;  3KWQ B;  4NE5 A;  5BNV B;  5B24 B;  1P3O B;  4ZBJ C;  5B32 G;  3B6F D;  3UT9 C;  3A6N B;  5AVB A;  2XD1 A;  1P3K C;  1EQZ A;  4CSR A;  4YS3 A;  3TU4 B;  4XUJ B;  3B6G B;  2ZY2 A;  3WTP D;  3REJ C;  1AOI D;  5CPJ B;  1P3G A;  5AV5 D;  3LZ0 B;  3NQJ A;  4KGC D;  3W96 A;  2NZD C;  5B31 D;  2G5I C;  2HUE B;  5JRG C;  3AZH C;  1S32 A;  4WU8 A;  3X1T D;  2HIO C;  5DNM B;  5B40 C;  5AV6 A;  5CP6 B;  3LJA C;  4QLC C;  3MNN A;  3C1C B;  5B2J B;  3X1V A;  4J8U B;  4R8P D;  3REK C;  3AN2 B;  1P3M A;  5DNN B;  1P3A D;  3MVD C;  5JA4 A;  4YM6 A;  4DRA A;  3REI D;  3IP4 C;  5CHL B;  1P3K D;  3B6F B;  2Y2K A;  3H0L C;  5BS7 C;  3REL D;  1M18 D;  5G49 A;  3X1U C;  3X1S B;  2Y2M A;  2YFV A;  3AZF C;  5FUG B;  1Q9C A;  3MGS A;  3B0C T;  5B32 A;  2BYK A;  5B0Z B;  2NZD D;  3AZE B;  3UTB B;  3AZM C;  4J8X A;  4Z66 A;  5B31 B;  5B1L B;  1F66 B;  2PYO A;  1KX3 C;  4WJ3 C;  3WA9 B;  4KHA A;  1P3B C;  3AFA C;  1S32 C;  3VH5 W;  4WU8 C;  5F99 C;  3X1T B;  1F1E A;  4Z5T B;  4QLC D;  3AL0 C;  5AV6 C;  4JJN C;  3MGQ D;  3REH D;  2ZY3 A;  3AZL A;  1JFI B;  4X23 C;  3AZI A;  4NFT A;  5B31 G;  3X1V C;  1KU5 A;  2ZM5 A;  1P3M C;  1P3F D;  2CV5 A;  5B24 C;  3UT9 B;  3KUY A;  3FDD A;  3AZK C;  3MGR D;  2NQB A;  1ID3 A;  3AZN A;  3AZG C;  1P3K B;  3AZF D;  3O62 D;  5B2I A;  1P3P D;  4LD9 A;  5AV9 A;  3AYW A;  5BO0 A;  3REJ B;  2ZY4 A;  5GT0 A;  3MGS C;  3AZM D;  4WNN B;  3B6G C;  2NZD B;  5B1M D;  4CAY B;  5CPJ C;  4Z2M G;  1BH9 B;  4Z66 C;  3F6T A;  2F8N B;  3W98 A;  3H0M C;  3AV2 D;  1U35 A;  5JRG B;  4J8W B;  3AZH B;  3WKJ C;  2HIO B;  1B67 A;  2HUE C;  5B40 B;  4M6B A;  3LZ1 A;  4JJN D;  1P34 D;  1M19 A;  2FJ7 D;  3LJA B;  5DNM C;  4QLC B;  5CP6 C;  3B0C W;  1KX4 A;  4XZQ C;  3REK B;  3KWQ D;  3MVD B;  5B24 D;  4H9S A;  1P3O D;  2F8N K;  3AZG D;  5B33 C;  3UTA A;  3C1B A;  3WTP A;  2CV5 C;  1M1A C;  3A6N D;  3KUY C;  2RVQ C;  1ID3 C;  3X1U B;  4NE6 A;  3AZN C;  5CPK A;  5GT3 C;  1P3I A;  3AZF B;  1KX5 C;  4CSR B;  4YS3 B;  4LD9 C;  3TU4 D;  3B6G D;  2Y2I A;  2ARO C;  5CPJ D;  5GT0 C;  3LZ0 D;  3NQJ B;  5B0Z C;  2YFW B;  3AV1 A;  4WU9 C;  4H9Q A;  5AV8 A;  4DRB A;  2UWX A;  1KX3 B;  3NQU A;  5AY8 C;  1U35 C;  1P3B B;  4WZS B;  3AFA B;  3LEL A;  4WU8 B;  5E5A A;  5DNM D;  5F99 B;  3V9R B;  1S32 B;  3LZ1 C;  5CP6 D;  5AV6 B;  1P3A A;  4H9P B;  3MNN B;  4X23 B;  1KX4 C;  3C1C D;  4J8U D;  3X1V B;  2FFF B;  3AN2 D;  5DNN D;  1P3M B;  3KFU G;  5JA4 B;  5B33 D;  1M1A D;  4YM6 B;  4H9S C;  3AZK B;  2ZY5 A;  3AZG B;  5GT3 D;  3UTA C;  3W99 C;  5G49 B;  1KX5 D;  5GSU A;  3X1S D;  5CPK C;  2BYM A;  2YFV B;  5BNX B;  1P3I C;  3VH5 T;  2G5H C;  1HTA A;  4KUD C;  3MGS B;  5CPI A;  5B0Z D;  3VH6 W;  3AZE D;  3P5J B;  3UTB D;  4Z66 B;  3REH A;  2DF4 C;  3R45 A;  5B1L D;  1F66 D;  2PYO B;  4E44 A;  3WA9 D;  3WKJ B;  3EG5 B;  4J8W C;  4WV4 B;  1ZLA C;  3LEL C;  4Z5T D;  4UUZ B;  1P3F A;  2L5A A;  4ZUX A;  1ULY A;  4XZQ B;  3MGR A;  5B0Y C;  1P3L C;  5GXQ C;  3WAA A;  5B33 B;  3UT9 D;  2CV5 B;  1M1A B;  3KUY B;  1TZY A;  1BH8 A;  3AZN B;  1ID3 B;  5GT3 B;  5B1M A;  1KX5 B;  5AVB C;  4KUD D;  5GSU C;  5B2I B;  4LD9 B;  5AVC A;  3AV2 A;  5AV9 B;  1EQZ C;  5BO0 B;  2IO5 C;  4YS3 C;  3REJ D;  2ARO B;  5GT0 B;  3AZJ A;  1P34 A;  4WU9 B;  4G91 C;  3VH5 A;  2Y2N A;  1P3G C;  2F8N D;  4H9N B;  3W96 C;  3W97 A;  5AY8 B;  5JRG D;  1U35 B;  4J8W D;  3AZH D;  2HIO D;  5B40 D;  3KWQ A;  5BNV A;  3LZ1 B;  3LJA D;  1R4V A;  1KX4 B;  3MGP A;  1P3L D;  2Y2G A;  5GXQ D;  3MNN C;  1H3O A;  3REK D;  5KDM B;  3MVD D;  3WAA C;  1N1J B;  3TU4 A;  1HQ3 A;  4XUJ A;  4Z2M H;  4YM6 C;  3C1B B;  3UTA B;  3W99 B;  1TZY C;  3X1U D;  5AVB D;  3WTP E;  5CPK B;  1P3I B;  4DQY B;  4YS3 D;  4J8V A;  4KUD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...