4J8XD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xD00
1P3AB 3B6GA 1S32C 5B1MC 4Z2MG 3KXBB 1P3FC 5GT3A 4JJNA 5AV6A 3TU4B 3W97B 2NQBB 3NQUB 5AV5A 1M19A 3O62D 3AZEB 1TAFB 3X1UD 5GT0D 3VH6W 3O62C 4R8PD 4WU9B 5CPJA 2AROD 3B6FB 3RELD 3X1UC 5GT0C 5AVCB 5B1LB 4R8PC 5B33D 2AROC 1P3BD 4CAYB 4WV4B 5KDMA 5B0ZB 3X1SB 3RELC 3AZKA 3W98B 4X23B 5DNMD 1P3KB 3AZLD 5B33C 1P3BC 4AWLC 1P3GA 3AV2A 5DNMC 3WTPA 3KWQB 3AZLC 3B0DC 5B24C 4EO5C 4CSRB 3A6ND 5E5AB 3B6GB 1S32A 1HQ3D 5B1MA 4XUJB 3A6NC 1P3FA 4NE6A 5AV8D 1HQ3C 4JJNB 4H9SC 1F66D 2F8NH 5AV8C 1ID3B 4ZBJC 5AV5B 4H9OA 2BYKA 5B32G 1M19B 3MNND 1A7WA 1F66C 1AOID 1BFMA 4J8VD 3O62A 3MNNC 5CPJB 3W99A 1AOIC 5B40B 5B32D 3B6FD 3X1UA 5GT0A 5BNXB 4J8VC 3AZNB 2AROA 5B1LD 5B32C 3AZKB 3RELA 5B2IB 4G91C 4YM6B 4X23D 4E44A 5B33A 5DNND 3X1TD 1P3KD 5B1LC 5C3IC 1P3GB 2HIOD 3AV2B 3WTPB 4DRAA 2RVQD 3AZLA 5B24A 4X23C 3X1TC 5DNNC 1EQZB 2HIOC 2RVQC 1KU5A 1S32B 5E5AD 5JA4B 5B1MB 3UTAB 3AZFB 1WWIA 1P3FB 4XUJD 1HQ3A 5E5AC 4H9SA 4LD9D 1M1AB 4XUJC 5AV8A 4H9OB 2F8NK 1B6WA 1ID3D 5AV5D 3WTPE 1F66A 4LD9C 5B2JD 3VH5W 1ID3C 2F8NG 5AV5C 3O62B 3MNNA 1AOIA 5B2JC 3X1UB 2HUEC 3WAAB 5GT0B 5B40D 4J8VA 5B32A 3RELB 3AZND 2F8ND 5B40C 1Q9CA 1KX3C 5B2ID 4YM6D 5B1LA 1P34C 1F1EA 4AWLB 3C1BB 3AZNC 4H9QA 3AZLB 3B0DB 5B24B 4X23A 3VH5A 5B2IC 5DNNA 4H9PA 4ZUXD 4WZSB 4YM6C 3X1TA 3AZHD 2HIOA 1EQZD 3WKJD 3AYWC 4ZUXC 3AZHC 1S32D 2YFVB 3UTAD 3AZFD 1P3PD 1EQZC 3WKJC 4Z66B 1HQ3B 5E5AA 5F99B 1P3MB 5AV8B 3UTAC 4XUJA 3MGPC 4J8WD 4ZBJB 3AZFC 1P3PC 1KX4B 1M1AD 1F66B 4LD9A 4KGCD 4J8WC 1M1AC 4UUZB 1ID3A 3MNNB 1AOIB 1BH9A 4KGCC 5B31B 5B2JA 4J8VB 3WAAD 3V9RA 5B32B 5B40A 1KX3A 4G91B 3AFAD 3WAAC 5BT1D 5B0YB 5CHLB 5BNXA 3MGRB 5C3IB 1P34A 2F8NA 3AZNA 4H9QB 3AFAC 3C1BD 5BT1C 3X1TB 1TZYB 4H9PB 5DNNB 5B2IA 5B24D 4YM6A 2HIOB 3C1BC 1P3OD 3AYWA 4ZUXA 4KUDD 3AZHA 3MGQD 2JSSA 3LELD 3VH6T 1EQZA 1P3OC 3LZ0D 5AVBD 3WKJA 4KUDC 3AV1D 4H9NA 4Z66D 5JRGD 3MGQC 5JA4A 5F99D 3UTAA 3LELC 3MGPA 3AZFA 1P3MD 1P3PA 3LZ0C 5AVBC 3MVDB 3AV1C 1KX4D 4Z66C 5JRGC 5B31G 4LD9B 5F99C 4J8WA 1P3MC 4HGAB 1M1AA 3REHD 1KX4C 3NQJA 1BH9B 4KGCA 5B2JB 2HUEB 3AZGA 5B31D 3REHC 1P3IA 3V9RB 1KX3B 5B31C 3MGSC 3WAAA 3AZID 1P34B 5B0YD 2F8NB 3MGRD 5G49B 3AFAA 3AZIC 5GXQD 5AV9B 3R45A 4NFTA 1N1JA 1TZYD 2LY8A 5B0YC 3MGRC 3LJAC 3C1BA 5BNVA 4J8UB 5GXQC 4ZUXB 3AYWB 3AZHB 1TZYC 3WKJB 5BS7C 5BO0A 3UTBC 1P3OA 3REJB 4H9NB 1KX5B 4KUDA 3MGQA 1P3PB 3MGPB 3LELA 3LZ0A 5AVBA 2YFVA 4WNNA 3C1CB 3AV1A 4Z66A 5JRGA 3MVDD 5F99A 4J8WB 4G92C 1P3MA 3REIA 3NQJB 1KX4A 3MVDC 4KGCB 3AZGB 3REHA 1P3IB 4HGAC 4UUZA 3AZMA 2BYMA 1M18D 5B31A 3MGSA 4Z2MH 1KX3D 4Z5TA 4XZQA 1M18C 5GSUD 3AFAB 1P34D 3AZIA 3R45B 1N1JB 5B0YA 3MGRA 5AV9D 3LJAA 5GSUC 5BNVB 5GXQA 5AY8B 3AN2B 4J8UD 1TZYA 3AYWD 3VH5T 5AV9C 5BO0B 5BS7A 1P3OB 3UTBA 3KUYA 2FJ7D 4KUDB 5CPKD 4J8UC 3MGQB 3REJD 4H9RA 3X1VD 3WA9D 5FUGA 3LELB 1KX5D 3LZ0B 5AVBB 1U35D 3MGPD 4WNNB 2FJ7C 3AZJB 3AV1B 5CPKC 3X1VC 3REJC 5JRGB 3WA9C 3C1CD 1KX5C 3REIB 1U35C 4YS3B 4NE5A 1H3OA 3MVDA 4KHAB 3C1CC 3LZ1D 2L5AA 3REHB 3AZGD 1ZLAB 3AZMB 1P3ID 3LZ1C 2BYMB 3B0BA 3MGSB 4DRBA 3AZGC 3W96B 1P3IC 4Z5TB 4XZQB 3UT9D 1M18A 3AZIB 4WU8D 5CP6D 3UT9C 3LJAB 1P3LA 5GSUA 3B0CW 4WU8C 5GXQB 5G49A 5CP6C 2PYOD 4QLCB 5AY8D 3AN2D 5AV9A 3UTBB 3KUYB 2PYOC 3REKB 4J8UA 4H9RB 5AY8C 3AN2C 5FUGB 2FJ7A 5CPKA 3X1VA 3REJA 4M6BA 3WA9A 3AZJD 4G92B 1KX5A 4J8XB 1U35A 2NZDA 1H3OB 3REID 4YS3D 3AZJC 3B0CT 3C1CA 5CPIB 3REIC 2IO5B 4YS3C 3LZ1A 1ZLAD 3AZMD 1WWSA 3MGSD 2CV5D 1ZLAC 3VH6A 3AZMC 3W96D 1M18B 3W99B 4Z5TD 4XZQD 1JFIA 2CV5C 1P3AD 3W96C 3UT9A 1P3LB 5GSUB 4Z5TC 4XZQC 4WU8A 3LJAD 5CP6A 3KXBD 1P3AC 5GT3B 2YFWA 4QLCD 5AV6B 3TU4D 3W97D 3KXBC 2PYOA 1R4VA 1ULYA 3UTBD 2NQBD 3KUYD 5AY8A 3AN2A 4QLCC 3REKD 3TU4C 3AZED 3W97C 2FJ7B 1BH8A 5CPKB 2NQBC 3X1VB 3KUYC 3WA9B 3REKC 4WU9D 3AZEC 1U35B 2NZDB 4J8XD 4R8PA 3AZJA 5AVCD 5KDMB 4WU9C 3B6FC 5CPID 5B0ZD 3X1SD 4J8XC 3W98D 4YS3A 5AVCC 1P3BA 3LZ1B 4KHAA 5CPIC 5DNMA 5B0ZC 3X1SC 3W98C 3KWQD 1P3KC 2IO5C 1ZLAA 1JFIB 3W99D 2CV5A 3KWQC 3B6GD 3UT9B 3W96A 3A6NA 4WU8B 1P3LD 1B67A 3W99C 5CP6B 1P3AA 3B6GC 2YFWB 5GT3D 4JJND 5AV6D 1P3LC 3KSYA 4NE3A 2BYKB 3KXBA 2PYOB 4QLCA 5GT3C 1M19D 4JJNC 5AV6C 3TU4A 3W97A 1BH8B 2NQBA 3NQUA 3REKA 1M19C 5CPJD 3AZEA 1TAFA 4R8PB 2NZDD 2AROB 5CPJC 4WU9A 3B6FA 1HTAA 3AZKD 4J8XA 5B33B 2NZDC 1P3BB 5AVCA 4E45A 4CAYA 2CWEA 5DNMB 5CPIA 3X1SA 5B0ZA 3AZKC 1P3GD 3W98A 3AV2D 4EO5B 3WTPD 1P3KA 1P3GC 3AV2C 3WTPC 2CV5B 3KWQA 4CSRA 3A6NB 5B1MD 1P3FD
chains in the Genus database with same CATH superfamily
1P3AB 3B6GA 1S32C 5B1MC 4Z2MG 3KXBB 1P3FC 2Y2NA 5GT3A 4JJNA 5AV6A 3TU4B 3W97B 1T3UA 2G5IC 2NQBB 3NQUB 5AV5A 1M19A 3O62D 3AZEB 1TAFB 3X1UD 5GT0D 3VH6W 3O62C 4R8PD 4WU9B 5CPJA 2AROD 3B6FB 3RELD 3X1UC 4WJ3C 5GT0C 5AVCB 5B1LB 4R8PC 5B33D 2AROC 1P3BD 4CAYB 4WV4B 5KDMA 5B0ZB 3X1SB 3RELC 3AZKA 3W98B 4X23B 5DNMD 1P3KB 3AZLD 5B33C 1P3BC 4AWLC 1P3GA 3AV2A 5DNMC 3WTPA 3KWQB 3AZLC 3B0DC 5B24C 4EO5C 4CSRB 3A6ND 5E5AB 3B6GB 1S32A 1HQ3D 5B1MA 4XUJB 3A6NC 1P3FA 3H0MC 4NE6A 5AV8D 2BG1A 1HQ3C 4JJNB 4H9SC 1F66D 2F8NH 5AV8C 1ID3B 4ZBJC 5AV5B 4H9OA 2BYKA 5B32G 1M19B 3MNND 1A7WA 1F66C 1AOID 1BFMA 4J8VD 3O62A 3MNNC 5CPJB 3W99A 1AOIC 5B40B 5B32D 3B6FD 3X1UA 5GT0A 5BNXB 4J8VC 3AZNB 2AROA 5B1LD 5B32C 3AZKB 3RELA 5B2IB 4G91C 4YM6B 4X23D 4E44A 5B33A 5DNND 3X1TD 1P3KD 5B1LC 5C3IC 1P3GB 2HIOD 3AV2B 3WTPB 4DRAA 2RVQD 3AZLA 5B24A 4X23C 3X1TC 5DNNC 1EQZB 2HIOC 2RVQC 1KU5A 1S32B 2ZY5A 5E5AD 5JA4B 5B1MB 3UTAB 3AZFB 1WWIA 1P3FB 4XUJD 1HQ3A 5E5AC 4H9SA 4LD9D 1M1AB 4XUJC 5AV8A 4H9OB 2F8NK 1B6WA 2Y2LA 1ID3D 5AV5D 3WTPE 3P5JB 1F66A 4LD9C 5B2JD 3VH5W 1ID3C 2F8NG 5AV5C 3EPJA 3O62B 3MNNA 1AOIA 2XD1A 5B2JC 3X1UB 2HUEC 3WAAB 5GT0B 5B40D 4J8VA 5B32A 3RELB 3AZND 2F8ND 5B40C 1Q9CA 1KX3C 2Y2HA 5B2ID 4YM6D 5B1LA 1P34C 1F1EA 4AWLB 3C1BB 3AZNC 4H9QA 3AZLB 3B0DB 5B24B 4X23A 3VH5A 3A1KA 5DNNA 4H9PA 5B2IC 4ZUXD 4YM6C 4WZSB 3X1TA 3AZHD 2HIOA 2Y2IA 1EQZD 3WKJD 3AYWC 4ZUXC 2Y2GA 3AZHC 1S32D 2ZY3A 2YFVB 3UTAD 3AZFD 1P3PD 1EQZC 3WKJC 4Z66B 1HQ3B 5E5AA 5F99B 2RIQA 1P3MB 5AV8B 3UTAC 4XUJA 3MGPC 4J8WD 4ZBJB 3AZFC 1P3PC 1KX4B 1M1AD 2G5HC 2ZY4A 1F66B 4LD9A 2Y2OA 4KGCD 4J8WC 1M1AC 4UUZB 1ID3A 3EPHA 3H0LC 3MNNB 1AOIB 1BH9A 4KGCC 5B31B 5B2JA 4J8VB 3WAAD 3V9RA 5B32B 3F6TA 5B40A 1KX3A 4G91B 3AFAD 3WAAC 5BT1D 5B0YB 5CHLB 5BNXA 3MGRB 5C3IB 1P34A 2F8NA 3AZNA 4H9QB 3AFAC 3C1BD 5BT1C 3X1TB 1TZYB 4H9PB 5DNNB 5B2IA 5B24D 4YM6A 2HIOB 2Y2KA 3C1BC 1P3OD 3AYWA 4ZUXA 4KUDD 3AZHA 3MGQD 2JSSA 3LELD 3VH6T 1EQZA 1P3OC 3LZ0D 5AVBD 3WKJA 4KUDC 3AV1D 4H9NA 4Z66D 5JRGD 3MGQC 5JA4A 5F99D 3UTAA 3LELC 3MGPA 3AZFA 1P3MD 1P3PA 3LZ0C 5AVBC 3MVDB 3AV1C 1KX4D 4Z66C 5JRGC 5B31G 4LD9B 5F99C 4J8WA 1P3MC 4HGAB 1M1AA 3REHD 1KX4C 3NQJA 1BH9B 4KGCA 5B2JB 2HUEB 3AZGA 5B31D 3REHC 1P3IA 3V9RB 1KX3B 5B31C 3MGSC 3WAAA 3AZID 2Y2PA 1P34B 5B0YD 2F8NB 3MGRD 5G49B 3AFAA 3AZIC 5GXQD 5AV9B 3R45A 4NFTA 1N1JA 1TZYD 2LY8A 5B0YC 3MGRC 3LJAC 2ZY2A 3C1BA 5BNVA 4J8UB 5GXQC 4ZUXB 3AYWB 3AZHB 2Y2JA 1TZYC 3WKJB 5BS7C 5BO0A 3UTBC 1P3OA 3REJB 4H9NB 2Y2MA 1KX5B 4KUDA 3MGQA 1Z2CB 1P3PB 3MGPB 3LELA 3LZ0A 5AVBA 2YFVA 4WNNA 3C1CB 3AV1A 4Z66A 5JRGA 3MVDD 5F99A 4J8WB 4G92C 3H0RC 1P3MA 3REIA 3NQJB 3A1IA 1KX4A 3MVDC 4KGCB 3AZGB 2XD5A 3REHA 1P3IB 4HGAC 4UUZA 3AZMA 2BYMA 1M18D 5B31A 3MGSA 4Z2MH 1KX3D 4Z5TA 4XZQA 1M18C 5GSUD 3AFAB 1P34D 3AZIA 3R45B 1N1JB 5B0YA 3MGRA 5AV9D 3LJAA 5GSUC 5BNVB 2J8PA 3FDDA 5AY8B 5GXQA 3AN2B 4J8UD 1TZYA 3AYWD 3VH5T 5AV9C 5BO0B 5BS7A 1P3OB 3UTBA 3KUYA 2FJ7D 4KUDB 5CPKD 2JE5A 3MGQB 4J8UC 4H9RA 3REJD 3X1VD 3WA9D 5FUGA 3LELB 1KX5D 3LZ0B 5AVBB 1U35D 3MGPD 4WNNB 2FJ7C 3AL0C 3AZJB 3AV1B 5CPKC 3X1VC 3REJC 5JRGB 3WA9C 3C1CD 1KX5C 3REIB 1U35C 4YS3B 4NE5A 1H3OA 3MVDA 4KHAB 3C1CC 3LZ1D 2L5AA 3REHB 3AZGD 1ZLAB 3AZMB 1P3ID 3LZ1C 2BYMB 2W8SA 3B0BA 3MGSB 4DRBA 3AZGC 3W96B 1P3IC 4Z5TB 4XZQB 3UT9D 1M18A 3AZIB 4WU8D 5CP6D 2VQRA 1PZRA 3UT9C 3LJAB 1P3LA 5GSUA 3B0CW 4WU8C 5GXQB 5G49A 5CP6C 2PYOD 4QLCB 2DF4C 5AY8D 3AN2D 5AV9A 3UTBB 3KUYB 2PYOC 3REKB 4J8UA 4H9RB 5AY8C 3AN2C 5FUGB 2FJ7A 5CPKA 3X1VA 3REJA 4M6BA 3WA9A 3AZJD 4G92B 1KX5A 4J8XB 1U35A 2NZDA 1H3OB 3REID 4YS3D 2FFFB 3B0CT 3AZJC 3C1CA 5CPIB 3REIC 2IO5B 4UPKA 4YS3C 3LZ1A 1ZLAD 3AZMD 1WWSA 3MGSD 2CV5D 1ZLAC 3VH6A 3AZMC 3W96D 1M18B 3W99B 4Z5TD 4XZQD 1JFIA 2CV5C 1P3AD 3W96C 3UT9A 1P3LB 5GSUB 4Z5TC 4XZQC 4WU8A 3LJAD 5CP6A 3KXBD 1P3AC 5GT3B 3KFUG 2YFWA 4QLCD 5AV6B 3EPKA 3EPLA 2JCHA 1W2EA 3TU4D 3W97D 3KXBC 2PYOA 1R4VA 1ULYA 2UWXA 3UTBD 3KUYD 2NQBD 5AY8A 3AN2A 4QLCC 3REKD 2ZM5A 2Y2QA 3TU4C 3AZED 2FJ7B 1BH8A 3W97C 5CPKB 2NQBC 3X1VB 3KUYC 3WA9B 3REKC 4WU9D 3AZEC 1U35B 2NZDB 4J8XD 3EG5B 4R8PA 3AZJA 5AVCD 5KDMB 4WU9C 3B6FC 5CPID 5B0ZD 3X1SD 4J8XC 3W98D 4YS3A 5AVCC 1P3BA 3LZ1B 4KHAA 5CPIC 5DNMA 5B0ZC 3X1SC 3W98C 3KWQD 1P3KC 2IO5C 1ZLAA 1JFIB 2F2AC 3W99D 2CV5A 3KWQC 3B6GD 3UT9B 3W96A 3A6NA 4WU8B 1P3LD 1B67A 3W99C 5CP6B 1P3AA 3B6GC 2YFWB 5GT3D 4JJND 5AV6D 1P3LC 3KSYA 4NE3A 2BYKB 3KXBA 2PYOB 4QLCA 5GT3C 1M19D 4JJNC 5AV6C 3TU4A 3W97A 1BH8B 2NQBA 3NQUA 3REKA 1M19C 5CPJD 4DQYB 3AZEA 1TAFA 4R8PB 2NZDD 2AROB 5CPJC 4WU9A 3B6FA 1HTAA 3AZKD 4J8XA 5B33B 2NZDC 1P3BB 5AVCA 2DQNC 4E45A 4CAYA 2CWEA 5DNMB 5CPIA 3X1SA 5B0ZA 3AZKC 1P3GD 3W98A 3AV2D 4EO5B 3WTPD 1P3KA 1P3GC 3AV2C 3WTPC 2CV5B 3IP4C 3KWQA 4CSRA 3A6NB 5B1MD 1P3FD
chains in the Genus database with same CATH topology
1P3AB 3B6GA 1S32C 5B1MC 4Z2MG 3KXBB 1P3FC 2Y2NA 5GT3A 4JJNA 5AV6A 3TU4B 3W97B 1T3UA 2G5IC 2NQBB 3NQUB 5AV5A 1M19A 3O62D 3AZEB 1TAFB 3X1UD 5GT0D 3VH6W 3O62C 4R8PD 4WU9B 5CPJA 2AROD 3B6FB 3RELD 3X1UC 4WJ3C 5GT0C 5AVCB 5B1LB 4R8PC 5B33D 2AROC 1P3BD 4CAYB 4WV4B 5KDMA 5B0ZB 3X1SB 3RELC 3AZKA 3W98B 4X23B 5DNMD 1P3KB 3AZLD 5B33C 1P3BC 4AWLC 1P3GA 3AV2A 5DNMC 3WTPA 3KWQB 3AZLC 3B0DC 5B24C 4EO5C 4CSRB 3A6ND 5E5AB 3B6GB 1S32A 1HQ3D 5B1MA 4XUJB 3A6NC 1P3FA 3H0MC 4NE6A 5AV8D 2BG1A 1HQ3C 4JJNB 4H9SC 1F66D 2F8NH 5AV8C 1ID3B 4ZBJC 5AV5B 4H9OA 2BYKA 5B32G 1M19B 3MNND 1A7WA 1F66C 1AOID 1BFMA 4J8VD 3O62A 3MNNC 5CPJB 3W99A 1AOIC 5B40B 5B32D 3B6FD 3X1UA 5GT0A 5BNXB 4J8VC 3AZNB 2AROA 5B1LD 5B32C 3AZKB 3RELA 5B2IB 4G91C 4YM6B 4X23D 4E44A 5B33A 5DNND 3X1TD 1P3KD 5B1LC 5C3IC 1P3GB 2HIOD 3AV2B 3WTPB 4DRAA 2RVQD 3AZLA 5B24A 4X23C 3X1TC 5DNNC 1EQZB 2HIOC 2RVQC 1KU5A 1S32B 2ZY5A 5E5AD 5JA4B 5B1MB 3UTAB 3AZFB 1WWIA 1P3FB 4XUJD 1HQ3A 5E5AC 4H9SA 4LD9D 1M1AB 4XUJC 5AV8A 4H9OB 2F8NK 1B6WA 2Y2LA 1ID3D 5AV5D 3WTPE 3P5JB 1F66A 4LD9C 5B2JD 3VH5W 1ID3C 2F8NG 5AV5C 3EPJA 3O62B 3MNNA 1AOIA 2XD1A 5B2JC 3X1UB 2HUEC 3WAAB 5GT0B 5B40D 4J8VA 5B32A 3RELB 3AZND 2F8ND 5B40C 1Q9CA 1KX3C 2Y2HA 5B2ID 4YM6D 5B1LA 1P34C 1F1EA 4AWLB 3C1BB 3AZNC 4H9QA 3AZLB 3B0DB 5B24B 4X23A 3VH5A 3A1KA 5DNNA 4H9PA 5B2IC 4ZUXD 4YM6C 4WZSB 3X1TA 3AZHD 2HIOA 2Y2IA 1EQZD 3WKJD 3AYWC 4ZUXC 2Y2GA 3AZHC 1S32D 2ZY3A 2YFVB 3UTAD 3AZFD 1P3PD 1EQZC 3WKJC 4Z66B 1HQ3B 5E5AA 5F99B 2RIQA 1P3MB 5AV8B 3UTAC 4XUJA 3MGPC 4J8WD 4ZBJB 3AZFC 1P3PC 1KX4B 1M1AD 2G5HC 2ZY4A 1F66B 4LD9A 2Y2OA 4KGCD 4J8WC 1M1AC 4UUZB 1ID3A 3EPHA 3H0LC 3MNNB 1AOIB 1BH9A 4KGCC 5B31B 5B2JA 4J8VB 3WAAD 3V9RA 5B32B 3F6TA 5B40A 1KX3A 4G91B 3AFAD 3WAAC 5BT1D 5B0YB 5CHLB 5BNXA 3MGRB 5C3IB 1P34A 2F8NA 3AZNA 4H9QB 3AFAC 3C1BD 5BT1C 3X1TB 1TZYB 4H9PB 5DNNB 5B2IA 5B24D 4YM6A 2HIOB 2Y2KA 3C1BC 1P3OD 3AYWA 4ZUXA 4KUDD 3AZHA 3MGQD 2JSSA 3LELD 3VH6T 1EQZA 1P3OC 3LZ0D 5AVBD 3WKJA 4KUDC 3AV1D 4H9NA 4Z66D 5JRGD 3MGQC 5JA4A 5F99D 3UTAA 3LELC 3MGPA 3AZFA 1P3MD 1P3PA 3LZ0C 5AVBC 3MVDB 3AV1C 1KX4D 4Z66C 5JRGC 5B31G 4LD9B 5F99C 4J8WA 1P3MC 4HGAB 1M1AA 3REHD 1KX4C 3NQJA 1BH9B 4KGCA 5B2JB 2HUEB 3AZGA 5B31D 3REHC 1P3IA 3V9RB 1KX3B 5B31C 3MGSC 3WAAA 3AZID 2Y2PA 1P34B 5B0YD 2F8NB 3MGRD 5G49B 3AFAA 3AZIC 5GXQD 5AV9B 3R45A 4NFTA 1N1JA 1TZYD 2LY8A 5B0YC 3MGRC 3LJAC 2ZY2A 3C1BA 5BNVA 4J8UB 5GXQC 4ZUXB 3AYWB 3AZHB 2Y2JA 1TZYC 3WKJB 5BS7C 5BO0A 3UTBC 1P3OA 3REJB 4H9NB 2Y2MA 1KX5B 4KUDA 3MGQA 1Z2CB 1P3PB 3MGPB 3LELA 3LZ0A 5AVBA 2YFVA 4WNNA 3C1CB 3AV1A 4Z66A 5JRGA 3MVDD 5F99A 4J8WB 4G92C 3H0RC 1P3MA 3REIA 3NQJB 3A1IA 1KX4A 3MVDC 4KGCB 3AZGB 2XD5A 3REHA 1P3IB 4HGAC 4UUZA 3AZMA 2BYMA 1M18D 5B31A 3MGSA 4Z2MH 1KX3D 4Z5TA 4XZQA 1M18C 5GSUD 3AFAB 1P34D 3AZIA 3R45B 1N1JB 5B0YA 3MGRA 5AV9D 3LJAA 5GSUC 5BNVB 2J8PA 3FDDA 5AY8B 5GXQA 3AN2B 4J8UD 1TZYA 3AYWD 3VH5T 5AV9C 5BO0B 5BS7A 1P3OB 3UTBA 3KUYA 2FJ7D 4KUDB 5CPKD 2JE5A 3MGQB 4J8UC 4H9RA 3REJD 3X1VD 3WA9D 5FUGA 3LELB 1KX5D 3LZ0B 5AVBB 1U35D 3MGPD 4WNNB 2FJ7C 3AL0C 3AZJB 3AV1B 5CPKC 3X1VC 3REJC 5JRGB 3WA9C 3C1CD 1KX5C 3REIB 1U35C 4YS3B 4NE5A 1H3OA 3MVDA 4KHAB 3C1CC 3LZ1D 2L5AA 3REHB 3AZGD 1ZLAB 3AZMB 1P3ID 3LZ1C 2BYMB 2W8SA 3B0BA 3MGSB 4DRBA 3AZGC 3W96B 1P3IC 4Z5TB 4XZQB 3UT9D 1M18A 3AZIB 4WU8D 5CP6D 2VQRA 1PZRA 3UT9C 3LJAB 1P3LA 5GSUA 3B0CW 4WU8C 5GXQB 5G49A 5CP6C 2PYOD 4QLCB 2DF4C 5AY8D 3AN2D 5AV9A 3UTBB 3KUYB 2PYOC 3REKB 4J8UA 4H9RB 5AY8C 3AN2C 5FUGB 2FJ7A 5CPKA 3X1VA 3REJA 4M6BA 3WA9A 3AZJD 4G92B 1KX5A 4J8XB 1U35A 2NZDA 1H3OB 3REID 4YS3D 2FFFB 3B0CT 3AZJC 3C1CA 5CPIB 3REIC 2IO5B 4UPKA 4YS3C 3LZ1A 1ZLAD 3AZMD 1WWSA 3MGSD 2CV5D 1ZLAC 3VH6A 3AZMC 3W96D 1M18B 3W99B 4Z5TD 4XZQD 1JFIA 2CV5C 1P3AD 3W96C 3UT9A 1P3LB 5GSUB 4Z5TC 4XZQC 4WU8A 3LJAD 5CP6A 3KXBD 1P3AC 5GT3B 3KFUG 2YFWA 4QLCD 5AV6B 3EPKA 3EPLA 2JCHA 1W2EA 3TU4D 3W97D 3KXBC 2PYOA 1R4VA 1ULYA 2UWXA 3UTBD 3KUYD 2NQBD 5AY8A 3AN2A 4QLCC 3REKD 2ZM5A 2Y2QA 3TU4C 3AZED 2FJ7B 1BH8A 3W97C 5CPKB 2NQBC 3X1VB 3KUYC 3WA9B 3REKC 4WU9D 3AZEC 1U35B 2NZDB 4J8XD 3EG5B 4R8PA 3AZJA 5AVCD 5KDMB 4WU9C 3B6FC 5CPID 5B0ZD 3X1SD 4J8XC 3W98D 4YS3A 5AVCC 1P3BA 3LZ1B 4KHAA 5CPIC 5DNMA 5B0ZC 3X1SC 3W98C 3KWQD 1P3KC 2IO5C 1ZLAA 1JFIB 2F2AC 3W99D 2CV5A 3KWQC 3B6GD 3UT9B 3W96A 3A6NA 4WU8B 1P3LD 1B67A 3W99C 5CP6B 1P3AA 3B6GC 2YFWB 5GT3D 4JJND 5AV6D 1P3LC 3KSYA 4NE3A 2BYKB 3KXBA 2PYOB 4QLCA 5GT3C 1M19D 4JJNC 5AV6C 3TU4A 3W97A 1BH8B 2NQBA 3NQUA 3REKA 1M19C 5CPJD 4DQYB 3AZEA 1TAFA 4R8PB 2NZDD 2AROB 5CPJC 4WU9A 3B6FA 1HTAA 3AZKD 4J8XA 5B33B 2NZDC 1P3BB 5AVCA 2DQNC 4E45A 4CAYA 2CWEA 5DNMB 5CPIA 3X1SA 5B0ZA 3AZKC 1P3GD 3W98A 3AV2D 4EO5B 3WTPD 1P3KA 1P3GC 3AV2C 3WTPC 2CV5B 3IP4C 3KWQA 4CSRA 3A6NB 5B1MD 1P3FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A B;  3B6G A;  1S32 C;  5B1M C;  4Z2M G;  3KXB B;  1P3F C;  5GT3 A;  4JJN A;  5AV6 A;  3TU4 B;  3W97 B;  2NQB B;  3NQU B;  5AV5 A;  1M19 A;  3O62 D;  3AZE B;  1TAF B;  3X1U D;  5GT0 D;  3VH6 W;  3O62 C;  4R8P D;  4WU9 B;  5CPJ A;  2ARO D;  3B6F B;  3REL D;  3X1U C;  5GT0 C;  5AVC B;  5B1L B;  4R8P C;  5B33 D;  2ARO C;  1P3B D;  4CAY B;  4WV4 B;  5KDM A;  5B0Z B;  3X1S B;  3REL C;  3AZK A;  3W98 B;  4X23 B;  5DNM D;  1P3K B;  3AZL D;  5B33 C;  1P3B C;  4AWL C;  1P3G A;  3AV2 A;  5DNM C;  3WTP A;  3KWQ B;  3AZL C;  3B0D C;  5B24 C;  4EO5 C;  4CSR B;  3A6N D;  5E5A B;  3B6G B;  1S32 A;  1HQ3 D;  5B1M A;  4XUJ B;  3A6N C;  1P3F A;  4NE6 A;  5AV8 D;  1HQ3 C;  4JJN B;  4H9S C;  1F66 D;  2F8N H;  5AV8 C;  1ID3 B;  4ZBJ C;  5AV5 B;  4H9O A;  2BYK A;  5B32 G;  1M19 B;  3MNN D;  1A7W A;  1F66 C;  1AOI D;  1BFM A;  4J8V D;  3O62 A;  3MNN C;  5CPJ B;  3W99 A;  1AOI C;  5B40 B;  5B32 D;  3B6F D;  3X1U A;  5GT0 A;  5BNX B;  4J8V C;  3AZN B;  2ARO A;  5B1L D;  5B32 C;  3AZK B;  3REL A;  5B2I B;  4G91 C;  4YM6 B;  4X23 D;  4E44 A;  5B33 A;  5DNN D;  3X1T D;  1P3K D;  5B1L C;  5C3I C;  1P3G B;  2HIO D;  3AV2 B;  3WTP B;  4DRA A;  2RVQ D;  3AZL A;  5B24 A;  4X23 C;  3X1T C;  5DNN C;  1EQZ B;  2HIO C;  2RVQ C;  1KU5 A;  1S32 B;  5E5A D;  5JA4 B;  5B1M B;  3UTA B;  3AZF B;  1WWI A;  1P3F B;  4XUJ D;  1HQ3 A;  5E5A C;  4H9S A;  4LD9 D;  1M1A B;  4XUJ C;  5AV8 A;  4H9O B;  2F8N K;  1B6W A;  1ID3 D;  5AV5 D;  3WTP E;  1F66 A;  4LD9 C;  5B2J D;  3VH5 W;  1ID3 C;  2F8N G;  5AV5 C;  3O62 B;  3MNN A;  1AOI A;  5B2J C;  3X1U B;  2HUE C;  3WAA B;  5GT0 B;  5B40 D;  4J8V A;  5B32 A;  3REL B;  3AZN D;  2F8N D;  5B40 C;  1Q9C A;  1KX3 C;  5B2I D;  4YM6 D;  5B1L A;  1P34 C;  1F1E A;  4AWL B;  3C1B B;  3AZN C;  4H9Q A;  3AZL B;  3B0D B;  5B24 B;  4X23 A;  3VH5 A;  5B2I C;  5DNN A;  4H9P A;  4ZUX D;  4WZS B;  4YM6 C;  3X1T A;  3AZH D;  2HIO A;  1EQZ D;  3WKJ D;  3AYW C;  4ZUX C;  3AZH C;  1S32 D;  2YFV B;  3UTA D;  3AZF D;  1P3P D;  1EQZ C;  3WKJ C;  4Z66 B;  1HQ3 B;  5E5A A;  5F99 B;  1P3M B;  5AV8 B;  3UTA C;  4XUJ A;  3MGP C;  4J8W D;  4ZBJ B;  3AZF C;  1P3P C;  1KX4 B;  1M1A D;  1F66 B;  4LD9 A;  4KGC D;  4J8W C;  1M1A C;  4UUZ B;  1ID3 A;  3MNN B;  1AOI B;  1BH9 A;  4KGC C;  5B31 B;  5B2J A;  4J8V B;  3WAA D;  3V9R A;  5B32 B;  5B40 A;  1KX3 A;  4G91 B;  3AFA D;  3WAA C;  5BT1 D;  5B0Y B;  5CHL B;  5BNX A;  3MGR B;  5C3I B;  1P34 A;  2F8N A;  3AZN A;  4H9Q B;  3AFA C;  3C1B D;  5BT1 C;  3X1T B;  1TZY B;  4H9P B;  5DNN B;  5B2I A;  5B24 D;  4YM6 A;  2HIO B;  3C1B C;  1P3O D;  3AYW A;  4ZUX A;  4KUD D;  3AZH A;  3MGQ D;  2JSS A;  3LEL D;  3VH6 T;  1EQZ A;  1P3O C;  3LZ0 D;  5AVB D;  3WKJ A;  4KUD C;  3AV1 D;  4H9N A;  4Z66 D;  5JRG D;  3MGQ C;  5JA4 A;  5F99 D;  3UTA A;  3LEL C;  3MGP A;  3AZF A;  1P3M D;  1P3P A;  3LZ0 C;  5AVB C;  3MVD B;  3AV1 C;  1KX4 D;  4Z66 C;  5JRG C;  5B31 G;  4LD9 B;  5F99 C;  4J8W A;  1P3M C;  4HGA B;  1M1A A;  3REH D;  1KX4 C;  3NQJ A;  1BH9 B;  4KGC A;  5B2J B;  2HUE B;  3AZG A;  5B31 D;  3REH C;  1P3I A;  3V9R B;  1KX3 B;  5B31 C;  3MGS C;  3WAA A;  3AZI D;  1P34 B;  5B0Y D;  2F8N B;  3MGR D;  5G49 B;  3AFA A;  3AZI C;  5GXQ D;  5AV9 B;  3R45 A;  4NFT A;  1N1J A;  1TZY D;  2LY8 A;  5B0Y C;  3MGR C;  3LJA C;  3C1B A;  5BNV A;  4J8U B;  5GXQ C;  4ZUX B;  3AYW B;  3AZH B;  1TZY C;  3WKJ B;  5BS7 C;  5BO0 A;  3UTB C;  1P3O A;  3REJ B;  4H9N B;  1KX5 B;  4KUD A;  3MGQ A;  1P3P B;  3MGP B;  3LEL A;  3LZ0 A;  5AVB A;  2YFV A;  4WNN A;  3C1C B;  3AV1 A;  4Z66 A;  5JRG A;  3MVD D;  5F99 A;  4J8W B;  4G92 C;  1P3M A;  3REI A;  3NQJ B;  1KX4 A;  3MVD C;  4KGC B;  3AZG B;  3REH A;  1P3I B;  4HGA C;  4UUZ A;  3AZM A;  2BYM A;  1M18 D;  5B31 A;  3MGS A;  4Z2M H;  1KX3 D;  4Z5T A;  4XZQ A;  1M18 C;  5GSU D;  3AFA B;  1P34 D;  3AZI A;  3R45 B;  1N1J B;  5B0Y A;  3MGR A;  5AV9 D;  3LJA A;  5GSU C;  5BNV B;  5GXQ A;  5AY8 B;  3AN2 B;  4J8U D;  1TZY A;  3AYW D;  3VH5 T;  5AV9 C;  5BO0 B;  5BS7 A;  1P3O B;  3UTB A;  3KUY A;  2FJ7 D;  4KUD B;  5CPK D;  4J8U C;  3MGQ B;  3REJ D;  4H9R A;  3X1V D;  3WA9 D;  5FUG A;  3LEL B;  1KX5 D;  3LZ0 B;  5AVB B;  1U35 D;  3MGP D;  4WNN B;  2FJ7 C;  3AZJ B;  3AV1 B;  5CPK C;  3X1V C;  3REJ C;  5JRG B;  3WA9 C;  3C1C D;  1KX5 C;  3REI B;  1U35 C;  4YS3 B;  4NE5 A;  1H3O A;  3MVD A;  4KHA B;  3C1C C;  3LZ1 D;  2L5A A;  3REH B;  3AZG D;  1ZLA B;  3AZM B;  1P3I D;  3LZ1 C;  2BYM B;  3B0B A;  3MGS B;  4DRB A;  3AZG C;  3W96 B;  1P3I C;  4Z5T B;  4XZQ B;  3UT9 D;  1M18 A;  3AZI B;  4WU8 D;  5CP6 D;  3UT9 C;  3LJA B;  1P3L A;  5GSU A;  3B0C W;  4WU8 C;  5GXQ B;  5G49 A;  5CP6 C;  2PYO D;  4QLC B;  5AY8 D;  3AN2 D;  5AV9 A;  3UTB B;  3KUY B;  2PYO C;  3REK B;  4J8U A;  4H9R B;  5AY8 C;  3AN2 C;  5FUG B;  2FJ7 A;  5CPK A;  3X1V A;  3REJ A;  4M6B A;  3WA9 A;  3AZJ D;  4G92 B;  1KX5 A;  4J8X B;  1U35 A;  2NZD A;  1H3O B;  3REI D;  4YS3 D;  3AZJ C;  3B0C T;  3C1C A;  5CPI B;  3REI C;  2IO5 B;  4YS3 C;  3LZ1 A;  1ZLA D;  3AZM D;  1WWS A;  3MGS D;  2CV5 D;  1ZLA C;  3VH6 A;  3AZM C;  3W96 D;  1M18 B;  3W99 B;  4Z5T D;  4XZQ D;  1JFI A;  2CV5 C;  1P3A D;  3W96 C;  3UT9 A;  1P3L B;  5GSU B;  4Z5T C;  4XZQ C;  4WU8 A;  3LJA D;  5CP6 A;  3KXB D;  1P3A C;  5GT3 B;  2YFW A;  4QLC D;  5AV6 B;  3TU4 D;  3W97 D;  3KXB C;  2PYO A;  1R4V A;  1ULY A;  3UTB D;  2NQB D;  3KUY D;  5AY8 A;  3AN2 A;  4QLC C;  3REK D;  3TU4 C;  3AZE D;  3W97 C;  2FJ7 B;  1BH8 A;  5CPK B;  2NQB C;  3X1V B;  3KUY C;  3WA9 B;  3REK C;  4WU9 D;  3AZE C;  1U35 B;  2NZD B;  4J8X D;  4R8P A;  3AZJ A;  5AVC D;  5KDM B;  4WU9 C;  3B6F C;  5CPI D;  5B0Z D;  3X1S D;  4J8X C;  3W98 D;  4YS3 A;  5AVC C;  1P3B A;  3LZ1 B;  4KHA A;  5CPI C;  5DNM A;  5B0Z C;  3X1S C;  3W98 C;  3KWQ D;  1P3K C;  2IO5 C;  1ZLA A;  1JFI B;  3W99 D;  2CV5 A;  3KWQ C;  3B6G D;  3UT9 B;  3W96 A;  3A6N A;  4WU8 B;  1P3L D;  1B67 A;  3W99 C;  5CP6 B;  1P3A A;  3B6G C;  2YFW B;  5GT3 D;  4JJN D;  5AV6 D;  1P3L C;  3KSY A;  4NE3 A;  2BYK B;  3KXB A;  2PYO B;  4QLC A;  5GT3 C;  1M19 D;  4JJN C;  5AV6 C;  3TU4 A;  3W97 A;  1BH8 B;  2NQB A;  3NQU A;  3REK A;  1M19 C;  5CPJ D;  3AZE A;  1TAF A;  4R8P B;  2NZD D;  2ARO B;  5CPJ C;  4WU9 A;  3B6F A;  1HTA A;  3AZK D;  4J8X A;  5B33 B;  2NZD C;  1P3B B;  5AVC A;  4E45 A;  4CAY A;  2CWE A;  5DNM B;  5CPI A;  3X1S A;  5B0Z A;  3AZK C;  1P3G D;  3W98 A;  3AV2 D;  4EO5 B;  3WTP D;  1P3K A;  1P3G C;  3AV2 C;  3WTP C;  2CV5 B;  3KWQ A;  4CSR A;  3A6N B;  5B1M D;  1P3F D; 
#chains in the Genus database with same CATH topology
 1P3A B;  3B6G A;  1S32 C;  5B1M C;  4Z2M G;  3KXB B;  1P3F C;  2Y2N A;  5GT3 A;  4JJN A;  5AV6 A;  3TU4 B;  3W97 B;  1T3U A;  2G5I C;  2NQB B;  3NQU B;  5AV5 A;  1M19 A;  3O62 D;  3AZE B;  1TAF B;  3X1U D;  5GT0 D;  3VH6 W;  3O62 C;  4R8P D;  4WU9 B;  5CPJ A;  2ARO D;  3B6F B;  3REL D;  3X1U C;  4WJ3 C;  5GT0 C;  5AVC B;  5B1L B;  4R8P C;  5B33 D;  2ARO C;  1P3B D;  4CAY B;  4WV4 B;  5KDM A;  5B0Z B;  3X1S B;  3REL C;  3AZK A;  3W98 B;  4X23 B;  5DNM D;  1P3K B;  3AZL D;  5B33 C;  1P3B C;  4AWL C;  1P3G A;  3AV2 A;  5DNM C;  3WTP A;  3KWQ B;  3AZL C;  3B0D C;  5B24 C;  4EO5 C;  4CSR B;  3A6N D;  5E5A B;  3B6G B;  1S32 A;  1HQ3 D;  5B1M A;  4XUJ B;  3A6N C;  1P3F A;  3H0M C;  4NE6 A;  5AV8 D;  2BG1 A;  1HQ3 C;  4JJN B;  4H9S C;  1F66 D;  2F8N H;  5AV8 C;  1ID3 B;  4ZBJ C;  5AV5 B;  4H9O A;  2BYK A;  5B32 G;  1M19 B;  3MNN D;  1A7W A;  1F66 C;  1AOI D;  1BFM A;  4J8V D;  3O62 A;  3MNN C;  5CPJ B;  3W99 A;  1AOI C;  5B40 B;  5B32 D;  3B6F D;  3X1U A;  5GT0 A;  5BNX B;  4J8V C;  3AZN B;  2ARO A;  5B1L D;  5B32 C;  3AZK B;  3REL A;  5B2I B;  4G91 C;  4YM6 B;  4X23 D;  4E44 A;  5B33 A;  5DNN D;  3X1T D;  1P3K D;  5B1L C;  5C3I C;  1P3G B;  2HIO D;  3AV2 B;  3WTP B;  4DRA A;  2RVQ D;  3AZL A;  5B24 A;  4X23 C;  3X1T C;  5DNN C;  1EQZ B;  2HIO C;  2RVQ C;  1KU5 A;  1S32 B;  2ZY5 A;  5E5A D;  5JA4 B;  5B1M B;  3UTA B;  3AZF B;  1WWI A;  1P3F B;  4XUJ D;  1HQ3 A;  5E5A C;  4H9S A;  4LD9 D;  1M1A B;  4XUJ C;  5AV8 A;  4H9O B;  2F8N K;  1B6W A;  2Y2L A;  1ID3 D;  5AV5 D;  3WTP E;  3P5J B;  1F66 A;  4LD9 C;  5B2J D;  3VH5 W;  1ID3 C;  2F8N G;  5AV5 C;  3EPJ A;  3O62 B;  3MNN A;  1AOI A;  2XD1 A;  5B2J C;  3X1U B;  2HUE C;  3WAA B;  5GT0 B;  5B40 D;  4J8V A;  5B32 A;  3REL B;  3AZN D;  2F8N D;  5B40 C;  1Q9C A;  1KX3 C;  2Y2H A;  5B2I D;  4YM6 D;  5B1L A;  1P34 C;  1F1E A;  4AWL B;  3C1B B;  3AZN C;  4H9Q A;  3AZL B;  3B0D B;  5B24 B;  4X23 A;  3VH5 A;  3A1K A;  5DNN A;  4H9P A;  5B2I C;  4ZUX D;  4YM6 C;  4WZS B;  3X1T A;  3AZH D;  2HIO A;  2Y2I A;  1EQZ D;  3WKJ D;  3AYW C;  4ZUX C;  2Y2G A;  3AZH C;  1S32 D;  2ZY3 A;  2YFV B;  3UTA D;  3AZF D;  1P3P D;  1EQZ C;  3WKJ C;  4Z66 B;  1HQ3 B;  5E5A A;  5F99 B;  2RIQ A;  1P3M B;  5AV8 B;  3UTA C;  4XUJ A;  3MGP C;  4J8W D;  4ZBJ B;  3AZF C;  1P3P C;  1KX4 B;  1M1A D;  2G5H C;  2ZY4 A;  1F66 B;  4LD9 A;  2Y2O A;  4KGC D;  4J8W C;  1M1A C;  4UUZ B;  1ID3 A;  3EPH A;  3H0L C;  3MNN B;  1AOI B;  1BH9 A;  4KGC C;  5B31 B;  5B2J A;  4J8V B;  3WAA D;  3V9R A;  5B32 B;  3F6T A;  5B40 A;  1KX3 A;  4G91 B;  3AFA D;  3WAA C;  5BT1 D;  5B0Y B;  5CHL B;  5BNX A;  3MGR B;  5C3I B;  1P34 A;  2F8N A;  3AZN A;  4H9Q B;  3AFA C;  3C1B D;  5BT1 C;  3X1T B;  1TZY B;  4H9P B;  5DNN B;  5B2I A;  5B24 D;  4YM6 A;  2HIO B;  2Y2K A;  3C1B C;  1P3O D;  3AYW A;  4ZUX A;  4KUD D;  3AZH A;  3MGQ D;  2JSS A;  3LEL D;  3VH6 T;  1EQZ A;  1P3O C;  3LZ0 D;  5AVB D;  3WKJ A;  4KUD C;  3AV1 D;  4H9N A;  4Z66 D;  5JRG D;  3MGQ C;  5JA4 A;  5F99 D;  3UTA A;  3LEL C;  3MGP A;  3AZF A;  1P3M D;  1P3P A;  3LZ0 C;  5AVB C;  3MVD B;  3AV1 C;  1KX4 D;  4Z66 C;  5JRG C;  5B31 G;  4LD9 B;  5F99 C;  4J8W A;  1P3M C;  4HGA B;  1M1A A;  3REH D;  1KX4 C;  3NQJ A;  1BH9 B;  4KGC A;  5B2J B;  2HUE B;  3AZG A;  5B31 D;  3REH C;  1P3I A;  3V9R B;  1KX3 B;  5B31 C;  3MGS C;  3WAA A;  3AZI D;  2Y2P A;  1P34 B;  5B0Y D;  2F8N B;  3MGR D;  5G49 B;  3AFA A;  3AZI C;  5GXQ D;  5AV9 B;  3R45 A;  4NFT A;  1N1J A;  1TZY D;  2LY8 A;  5B0Y C;  3MGR C;  3LJA C;  2ZY2 A;  3C1B A;  5BNV A;  4J8U B;  5GXQ C;  4ZUX B;  3AYW B;  3AZH B;  2Y2J A;  1TZY C;  3WKJ B;  5BS7 C;  5BO0 A;  3UTB C;  1P3O A;  3REJ B;  4H9N B;  2Y2M A;  1KX5 B;  4KUD A;  3MGQ A;  1Z2C B;  1P3P B;  3MGP B;  3LEL A;  3LZ0 A;  5AVB A;  2YFV A;  4WNN A;  3C1C B;  3AV1 A;  4Z66 A;  5JRG A;  3MVD D;  5F99 A;  4J8W B;  4G92 C;  3H0R C;  1P3M A;  3REI A;  3NQJ B;  3A1I A;  1KX4 A;  3MVD C;  4KGC B;  3AZG B;  2XD5 A;  3REH A;  1P3I B;  4HGA C;  4UUZ A;  3AZM A;  2BYM A;  1M18 D;  5B31 A;  3MGS A;  4Z2M H;  1KX3 D;  4Z5T A;  4XZQ A;  1M18 C;  5GSU D;  3AFA B;  1P34 D;  3AZI A;  3R45 B;  1N1J B;  5B0Y A;  3MGR A;  5AV9 D;  3LJA A;  5GSU C;  5BNV B;  2J8P A;  3FDD A;  5AY8 B;  5GXQ A;  3AN2 B;  4J8U D;  1TZY A;  3AYW D;  3VH5 T;  5AV9 C;  5BO0 B;  5BS7 A;  1P3O B;  3UTB A;  3KUY A;  2FJ7 D;  4KUD B;  5CPK D;  2JE5 A;  3MGQ B;  4J8U C;  4H9R A;  3REJ D;  3X1V D;  3WA9 D;  5FUG A;  3LEL B;  1KX5 D;  3LZ0 B;  5AVB B;  1U35 D;  3MGP D;  4WNN B;  2FJ7 C;  3AL0 C;  3AZJ B;  3AV1 B;  5CPK C;  3X1V C;  3REJ C;  5JRG B;  3WA9 C;  3C1C D;  1KX5 C;  3REI B;  1U35 C;  4YS3 B;  4NE5 A;  1H3O A;  3MVD A;  4KHA B;  3C1C C;  3LZ1 D;  2L5A A;  3REH B;  3AZG D;  1ZLA B;  3AZM B;  1P3I D;  3LZ1 C;  2BYM B;  2W8S A;  3B0B A;  3MGS B;  4DRB A;  3AZG C;  3W96 B;  1P3I C;  4Z5T B;  4XZQ B;  3UT9 D;  1M18 A;  3AZI B;  4WU8 D;  5CP6 D;  2VQR A;  1PZR A;  3UT9 C;  3LJA B;  1P3L A;  5GSU A;  3B0C W;  4WU8 C;  5GXQ B;  5G49 A;  5CP6 C;  2PYO D;  4QLC B;  2DF4 C;  5AY8 D;  3AN2 D;  5AV9 A;  3UTB B;  3KUY B;  2PYO C;  3REK B;  4J8U A;  4H9R B;  5AY8 C;  3AN2 C;  5FUG B;  2FJ7 A;  5CPK A;  3X1V A;  3REJ A;  4M6B A;  3WA9 A;  3AZJ D;  4G92 B;  1KX5 A;  4J8X B;  1U35 A;  2NZD A;  1H3O B;  3REI D;  4YS3 D;  2FFF B;  3B0C T;  3AZJ C;  3C1C A;  5CPI B;  3REI C;  2IO5 B;  4UPK A;  4YS3 C;  3LZ1 A;  1ZLA D;  3AZM D;  1WWS A;  3MGS D;  2CV5 D;  1ZLA C;  3VH6 A;  3AZM C;  3W96 D;  1M18 B;  3W99 B;  4Z5T D;  4XZQ D;  1JFI A;  2CV5 C;  1P3A D;  3W96 C;  3UT9 A;  1P3L B;  5GSU B;  4Z5T C;  4XZQ C;  4WU8 A;  3LJA D;  5CP6 A;  3KXB D;  1P3A C;  5GT3 B;  3KFU G;  2YFW A;  4QLC D;  5AV6 B;  3EPK A;  3EPL A;  2JCH A;  1W2E A;  3TU4 D;  3W97 D;  3KXB C;  2PYO A;  1R4V A;  1ULY A;  2UWX A;  3UTB D;  3KUY D;  2NQB D;  5AY8 A;  3AN2 A;  4QLC C;  3REK D;  2ZM5 A;  2Y2Q A;  3TU4 C;  3AZE D;  2FJ7 B;  1BH8 A;  3W97 C;  5CPK B;  2NQB C;  3X1V B;  3KUY C;  3WA9 B;  3REK C;  4WU9 D;  3AZE C;  1U35 B;  2NZD B;  4J8X D;  3EG5 B;  4R8P A;  3AZJ A;  5AVC D;  5KDM B;  4WU9 C;  3B6F C;  5CPI D;  5B0Z D;  3X1S D;  4J8X C;  3W98 D;  4YS3 A;  5AVC C;  1P3B A;  3LZ1 B;  4KHA A;  5CPI C;  5DNM A;  5B0Z C;  3X1S C;  3W98 C;  3KWQ D;  1P3K C;  2IO5 C;  1ZLA A;  1JFI B;  2F2A C;  3W99 D;  2CV5 A;  3KWQ C;  3B6G D;  3UT9 B;  3W96 A;  3A6N A;  4WU8 B;  1P3L D;  1B67 A;  3W99 C;  5CP6 B;  1P3A A;  3B6G C;  2YFW B;  5GT3 D;  4JJN D;  5AV6 D;  1P3L C;  3KSY A;  4NE3 A;  2BYK B;  3KXB A;  2PYO B;  4QLC A;  5GT3 C;  1M19 D;  4JJN C;  5AV6 C;  3TU4 A;  3W97 A;  1BH8 B;  2NQB A;  3NQU A;  3REK A;  1M19 C;  5CPJ D;  4DQY B;  3AZE A;  1TAF A;  4R8P B;  2NZD D;  2ARO B;  5CPJ C;  4WU9 A;  3B6F A;  1HTA A;  3AZK D;  4J8X A;  5B33 B;  2NZD C;  1P3B B;  5AVC A;  2DQN C;  4E45 A;  4CAY A;  2CWE A;  5DNM B;  5CPI A;  3X1S A;  5B0Z A;  3AZK C;  1P3G D;  3W98 A;  3AV2 D;  4EO5 B;  3WTP D;  1P3K A;  1P3G C;  3AV2 C;  3WTP C;  2CV5 B;  3IP4 C;  3KWQ A;  4CSR A;  3A6N B;  5B1M D;  1P3F D; 
#chains in the Genus database with same CATH homology
 1P3A B;  3B6G A;  1S32 C;  5B1M C;  4Z2M G;  3KXB B;  1P3F C;  2Y2N A;  5GT3 A;  4JJN A;  5AV6 A;  3TU4 B;  3W97 B;  1T3U A;  2G5I C;  2NQB B;  3NQU B;  5AV5 A;  1M19 A;  3O62 D;  3AZE B;  1TAF B;  3X1U D;  5GT0 D;  3VH6 W;  3O62 C;  4R8P D;  4WU9 B;  5CPJ A;  2ARO D;  3B6F B;  3REL D;  3X1U C;  4WJ3 C;  5GT0 C;  5AVC B;  5B1L B;  4R8P C;  5B33 D;  2ARO C;  1P3B D;  4CAY B;  4WV4 B;  5KDM A;  5B0Z B;  3X1S B;  3REL C;  3AZK A;  3W98 B;  4X23 B;  5DNM D;  1P3K B;  3AZL D;  5B33 C;  1P3B C;  4AWL C;  1P3G A;  3AV2 A;  5DNM C;  3WTP A;  3KWQ B;  3AZL C;  3B0D C;  5B24 C;  4EO5 C;  4CSR B;  3A6N D;  5E5A B;  3B6G B;  1S32 A;  1HQ3 D;  5B1M A;  4XUJ B;  3A6N C;  1P3F A;  3H0M C;  4NE6 A;  5AV8 D;  2BG1 A;  1HQ3 C;  4JJN B;  4H9S C;  1F66 D;  2F8N H;  5AV8 C;  1ID3 B;  4ZBJ C;  5AV5 B;  4H9O A;  2BYK A;  5B32 G;  1M19 B;  3MNN D;  1A7W A;  1F66 C;  1AOI D;  1BFM A;  4J8V D;  3O62 A;  3MNN C;  5CPJ B;  3W99 A;  1AOI C;  5B40 B;  5B32 D;  3B6F D;  3X1U A;  5GT0 A;  5BNX B;  4J8V C;  3AZN B;  2ARO A;  5B1L D;  5B32 C;  3AZK B;  3REL A;  5B2I B;  4G91 C;  4YM6 B;  4X23 D;  4E44 A;  5B33 A;  5DNN D;  3X1T D;  1P3K D;  5B1L C;  5C3I C;  1P3G B;  2HIO D;  3AV2 B;  3WTP B;  4DRA A;  2RVQ D;  3AZL A;  5B24 A;  4X23 C;  3X1T C;  5DNN C;  1EQZ B;  2HIO C;  2RVQ C;  1KU5 A;  1S32 B;  2ZY5 A;  5E5A D;  5JA4 B;  5B1M B;  3UTA B;  3AZF B;  1WWI A;  1P3F B;  4XUJ D;  1HQ3 A;  5E5A C;  4H9S A;  4LD9 D;  1M1A B;  4XUJ C;  5AV8 A;  4H9O B;  2F8N K;  1B6W A;  2Y2L A;  1ID3 D;  5AV5 D;  3WTP E;  3P5J B;  1F66 A;  4LD9 C;  5B2J D;  3VH5 W;  1ID3 C;  2F8N G;  5AV5 C;  3EPJ A;  3O62 B;  3MNN A;  1AOI A;  2XD1 A;  5B2J C;  3X1U B;  2HUE C;  3WAA B;  5GT0 B;  5B40 D;  4J8V A;  5B32 A;  3REL B;  3AZN D;  2F8N D;  5B40 C;  1Q9C A;  1KX3 C;  2Y2H A;  5B2I D;  4YM6 D;  5B1L A;  1P34 C;  1F1E A;  4AWL B;  3C1B B;  3AZN C;  4H9Q A;  3AZL B;  3B0D B;  5B24 B;  4X23 A;  3VH5 A;  3A1K A;  5DNN A;  4H9P A;  5B2I C;  4ZUX D;  4YM6 C;  4WZS B;  3X1T A;  3AZH D;  2HIO A;  2Y2I A;  1EQZ D;  3WKJ D;  3AYW C;  4ZUX C;  2Y2G A;  3AZH C;  1S32 D;  2ZY3 A;  2YFV B;  3UTA D;  3AZF D;  1P3P D;  1EQZ C;  3WKJ C;  4Z66 B;  1HQ3 B;  5E5A A;  5F99 B;  2RIQ A;  1P3M B;  5AV8 B;  3UTA C;  4XUJ A;  3MGP C;  4J8W D;  4ZBJ B;  3AZF C;  1P3P C;  1KX4 B;  1M1A D;  2G5H C;  2ZY4 A;  1F66 B;  4LD9 A;  2Y2O A;  4KGC D;  4J8W C;  1M1A C;  4UUZ B;  1ID3 A;  3EPH A;  3H0L C;  3MNN B;  1AOI B;  1BH9 A;  4KGC C;  5B31 B;  5B2J A;  4J8V B;  3WAA D;  3V9R A;  5B32 B;  3F6T A;  5B40 A;  1KX3 A;  4G91 B;  3AFA D;  3WAA C;  5BT1 D;  5B0Y B;  5CHL B;  5BNX A;  3MGR B;  5C3I B;  1P34 A;  2F8N A;  3AZN A;  4H9Q B;  3AFA C;  3C1B D;  5BT1 C;  3X1T B;  1TZY B;  4H9P B;  5DNN B;  5B2I A;  5B24 D;  4YM6 A;  2HIO B;  2Y2K A;  3C1B C;  1P3O D;  3AYW A;  4ZUX A;  4KUD D;  3AZH A;  3MGQ D;  2JSS A;  3LEL D;  3VH6 T;  1EQZ A;  1P3O C;  3LZ0 D;  5AVB D;  3WKJ A;  4KUD C;  3AV1 D;  4H9N A;  4Z66 D;  5JRG D;  3MGQ C;  5JA4 A;  5F99 D;  3UTA A;  3LEL C;  3MGP A;  3AZF A;  1P3M D;  1P3P A;  3LZ0 C;  5AVB C;  3MVD B;  3AV1 C;  1KX4 D;  4Z66 C;  5JRG C;  5B31 G;  4LD9 B;  5F99 C;  4J8W A;  1P3M C;  4HGA B;  1M1A A;  3REH D;  1KX4 C;  3NQJ A;  1BH9 B;  4KGC A;  5B2J B;  2HUE B;  3AZG A;  5B31 D;  3REH C;  1P3I A;  3V9R B;  1KX3 B;  5B31 C;  3MGS C;  3WAA A;  3AZI D;  2Y2P A;  1P34 B;  5B0Y D;  2F8N B;  3MGR D;  5G49 B;  3AFA A;  3AZI C;  5GXQ D;  5AV9 B;  3R45 A;  4NFT A;  1N1J A;  1TZY D;  2LY8 A;  5B0Y C;  3MGR C;  3LJA C;  2ZY2 A;  3C1B A;  5BNV A;  4J8U B;  5GXQ C;  4ZUX B;  3AYW B;  3AZH B;  2Y2J A;  1TZY C;  3WKJ B;  5BS7 C;  5BO0 A;  3UTB C;  1P3O A;  3REJ B;  4H9N B;  2Y2M A;  1KX5 B;  4KUD A;  3MGQ A;  1Z2C B;  1P3P B;  3MGP B;  3LEL A;  3LZ0 A;  5AVB A;  2YFV A;  4WNN A;  3C1C B;  3AV1 A;  4Z66 A;  5JRG A;  3MVD D;  5F99 A;  4J8W B;  4G92 C;  3H0R C;  1P3M A;  3REI A;  3NQJ B;  3A1I A;  1KX4 A;  3MVD C;  4KGC B;  3AZG B;  2XD5 A;  3REH A;  1P3I B;  4HGA C;  4UUZ A;  3AZM A;  2BYM A;  1M18 D;  5B31 A;  3MGS A;  4Z2M H;  1KX3 D;  4Z5T A;  4XZQ A;  1M18 C;  5GSU D;  3AFA B;  1P34 D;  3AZI A;  3R45 B;  1N1J B;  5B0Y A;  3MGR A;  5AV9 D;  3LJA A;  5GSU C;  5BNV B;  2J8P A;  3FDD A;  5AY8 B;  5GXQ A;  3AN2 B;  4J8U D;  1TZY A;  3AYW D;  3VH5 T;  5AV9 C;  5BO0 B;  5BS7 A;  1P3O B;  3UTB A;  3KUY A;  2FJ7 D;  4KUD B;  5CPK D;  2JE5 A;  3MGQ B;  4J8U C;  4H9R A;  3REJ D;  3X1V D;  3WA9 D;  5FUG A;  3LEL B;  1KX5 D;  3LZ0 B;  5AVB B;  1U35 D;  3MGP D;  4WNN B;  2FJ7 C;  3AL0 C;  3AZJ B;  3AV1 B;  5CPK C;  3X1V C;  3REJ C;  5JRG B;  3WA9 C;  3C1C D;  1KX5 C;  3REI B;  1U35 C;  4YS3 B;  4NE5 A;  1H3O A;  3MVD A;  4KHA B;  3C1C C;  3LZ1 D;  2L5A A;  3REH B;  3AZG D;  1ZLA B;  3AZM B;  1P3I D;  3LZ1 C;  2BYM B;  2W8S A;  3B0B A;  3MGS B;  4DRB A;  3AZG C;  3W96 B;  1P3I C;  4Z5T B;  4XZQ B;  3UT9 D;  1M18 A;  3AZI B;  4WU8 D;  5CP6 D;  2VQR A;  1PZR A;  3UT9 C;  3LJA B;  1P3L A;  5GSU A;  3B0C W;  4WU8 C;  5GXQ B;  5G49 A;  5CP6 C;  2PYO D;  4QLC B;  2DF4 C;  5AY8 D;  3AN2 D;  5AV9 A;  3UTB B;  3KUY B;  2PYO C;  3REK B;  4J8U A;  4H9R B;  5AY8 C;  3AN2 C;  5FUG B;  2FJ7 A;  5CPK A;  3X1V A;  3REJ A;  4M6B A;  3WA9 A;  3AZJ D;  4G92 B;  1KX5 A;  4J8X B;  1U35 A;  2NZD A;  1H3O B;  3REI D;  4YS3 D;  2FFF B;  3B0C T;  3AZJ C;  3C1C A;  5CPI B;  3REI C;  2IO5 B;  4UPK A;  4YS3 C;  3LZ1 A;  1ZLA D;  3AZM D;  1WWS A;  3MGS D;  2CV5 D;  1ZLA C;  3VH6 A;  3AZM C;  3W96 D;  1M18 B;  3W99 B;  4Z5T D;  4XZQ D;  1JFI A;  2CV5 C;  1P3A D;  3W96 C;  3UT9 A;  1P3L B;  5GSU B;  4Z5T C;  4XZQ C;  4WU8 A;  3LJA D;  5CP6 A;  3KXB D;  1P3A C;  5GT3 B;  3KFU G;  2YFW A;  4QLC D;  5AV6 B;  3EPK A;  3EPL A;  2JCH A;  1W2E A;  3TU4 D;  3W97 D;  3KXB C;  2PYO A;  1R4V A;  1ULY A;  2UWX A;  3UTB D;  3KUY D;  2NQB D;  5AY8 A;  3AN2 A;  4QLC C;  3REK D;  2ZM5 A;  2Y2Q A;  3TU4 C;  3AZE D;  2FJ7 B;  1BH8 A;  3W97 C;  5CPK B;  2NQB C;  3X1V B;  3KUY C;  3WA9 B;  3REK C;  4WU9 D;  3AZE C;  1U35 B;  2NZD B;  4J8X D;  3EG5 B;  4R8P A;  3AZJ A;  5AVC D;  5KDM B;  4WU9 C;  3B6F C;  5CPI D;  5B0Z D;  3X1S D;  4J8X C;  3W98 D;  4YS3 A;  5AVC C;  1P3B A;  3LZ1 B;  4KHA A;  5CPI C;  5DNM A;  5B0Z C;  3X1S C;  3W98 C;  3KWQ D;  1P3K C;  2IO5 C;  1ZLA A;  1JFI B;  2F2A C;  3W99 D;  2CV5 A;  3KWQ C;  3B6G D;  3UT9 B;  3W96 A;  3A6N A;  4WU8 B;  1P3L D;  1B67 A;  3W99 C;  5CP6 B;  1P3A A;  3B6G C;  2YFW B;  5GT3 D;  4JJN D;  5AV6 D;  1P3L C;  3KSY A;  4NE3 A;  2BYK B;  3KXB A;  2PYO B;  4QLC A;  5GT3 C;  1M19 D;  4JJN C;  5AV6 C;  3TU4 A;  3W97 A;  1BH8 B;  2NQB A;  3NQU A;  3REK A;  1M19 C;  5CPJ D;  4DQY B;  3AZE A;  1TAF A;  4R8P B;  2NZD D;  2ARO B;  5CPJ C;  4WU9 A;  3B6F A;  1HTA A;  3AZK D;  4J8X A;  5B33 B;  2NZD C;  1P3B B;  5AVC A;  2DQN C;  4E45 A;  4CAY A;  2CWE A;  5DNM B;  5CPI A;  3X1S A;  5B0Z A;  3AZK C;  1P3G D;  3W98 A;  3AV2 D;  4EO5 B;  3WTP D;  1P3K A;  1P3G C;  3AV2 C;  3WTP C;  2CV5 B;  3IP4 C;  3KWQ A;  4CSR A;  3A6N B;  5B1M D;  1P3F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...