4J8XD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xD00
4M6BA 1M1AB 3LJAA 5F99D 3REIC 3AYWA 3W97C 4KGCC 1P3IA 3WA9A 4J8XB 4H9NA 3UTAB 3W96D 5B1MB 4NE6A 5B32G 4HGAB 3UTAD 3O62A 1TZYD 5E5AC 3MGRB 3R45A 3C1CD 2JSSA 1P3GD 4NE5A 1F66B 5BNVA 2HIOC 3V9RB 2PYOB 5B2JB 1KX4C 4EO5C 1EQZA 3MGSA 1WWIA 1P3ID 3REIA 3REJA 3AN2A 3REHB 3W97A 3TU4C 5CPKB 4Z66D 5GXQB 4DRBA 3W99B 3WAAD 4J8VB 1AOIB 5JA4A 3W99D 5AV9A 4JJNC 4ZUXD 5DNMB 5AVCC 1P3LB 4YM6D 1S32C 1ZLAA 3WKJB 5B2IC 3AZHD 3X1UD 5AV5A 1P3PA 1P3LD 1KU5A 3AZID 4H9OB 3WTPC 4J8UA 3REKB 3W98B 4KUDB 4WV4B 3KXBD 5B40C 4XZQB 3LZ0A 2F8NA 3REID 4H9SA 5CHLB 1KX4A 3W97D 4KGCD 2NQBB 1P3BA 3RELC 3B6FA 2NZDA 4G92C 1KX3A 1BH9B 4WU8A 4UUZA 1P3MC 5GSUC 2RVQC 5BS7C 4JJNA 1M18B 5CP6A 5B1LB 5E5AD 4J8UD 3AZKC 5AY8C 2L5AA 2HIOD 5G49B 1M19B 4H9PB 2CV5B 4LD9A 1KX4D 3KUYA 5KDMA 5AVBB 1P3BD 1KX3D 1WWSA 5DNNC 3TU4D 4J8WA 2F8NK 1P34C 3AV1C 1M1AC 1S32B 4JJND 1JFIA 2BYMA 4YS3B 1P3AB 5AV8A 5AVCD 2F8NH 4R8PC 5B2ID 1N1JB 4J8XC 1BH8A 4WNNA 3WTPD 5B40B 5B1MC 5BNXA 5B40D 4LD9D 3MGRC 5B32B 5B33A 5AV6B 1F66C 4G92B 4J8WD 4NE3A 3RELD 3MVDC 3MGPA 1P3MB 2PYOC 3NQJA 5B2JC 5F99A 1P3MD 5GSUD 2RVQD 1A7WA 3AZKB 1TAFB 3VH6W 5AY8B 3REHC 3AZKD 5AY8D 3AZJB 5GXQC 1U35C 3MGQC 1AOIC 3AFAC 4QLCB 1HQ3C 3UTAA 5DNMC 3AZGB 3WKJC 3C1CA 5CPJC 5B0ZB 5DNNB 3REKC 1P34B 4H9RA 3W98C 5DNND 4CSRB 1P34D 3AV1D 4XZQC 1M1AD 2F8NG 5B24B 4R8PB 3C1BC 2NQBC 3LZ1C 4G91C 4Z66A 4J8XD 3WAAA 3AZLB 4Z5TC 1KX5B 5CPKA 3W99A 3A6NB 5B1MD 4J8VA 4ZUXA 5B31C 3AZFC 4YM6A 1M18C 3KWQB 3AZHA 5B1LC 3X1UA 3MGRD 5DNMA 4WU9C 1P3LA 3AZIA 2BYKB 3MVDB 1P3OB 2YFWB 1F66D 3VH6T 3X1SB 3B0CW 3KXBA 3MVDD 4KUDA 5CPIC 2PYOD 1M19C 5B2JD 2CV5C 5AVBC 4KGCA 1U35B 3REHD 4XUJC 3MGQB 3AZEC 3UT9C 3AFAB 5CPKD 3AZNC 5GXQD 1HQ3B 1U35D 3MGQD 1P3KC 4J8VD 1AOID 3NQUB 3AFAD 1R4VA 1BH9A 1HQ3D 1HTAA 5CPJB 3B6GB 4YS3C 1B6WA 1P3AC 5E5AA 5DNMD 3LJAB 3AV2C 1ID3C 3WKJD 1M18A 3AYWB 5B1LA 3REKD 3W98D 4KUDD 2HIOA 4H9NB 4XZQD 5B32C 3C1BB 5JRGB 3LZ1B 4G91B 5AV6C 3C1BD 3AZMC 2NQBD 4Z5TB 5AVBA 3LELB 3TU4A 4Z5TD 5B31B 3AZFB 3B0CT 2LY8A 5B31D 4WU9B 5AVCA 1S32A 1M18D 5B2IA 5B1LD 1P3FC 4WU9D 3MGSB 3WTPA 3REJB 3AZJC 3AN2B 5CPIB 5B0YC 3VH5W 2AROC 4QLCC 5B40A 1M19D 3AZGC 2CV5D 3AZEB 4XUJB 4WZSB 5B0ZC 3UT9B 4Z2MH 5AVBD 3AZNB 4X23B 4XUJD 5AV5B 3RELA 3AZED 1P3KB 3UT9D 3B0BA 4H9QA 3AZND 1H3OA 3X1VC 5FUGB 1P3MA 5GSUA 3AV2B 5B24C 1S32D 5BS7A 1ID3B 4YS3D 1P3AD 5GT3C 3X1TC 3LZ0B 1ID3D 2F8NB 3AZKA 1TAFA 2FJ7B 5AY8A 3AZLC 1KX5C 2NZDB 3A6NC 4KHAB 4WU8B 3KWQC 5B32D 3AZMB 3AZGA 5AV6D 1P3OC 3AZMD 5C3IC 3X1SC 2YFVB 5DNNA 1P34A 3AV1A 1M1AA 3VH5T 5GT0C 1P3FB 5B24A 4R8PA 3UTBB 1P3FD 1TZYC 4J8XA 5B0YB 2AROB 3AZJD 5B0YD 5B1MA 4QLCD 3MNNC 3B6GC 4ZBJB 3KSYA 3MGRA 3AZGD 4Z2MG 3LJAC 2BYMB 3AYWC 5AV8B 5B0ZD 4CAYB 1F66A 1P3IC 1BFMA 3MVDA 3WA9C 3X1VB 2YFWA 1BH8B 1P3OA 3V9RA 2PYOA 3X1VD 5B2JA 5GT3B 5BNXB 3X1TB 5B24D 4R8PD 5JRGC 3O62C 3REHA 5B33B 3LELC 1U35A 5GXQA 3MGQA 3AZLD 1AOIA 3AFAA 1KX5D 1HQ3A 3MGPB 3A6ND 1B67A 5BO0B 3WKJA 5CPJA 3KWQD 5F99B 1EQZC 3MGSC 5C3IB 4H9OA 3REJC 3AN2C 3REKA 1P3OD 3W98A 3X1SD 3W96B 5GT0B 4XZQA 5AV9C 5GT0D 1TZYB 3C1BA 1ZLAC 3C1CB 1P3GB 5JRGA 3LZ1A 2NQBA 4X23C 5AV5C 1P3PC 4Z5TA 3MNNB 3LELA 4J8UC 4H9RB 3MNND 5B31A 3AZFA 5CPJD 3B6GD 1Q9CA 3LJAD 3LZ0C 4WU9A 1P3IB 4H9SC 3AYWD 2FJ7C 3WA9B 3VH6A 1P3BC 4Z66B 3B6FC 3WA9D 2NZDC 3WAAB 5CPIA 5G49A 1KX3C 4E45A 1M19A 4H9PA 4WU8C 3O62B 2CV5A 4ZUXB 3R45B 5JRGD 4YM6B 3LZ1D 3O62D 3B0DB 3AZHB 5CP6C 3X1UB 3AZEA 4XUJA 2HUEC 3LELD 5BNVB 3UT9A 3AZIB 3AZNA 4E44A 4X23A 1P3KA 3KXBB 3AZFD 5FUGA 4YS3A 1P3AA 1EQZB 5BT1C 3AV2A 1ID3A 1N1JA 3REIB 3UTBC 1EQZD 4LD9C 3KUYC 4NFTA 3WTPE 3MGSD 3W97B 4KGCB 3REJD 3AN2D 2FJ7A 5CPID 5JA4B 4J8WC 5AV9B 4ZBJC 5B32A 4KHAA 1ZLAB 5AV9D 5AV6A 5E5AB 4DRAA 5AV8C 1P3PB 3AZMA 1ZLAD 4J8UB 4X23D 1P3KD 5AV5D 1P3PD 2YFVA 2HIOB 3AV2D 1KX4B 4EO5B 1P3FA 5B33C 3LZ0D 2F8ND 1P3BB 2FJ7D 3UTBA 3AZJA 3B6FB 1KX3B 5B0YA 2AROA 4QLCA 3TU4B 3B6FD 2NZDD 3MGPC 4UUZB 4AWLC 4WU8D 4JJNB 2IO5C 5CP6B 5F99C 2HUEB 5AVCB 5B0ZA 5B2IB 5CP6D 4CAYA 3WTPB 4CSRA 3W96C 3X1VA 3UTAC 4LD9B 3KUYB 5BT1D 5GT3A 4HGAC 3X1TA 5KDMB 3C1CC 1P3GC 3UTBD 3KUYD 3AZLA 2AROD 4J8WB 1KX5A 3RELB 3A6NA 4H9QB 1ULYA 5B31G 1JFIB 1H3OB 3KWQA 5BO0A 5GSUB 2CWEA 2BYKA 5AV8D 1F1EA 4WNNB 3X1SA 4Z66C 3WAAC 5CPKC 3W99C 3W96A 5GT0A 4ZUXC 3VH5A 5GT3D 4J8VC 3X1TD 4YM6C 3B0DC 3AZHC 3X1UC 1TZYA 5B33D 1P3LC 3AZIC 1P3GA 3NQUA 3KXBC 3MNNA 4AWLB 3MGPD 3AV1B 3NQJB 4KUDC 2IO5B 3B6GA
chains in the Genus database with same CATH superfamily
4M6BA 1M1AB 3LJAA 5F99D 3REIC 3AYWA 3F6TA 3W97C 4KGCC 1P3IA 3WA9A 4J8XB 4H9NA 3UTAB 3W96D 5B1MB 4NE6A 5B32G 4HGAB 3UTAD 3O62A 1TZYD 5E5AC 3MGRB 3IP4C 3R45A 3C1CD 2JSSA 1P3GD 2VQRA 4NE5A 2JCHA 1F66B 5BNVA 2HIOC 3V9RB 2ZY4A 2PYOB 5B2JB 1KX4C 2ZY2A 4EO5C 1EQZA 3MGSA 1WWIA 1P3ID 3REIA 3REJA 3AN2A 1W2EA 3REHB 3W97A 3TU4C 5CPKB 4Z66D 5GXQB 4DRBA 3W99B 3WAAD 4J8VB 1AOIB 5JA4A 3W99D 5AV9A 4JJNC 4ZUXD 1Z2CB 5DNMB 5AVCC 1P3LB 4YM6D 1S32C 1ZLAA 3WKJB 5B2IC 3AZHD 3X1UD 5AV5A 1P3PA 1P3LD 1KU5A 3AZID 4H9OB 3WTPC 4J8UA 3REKB 3W98B 4KUDB 3EPKA 4WV4B 3KXBD 5B40C 4XZQB 3LZ0A 2F8NA 3REID 4H9SA 5CHLB 1KX4A 3W97D 4KGCD 2NQBB 1P3BA 3RELC 3B6FA 2NZDA 4G92C 1KX3A 1BH9B 4WU8A 3H0LC 4UUZA 1P3MC 5GSUC 2RVQC 2Y2NA 5BS7C 4JJNA 1M18B 5CP6A 5B1LB 2XD5A 5E5AD 2FFFB 4J8UD 3AZKC 5AY8C 3AL0C 2ZM5A 2L5AA 2HIOD 5G49B 3EG5B 1M19B 4H9PB 2CV5B 4LD9A 1KX4D 3KUYA 5KDMA 5AVBB 1P3BD 1KX3D 1WWSA 5DNNC 3TU4D 4J8WA 2F8NK 1P34C 3AV1C 1M1AC 1S32B 2ZY5A 4JJND 1JFIA 2BYMA 4YS3B 1P3AB 5AV8A 5AVCD 2F8NH 4R8PC 5B2ID 1N1JB 2XD1A 4J8XC 1BH8A 4WNNA 3WTPD 5B40B 5B1MC 5BNXA 5B40D 2J8PA 4LD9D 3MGRC 5B32B 5B33A 5AV6B 1F66C 4G92B 4J8WD 4NE3A 3RELD 1T3UA 3MVDC 3MGPA 1P3MB 2PYOC 2DQNC 3NQJA 5B2JC 5F99A 1P3MD 5GSUD 2RVQD 1A7WA 3AZKB 1TAFB 3VH6W 5AY8B 3REHC 3AZKD 5AY8D 3AZJB 5GXQC 1U35C 3MGQC 1AOIC 3AFAC 4QLCB 3KFUG 1HQ3C 3UTAA 5DNMC 3AZGB 3WKJC 3C1CA 5CPJC 5B0ZB 5DNNB 3REKC 1P34B 4H9RA 3W98C 5DNND 4CSRB 1P34D 3AV1D 4XZQC 1M1AD 2F8NG 5B24B 2BG1A 2G5HC 4R8PB 3C1BC 2NQBC 3LZ1C 4G91C 4Z66A 4J8XD 3WAAA 3AZLB 1PZRA 4Z5TC 3A1IA 5CPKA 1KX5B 3W99A 3A6NB 5B1MD 4J8VA 2UWXA 4ZUXA 5B31C 3AZFC 2W8SA 4YM6A 1M18C 3KWQB 3AZHA 5B1LC 3X1UA 3MGRD 5DNMA 4WU9C 1P3LA 3AZIA 2BYKB 3MVDB 1P3OB 2YFWB 1F66D 3VH6T 3X1SB 3B0CW 3KXBA 3MVDD 4KUDA 5CPIC 4WJ3C 2PYOD 1M19C 5B2JD 2CV5C 5AVBC 4KGCA 3H0RC 1U35B 3REHD 4XUJC 3MGQB 3AZEC 3UT9C 3AFAB 5CPKD 2RIQA 5GXQD 1HQ3B 3AZNC 3MGQD 1U35D 1P3KC 4J8VD 1AOID 3NQUB 3AFAD 1R4VA 1BH9A 1HQ3D 1HTAA 5CPJB 3B6GB 4YS3C 1B6WA 1P3AC 5E5AA 5DNMD 3LJAB 3AV2C 1ID3C 3WKJD 1M18A 3AYWB 5B1LA 3REKD 3W98D 4KUDD 2HIOA 4H9NB 4XZQD 5B32C 3C1BB 5JRGB 3LZ1B 4G91B 2ZY3A 5AV6C 3C1BD 3AZMC 2NQBD 4Z5TB 5AVBA 3LELB 3TU4A 4Z5TD 5B31B 3AZFB 3B0CT 2LY8A 2Y2IA 5B31D 4WU9B 5AVCA 1S32A 1M18D 5B2IA 5B1LD 1P3FC 4WU9D 3MGSB 3WTPA 3REJB 4DQYB 3AZJC 3AN2B 2Y2KA 5CPIB 5B0YC 3VH5W 2AROC 4QLCC 5B40A 1M19D 3AZGC 2CV5D 2Y2HA 3AZEB 4XUJB 4WZSB 5B0ZC 3UT9B 4Z2MH 5AVBD 3AZNB 4X23B 4XUJD 5AV5B 3RELA 3AZED 1P3KB 3UT9D 3B0BA 4H9QA 3AZND 1H3OA 3X1VC 5FUGB 2Y2JA 1P3MA 5GSUA 3AV2B 5B24C 1S32D 5BS7A 1ID3B 4YS3D 1P3AD 5GT3C 3X1TC 3LZ0B 1ID3D 2F8NB 3AZKA 1TAFA 2FJ7B 5AY8A 3AZLC 1KX5C 2NZDB 3A6NC 4KHAB 4WU8B 3KWQC 5B32D 3AZMB 3AZGA 5AV6D 1P3OC 3AZMD 5C3IC 3X1SC 2YFVB 5DNNA 1P34A 3AV1A 1M1AA 3VH5T 5GT0C 3EPJA 1P3FB 5B24A 4R8PA 3UTBB 1P3FD 1TZYC 4J8XA 5B0YB 2AROB 3AZJD 5B0YD 5B1MA 4QLCD 3MNNC 3B6GC 4ZBJB 3KSYA 3MGRA 3AZGD 4Z2MG 3LJAC 2BYMB 3AYWC 5AV8B 5B0ZD 4CAYB 1F66A 1P3IC 1BFMA 3MVDA 3WA9C 3X1VB 2YFWA 1BH8B 1P3OA 3V9RA 2PYOA 3X1VD 5B2JA 2Y2PA 5GT3B 5BNXB 3X1TB 5B24D 4R8PD 5JRGC 3O62C 3REHA 5B33B 3LELC 1U35A 5GXQA 3MGQA 3AZLD 1AOIA 3AFAA 1KX5D 1HQ3A 3MGPB 3A6ND 1B67A 5BO0B 3WKJA 5CPJA 3KWQD 5F99B 1EQZC 3MGSC 5C3IB 4H9OA 3REJC 3AN2C 3REKA 1P3OD 3W98A 3X1SD 3W96B 5GT0B 4XZQA 5AV9C 5GT0D 1TZYB 3C1BA 1ZLAC 3C1CB 1P3GB 2G5IC 5JRGA 3LZ1A 2NQBA 4X23C 5AV5C 1P3PC 2F2AC 4Z5TA 3MNNB 3LELA 4J8UC 4H9RB 3MNND 5B31A 3AZFA 5CPJD 3B6GD 1Q9CA 2Y2GA 3LJAD 3LZ0C 4WU9A 1P3IB 4H9SC 3AYWD 2FJ7C 3WA9B 3VH6A 1P3BC 4Z66B 3B6FC 3WA9D 2NZDC 3WAAB 5CPIA 5G49A 1KX3C 4E45A 1M19A 4H9PA 4WU8C 3O62B 2CV5A 4ZUXB 3R45B 5JRGD 4YM6B 3LZ1D 2Y2LA 3B0DB 3O62D 5CP6C 3X1UB 3AZHB 3AZEA 4XUJA 2HUEC 3LELD 5BNVB 3UT9A 3AZIB 3AZNA 3FDDA 4E44A 4X23A 1P3KA 3KXBB 3AZFD 5FUGA 4YS3A 1P3AA 2DF4C 1EQZB 5BT1C 3AV2A 1ID3A 1N1JA 3REIB 3UTBC 1EQZD 4LD9C 3KUYC 4NFTA 3WTPE 3MGSD 3W97B 4KGCB 3REJD 3AN2D 2FJ7A 3A1KA 5CPID 2Y2OA 5JA4B 4J8WC 5AV9B 4ZBJC 5B32A 4KHAA 1ZLAB 5AV9D 5AV6A 5E5AB 4DRAA 5AV8C 1P3PB 3AZMA 1ZLAD 4J8UB 4X23D 1P3KD 5AV5D 1P3PD 2YFVA 4UPKA 2HIOB 3AV2D 1KX4B 4EO5B 1P3FA 5B33C 3LZ0D 2F8ND 1P3BB 2FJ7D 3UTBA 3AZJA 3B6FB 1KX3B 5B0YA 2AROA 4QLCA 3TU4B 3B6FD 2NZDD 3MGPC 4UUZB 4AWLC 4WU8D 4JJNB 2IO5C 5CP6B 5F99C 2HUEB 5AVCB 5B0ZA 5B2IB 5CP6D 4CAYA 3EPHA 3WTPB 2JE5A 4CSRA 3W96C 3X1VA 3EPLA 3UTAC 4LD9B 3KUYB 5BT1D 5GT3A 4HGAC 3X1TA 5KDMB 3C1CC 1P3GC 3UTBD 3KUYD 3AZLA 2AROD 4J8WB 1KX5A 3RELB 3A6NA 1ULYA 4H9QB 5B31G 1JFIB 1H3OB 3H0MC 3KWQA 5BO0A 5GSUB 2CWEA 2BYKA 5AV8D 1F1EA 4WNNB 3X1SA 4Z66C 3WAAC 5CPKC 3W99C 3W96A 5GT0A 4ZUXC 3VH5A 5GT3D 4J8VC 3X1TD 4YM6C 3B0DC 3AZHC 3X1UC 1TZYA 5B33D 1P3LC 3AZIC 1P3GA 3NQUA 3KXBC 3MNNA 4AWLB 3MGPD 3P5JB 2Y2MA 3NQJB 3AV1B 4KUDC 2IO5B 3B6GA 2Y2QA
chains in the Genus database with same CATH topology
4M6BA 1M1AB 3LJAA 5F99D 3REIC 3AYWA 3F6TA 3W97C 4KGCC 1P3IA 3WA9A 4J8XB 4H9NA 3UTAB 3W96D 5B1MB 4NE6A 5B32G 4HGAB 3UTAD 3O62A 1TZYD 5E5AC 3MGRB 3IP4C 3R45A 3C1CD 2JSSA 1P3GD 2VQRA 4NE5A 2JCHA 1F66B 5BNVA 2HIOC 3V9RB 2ZY4A 2PYOB 5B2JB 1KX4C 2ZY2A 4EO5C 1EQZA 3MGSA 1WWIA 1P3ID 3REIA 3REJA 3AN2A 1W2EA 3REHB 3W97A 3TU4C 5CPKB 4Z66D 5GXQB 4DRBA 3W99B 3WAAD 4J8VB 1AOIB 5JA4A 3W99D 5AV9A 4JJNC 4ZUXD 1Z2CB 5DNMB 5AVCC 1P3LB 4YM6D 1S32C 1ZLAA 3WKJB 5B2IC 3AZHD 3X1UD 5AV5A 1P3PA 1P3LD 1KU5A 3AZID 4H9OB 3WTPC 4J8UA 3REKB 3W98B 4KUDB 3EPKA 4WV4B 3KXBD 5B40C 4XZQB 3LZ0A 2F8NA 3REID 4H9SA 5CHLB 1KX4A 3W97D 4KGCD 2NQBB 1P3BA 3RELC 3B6FA 2NZDA 4G92C 1KX3A 1BH9B 4WU8A 3H0LC 4UUZA 1P3MC 5GSUC 2RVQC 2Y2NA 5BS7C 4JJNA 1M18B 5CP6A 5B1LB 2XD5A 5E5AD 2FFFB 4J8UD 3AZKC 5AY8C 3AL0C 2ZM5A 2L5AA 2HIOD 5G49B 3EG5B 1M19B 4H9PB 2CV5B 4LD9A 1KX4D 3KUYA 5KDMA 5AVBB 1P3BD 1KX3D 1WWSA 5DNNC 3TU4D 4J8WA 2F8NK 1P34C 3AV1C 1M1AC 1S32B 2ZY5A 4JJND 1JFIA 2BYMA 4YS3B 1P3AB 5AV8A 5AVCD 2F8NH 4R8PC 5B2ID 1N1JB 2XD1A 4J8XC 1BH8A 4WNNA 3WTPD 5B40B 5B1MC 5BNXA 5B40D 2J8PA 4LD9D 3MGRC 5B32B 5B33A 5AV6B 1F66C 4G92B 4J8WD 4NE3A 3RELD 1T3UA 3MVDC 3MGPA 1P3MB 2PYOC 2DQNC 3NQJA 5B2JC 5F99A 1P3MD 5GSUD 2RVQD 1A7WA 3AZKB 1TAFB 3VH6W 5AY8B 3REHC 3AZKD 5AY8D 3AZJB 5GXQC 1U35C 3MGQC 1AOIC 3AFAC 4QLCB 3KFUG 1HQ3C 3UTAA 5DNMC 3AZGB 3WKJC 3C1CA 5CPJC 5B0ZB 5DNNB 3REKC 1P34B 4H9RA 3W98C 5DNND 4CSRB 1P34D 3AV1D 4XZQC 1M1AD 2F8NG 5B24B 2BG1A 2G5HC 4R8PB 3C1BC 2NQBC 3LZ1C 4G91C 4Z66A 4J8XD 3WAAA 3AZLB 1PZRA 4Z5TC 3A1IA 5CPKA 1KX5B 3W99A 3A6NB 5B1MD 4J8VA 2UWXA 4ZUXA 5B31C 3AZFC 2W8SA 4YM6A 1M18C 3KWQB 3AZHA 5B1LC 3X1UA 3MGRD 5DNMA 4WU9C 1P3LA 3AZIA 2BYKB 3MVDB 1P3OB 2YFWB 1F66D 3VH6T 3X1SB 3B0CW 3KXBA 3MVDD 4KUDA 5CPIC 4WJ3C 2PYOD 1M19C 5B2JD 2CV5C 5AVBC 4KGCA 3H0RC 1U35B 3REHD 4XUJC 3MGQB 3AZEC 3UT9C 3AFAB 5CPKD 2RIQA 5GXQD 1HQ3B 3AZNC 3MGQD 1U35D 1P3KC 4J8VD 1AOID 3NQUB 3AFAD 1R4VA 1BH9A 1HQ3D 1HTAA 5CPJB 3B6GB 4YS3C 1B6WA 1P3AC 5E5AA 5DNMD 3LJAB 3AV2C 1ID3C 3WKJD 1M18A 3AYWB 5B1LA 3REKD 3W98D 4KUDD 2HIOA 4H9NB 4XZQD 5B32C 3C1BB 5JRGB 3LZ1B 4G91B 2ZY3A 5AV6C 3C1BD 3AZMC 2NQBD 4Z5TB 5AVBA 3LELB 3TU4A 4Z5TD 5B31B 3AZFB 3B0CT 2LY8A 2Y2IA 5B31D 4WU9B 5AVCA 1S32A 1M18D 5B2IA 5B1LD 1P3FC 4WU9D 3MGSB 3WTPA 3REJB 4DQYB 3AZJC 3AN2B 2Y2KA 5CPIB 5B0YC 3VH5W 2AROC 4QLCC 5B40A 1M19D 3AZGC 2CV5D 2Y2HA 3AZEB 4XUJB 4WZSB 5B0ZC 3UT9B 4Z2MH 5AVBD 3AZNB 4X23B 4XUJD 5AV5B 3RELA 3AZED 1P3KB 3UT9D 3B0BA 4H9QA 3AZND 1H3OA 3X1VC 5FUGB 2Y2JA 1P3MA 5GSUA 3AV2B 5B24C 1S32D 5BS7A 1ID3B 4YS3D 1P3AD 5GT3C 3X1TC 3LZ0B 1ID3D 2F8NB 3AZKA 1TAFA 2FJ7B 5AY8A 3AZLC 1KX5C 2NZDB 3A6NC 4KHAB 4WU8B 3KWQC 5B32D 3AZMB 3AZGA 5AV6D 1P3OC 3AZMD 5C3IC 3X1SC 2YFVB 5DNNA 1P34A 3AV1A 1M1AA 3VH5T 5GT0C 3EPJA 1P3FB 5B24A 4R8PA 3UTBB 1P3FD 1TZYC 4J8XA 5B0YB 2AROB 3AZJD 5B0YD 5B1MA 4QLCD 3MNNC 3B6GC 4ZBJB 3KSYA 3MGRA 3AZGD 4Z2MG 3LJAC 2BYMB 3AYWC 5AV8B 5B0ZD 4CAYB 1F66A 1P3IC 1BFMA 3MVDA 3WA9C 3X1VB 2YFWA 1BH8B 1P3OA 3V9RA 2PYOA 3X1VD 5B2JA 2Y2PA 5GT3B 5BNXB 3X1TB 5B24D 4R8PD 5JRGC 3O62C 3REHA 5B33B 3LELC 1U35A 5GXQA 3MGQA 3AZLD 1AOIA 3AFAA 1KX5D 1HQ3A 3MGPB 3A6ND 1B67A 5BO0B 3WKJA 5CPJA 3KWQD 5F99B 1EQZC 3MGSC 5C3IB 4H9OA 3REJC 3AN2C 3REKA 1P3OD 3W98A 3X1SD 3W96B 5GT0B 4XZQA 5AV9C 5GT0D 1TZYB 3C1BA 1ZLAC 3C1CB 1P3GB 2G5IC 5JRGA 3LZ1A 2NQBA 4X23C 5AV5C 1P3PC 2F2AC 4Z5TA 3MNNB 3LELA 4J8UC 4H9RB 3MNND 5B31A 3AZFA 5CPJD 3B6GD 1Q9CA 2Y2GA 3LJAD 3LZ0C 4WU9A 1P3IB 4H9SC 3AYWD 2FJ7C 3WA9B 3VH6A 1P3BC 4Z66B 3B6FC 3WA9D 2NZDC 3WAAB 5CPIA 5G49A 1KX3C 4E45A 1M19A 4H9PA 4WU8C 3O62B 2CV5A 4ZUXB 3R45B 5JRGD 4YM6B 3LZ1D 2Y2LA 3B0DB 3O62D 5CP6C 3X1UB 3AZHB 3AZEA 4XUJA 2HUEC 3LELD 5BNVB 3UT9A 3AZIB 3AZNA 3FDDA 4E44A 4X23A 1P3KA 3KXBB 3AZFD 5FUGA 4YS3A 1P3AA 2DF4C 1EQZB 5BT1C 3AV2A 1ID3A 1N1JA 3REIB 3UTBC 1EQZD 4LD9C 3KUYC 4NFTA 3WTPE 3MGSD 3W97B 4KGCB 3REJD 3AN2D 2FJ7A 3A1KA 5CPID 2Y2OA 5JA4B 4J8WC 5AV9B 4ZBJC 5B32A 4KHAA 1ZLAB 5AV9D 5AV6A 5E5AB 4DRAA 5AV8C 1P3PB 3AZMA 1ZLAD 4J8UB 4X23D 1P3KD 5AV5D 1P3PD 2YFVA 4UPKA 2HIOB 3AV2D 1KX4B 4EO5B 1P3FA 5B33C 3LZ0D 2F8ND 1P3BB 2FJ7D 3UTBA 3AZJA 3B6FB 1KX3B 5B0YA 2AROA 4QLCA 3TU4B 3B6FD 2NZDD 3MGPC 4UUZB 4AWLC 4WU8D 4JJNB 2IO5C 5CP6B 5F99C 2HUEB 5AVCB 5B0ZA 5B2IB 5CP6D 4CAYA 3EPHA 3WTPB 2JE5A 4CSRA 3W96C 3X1VA 3EPLA 3UTAC 4LD9B 3KUYB 5BT1D 5GT3A 4HGAC 3X1TA 5KDMB 3C1CC 1P3GC 3UTBD 3KUYD 3AZLA 2AROD 4J8WB 1KX5A 3RELB 3A6NA 1ULYA 4H9QB 5B31G 1JFIB 1H3OB 3H0MC 3KWQA 5BO0A 5GSUB 2CWEA 2BYKA 5AV8D 1F1EA 4WNNB 3X1SA 4Z66C 3WAAC 5CPKC 3W99C 3W96A 5GT0A 4ZUXC 3VH5A 5GT3D 4J8VC 3X1TD 4YM6C 3B0DC 3AZHC 3X1UC 1TZYA 5B33D 1P3LC 3AZIC 1P3GA 3NQUA 3KXBC 3MNNA 4AWLB 3MGPD 3P5JB 2Y2MA 3NQJB 3AV1B 4KUDC 2IO5B 3B6GA 2Y2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  1M1A B;  3LJA A;  5F99 D;  3REI C;  3AYW A;  3W97 C;  4KGC C;  1P3I A;  3WA9 A;  4J8X B;  4H9N A;  3UTA B;  3W96 D;  5B1M B;  4NE6 A;  5B32 G;  4HGA B;  3UTA D;  3O62 A;  1TZY D;  5E5A C;  3MGR B;  3R45 A;  3C1C D;  2JSS A;  1P3G D;  4NE5 A;  1F66 B;  5BNV A;  2HIO C;  3V9R B;  2PYO B;  5B2J B;  1KX4 C;  4EO5 C;  1EQZ A;  3MGS A;  1WWI A;  1P3I D;  3REI A;  3REJ A;  3AN2 A;  3REH B;  3W97 A;  3TU4 C;  5CPK B;  4Z66 D;  5GXQ B;  4DRB A;  3W99 B;  3WAA D;  4J8V B;  1AOI B;  5JA4 A;  3W99 D;  5AV9 A;  4JJN C;  4ZUX D;  5DNM B;  5AVC C;  1P3L B;  4YM6 D;  1S32 C;  1ZLA A;  3WKJ B;  5B2I C;  3AZH D;  3X1U D;  5AV5 A;  1P3P A;  1P3L D;  1KU5 A;  3AZI D;  4H9O B;  3WTP C;  4J8U A;  3REK B;  3W98 B;  4KUD B;  4WV4 B;  3KXB D;  5B40 C;  4XZQ B;  3LZ0 A;  2F8N A;  3REI D;  4H9S A;  5CHL B;  1KX4 A;  3W97 D;  4KGC D;  2NQB B;  1P3B A;  3REL C;  3B6F A;  2NZD A;  4G92 C;  1KX3 A;  1BH9 B;  4WU8 A;  4UUZ A;  1P3M C;  5GSU C;  2RVQ C;  5BS7 C;  4JJN A;  1M18 B;  5CP6 A;  5B1L B;  5E5A D;  4J8U D;  3AZK C;  5AY8 C;  2L5A A;  2HIO D;  5G49 B;  1M19 B;  4H9P B;  2CV5 B;  4LD9 A;  1KX4 D;  3KUY A;  5KDM A;  5AVB B;  1P3B D;  1KX3 D;  1WWS A;  5DNN C;  3TU4 D;  4J8W A;  2F8N K;  1P34 C;  3AV1 C;  1M1A C;  1S32 B;  4JJN D;  1JFI A;  2BYM A;  4YS3 B;  1P3A B;  5AV8 A;  5AVC D;  2F8N H;  4R8P C;  5B2I D;  1N1J B;  4J8X C;  1BH8 A;  4WNN A;  3WTP D;  5B40 B;  5B1M C;  5BNX A;  5B40 D;  4LD9 D;  3MGR C;  5B32 B;  5B33 A;  5AV6 B;  1F66 C;  4G92 B;  4J8W D;  4NE3 A;  3REL D;  3MVD C;  3MGP A;  1P3M B;  2PYO C;  3NQJ A;  5B2J C;  5F99 A;  1P3M D;  5GSU D;  2RVQ D;  1A7W A;  3AZK B;  1TAF B;  3VH6 W;  5AY8 B;  3REH C;  3AZK D;  5AY8 D;  3AZJ B;  5GXQ C;  1U35 C;  3MGQ C;  1AOI C;  3AFA C;  4QLC B;  1HQ3 C;  3UTA A;  5DNM C;  3AZG B;  3WKJ C;  3C1C A;  5CPJ C;  5B0Z B;  5DNN B;  3REK C;  1P34 B;  4H9R A;  3W98 C;  5DNN D;  4CSR B;  1P34 D;  3AV1 D;  4XZQ C;  1M1A D;  2F8N G;  5B24 B;  4R8P B;  3C1B C;  2NQB C;  3LZ1 C;  4G91 C;  4Z66 A;  4J8X D;  3WAA A;  3AZL B;  4Z5T C;  1KX5 B;  5CPK A;  3W99 A;  3A6N B;  5B1M D;  4J8V A;  4ZUX A;  5B31 C;  3AZF C;  4YM6 A;  1M18 C;  3KWQ B;  3AZH A;  5B1L C;  3X1U A;  3MGR D;  5DNM A;  4WU9 C;  1P3L A;  3AZI A;  2BYK B;  3MVD B;  1P3O B;  2YFW B;  1F66 D;  3VH6 T;  3X1S B;  3B0C W;  3KXB A;  3MVD D;  4KUD A;  5CPI C;  2PYO D;  1M19 C;  5B2J D;  2CV5 C;  5AVB C;  4KGC A;  1U35 B;  3REH D;  4XUJ C;  3MGQ B;  3AZE C;  3UT9 C;  3AFA B;  5CPK D;  3AZN C;  5GXQ D;  1HQ3 B;  1U35 D;  3MGQ D;  1P3K C;  4J8V D;  1AOI D;  3NQU B;  3AFA D;  1R4V A;  1BH9 A;  1HQ3 D;  1HTA A;  5CPJ B;  3B6G B;  4YS3 C;  1B6W A;  1P3A C;  5E5A A;  5DNM D;  3LJA B;  3AV2 C;  1ID3 C;  3WKJ D;  1M18 A;  3AYW B;  5B1L A;  3REK D;  3W98 D;  4KUD D;  2HIO A;  4H9N B;  4XZQ D;  5B32 C;  3C1B B;  5JRG B;  3LZ1 B;  4G91 B;  5AV6 C;  3C1B D;  3AZM C;  2NQB D;  4Z5T B;  5AVB A;  3LEL B;  3TU4 A;  4Z5T D;  5B31 B;  3AZF B;  3B0C T;  2LY8 A;  5B31 D;  4WU9 B;  5AVC A;  1S32 A;  1M18 D;  5B2I A;  5B1L D;  1P3F C;  4WU9 D;  3MGS B;  3WTP A;  3REJ B;  3AZJ C;  3AN2 B;  5CPI B;  5B0Y C;  3VH5 W;  2ARO C;  4QLC C;  5B40 A;  1M19 D;  3AZG C;  2CV5 D;  3AZE B;  4XUJ B;  4WZS B;  5B0Z C;  3UT9 B;  4Z2M H;  5AVB D;  3AZN B;  4X23 B;  4XUJ D;  5AV5 B;  3REL A;  3AZE D;  1P3K B;  3UT9 D;  3B0B A;  4H9Q A;  3AZN D;  1H3O A;  3X1V C;  5FUG B;  1P3M A;  5GSU A;  3AV2 B;  5B24 C;  1S32 D;  5BS7 A;  1ID3 B;  4YS3 D;  1P3A D;  5GT3 C;  3X1T C;  3LZ0 B;  1ID3 D;  2F8N B;  3AZK A;  1TAF A;  2FJ7 B;  5AY8 A;  3AZL C;  1KX5 C;  2NZD B;  3A6N C;  4KHA B;  4WU8 B;  3KWQ C;  5B32 D;  3AZM B;  3AZG A;  5AV6 D;  1P3O C;  3AZM D;  5C3I C;  3X1S C;  2YFV B;  5DNN A;  1P34 A;  3AV1 A;  1M1A A;  3VH5 T;  5GT0 C;  1P3F B;  5B24 A;  4R8P A;  3UTB B;  1P3F D;  1TZY C;  4J8X A;  5B0Y B;  2ARO B;  3AZJ D;  5B0Y D;  5B1M A;  4QLC D;  3MNN C;  3B6G C;  4ZBJ B;  3KSY A;  3MGR A;  3AZG D;  4Z2M G;  3LJA C;  2BYM B;  3AYW C;  5AV8 B;  5B0Z D;  4CAY B;  1F66 A;  1P3I C;  1BFM A;  3MVD A;  3WA9 C;  3X1V B;  2YFW A;  1BH8 B;  1P3O A;  3V9R A;  2PYO A;  3X1V D;  5B2J A;  5GT3 B;  5BNX B;  3X1T B;  5B24 D;  4R8P D;  5JRG C;  3O62 C;  3REH A;  5B33 B;  3LEL C;  1U35 A;  5GXQ A;  3MGQ A;  3AZL D;  1AOI A;  3AFA A;  1KX5 D;  1HQ3 A;  3MGP B;  3A6N D;  1B67 A;  5BO0 B;  3WKJ A;  5CPJ A;  3KWQ D;  5F99 B;  1EQZ C;  3MGS C;  5C3I B;  4H9O A;  3REJ C;  3AN2 C;  3REK A;  1P3O D;  3W98 A;  3X1S D;  3W96 B;  5GT0 B;  4XZQ A;  5AV9 C;  5GT0 D;  1TZY B;  3C1B A;  1ZLA C;  3C1C B;  1P3G B;  5JRG A;  3LZ1 A;  2NQB A;  4X23 C;  5AV5 C;  1P3P C;  4Z5T A;  3MNN B;  3LEL A;  4J8U C;  4H9R B;  3MNN D;  5B31 A;  3AZF A;  5CPJ D;  3B6G D;  1Q9C A;  3LJA D;  3LZ0 C;  4WU9 A;  1P3I B;  4H9S C;  3AYW D;  2FJ7 C;  3WA9 B;  3VH6 A;  1P3B C;  4Z66 B;  3B6F C;  3WA9 D;  2NZD C;  3WAA B;  5CPI A;  5G49 A;  1KX3 C;  4E45 A;  1M19 A;  4H9P A;  4WU8 C;  3O62 B;  2CV5 A;  4ZUX B;  3R45 B;  5JRG D;  4YM6 B;  3LZ1 D;  3O62 D;  3B0D B;  3AZH B;  5CP6 C;  3X1U B;  3AZE A;  4XUJ A;  2HUE C;  3LEL D;  5BNV B;  3UT9 A;  3AZI B;  3AZN A;  4E44 A;  4X23 A;  1P3K A;  3KXB B;  3AZF D;  5FUG A;  4YS3 A;  1P3A A;  1EQZ B;  5BT1 C;  3AV2 A;  1ID3 A;  1N1J A;  3REI B;  3UTB C;  1EQZ D;  4LD9 C;  3KUY C;  4NFT A;  3WTP E;  3MGS D;  3W97 B;  4KGC B;  3REJ D;  3AN2 D;  2FJ7 A;  5CPI D;  5JA4 B;  4J8W C;  5AV9 B;  4ZBJ C;  5B32 A;  4KHA A;  1ZLA B;  5AV9 D;  5AV6 A;  5E5A B;  4DRA A;  5AV8 C;  1P3P B;  3AZM A;  1ZLA D;  4J8U B;  4X23 D;  1P3K D;  5AV5 D;  1P3P D;  2YFV A;  2HIO B;  3AV2 D;  1KX4 B;  4EO5 B;  1P3F A;  5B33 C;  3LZ0 D;  2F8N D;  1P3B B;  2FJ7 D;  3UTB A;  3AZJ A;  3B6F B;  1KX3 B;  5B0Y A;  2ARO A;  4QLC A;  3TU4 B;  3B6F D;  2NZD D;  3MGP C;  4UUZ B;  4AWL C;  4WU8 D;  4JJN B;  2IO5 C;  5CP6 B;  5F99 C;  2HUE B;  5AVC B;  5B0Z A;  5B2I B;  5CP6 D;  4CAY A;  3WTP B;  4CSR A;  3W96 C;  3X1V A;  3UTA C;  4LD9 B;  3KUY B;  5BT1 D;  5GT3 A;  4HGA C;  3X1T A;  5KDM B;  3C1C C;  1P3G C;  3UTB D;  3KUY D;  3AZL A;  2ARO D;  4J8W B;  1KX5 A;  3REL B;  3A6N A;  4H9Q B;  1ULY A;  5B31 G;  1JFI B;  1H3O B;  3KWQ A;  5BO0 A;  5GSU B;  2CWE A;  2BYK A;  5AV8 D;  1F1E A;  4WNN B;  3X1S A;  4Z66 C;  3WAA C;  5CPK C;  3W99 C;  3W96 A;  5GT0 A;  4ZUX C;  3VH5 A;  5GT3 D;  4J8V C;  3X1T D;  4YM6 C;  3B0D C;  3AZH C;  3X1U C;  1TZY A;  5B33 D;  1P3L C;  3AZI C;  1P3G A;  3NQU A;  3KXB C;  3MNN A;  4AWL B;  3MGP D;  3AV1 B;  3NQJ B;  4KUD C;  2IO5 B;  3B6G A; 
#chains in the Genus database with same CATH topology
 4M6B A;  1M1A B;  3LJA A;  5F99 D;  3REI C;  3AYW A;  3F6T A;  3W97 C;  4KGC C;  1P3I A;  3WA9 A;  4J8X B;  4H9N A;  3UTA B;  3W96 D;  5B1M B;  4NE6 A;  5B32 G;  4HGA B;  3UTA D;  3O62 A;  1TZY D;  5E5A C;  3MGR B;  3IP4 C;  3R45 A;  3C1C D;  2JSS A;  1P3G D;  2VQR A;  4NE5 A;  2JCH A;  1F66 B;  5BNV A;  2HIO C;  3V9R B;  2ZY4 A;  2PYO B;  5B2J B;  1KX4 C;  2ZY2 A;  4EO5 C;  1EQZ A;  3MGS A;  1WWI A;  1P3I D;  3REI A;  3REJ A;  3AN2 A;  1W2E A;  3REH B;  3W97 A;  3TU4 C;  5CPK B;  4Z66 D;  5GXQ B;  4DRB A;  3W99 B;  3WAA D;  4J8V B;  1AOI B;  5JA4 A;  3W99 D;  5AV9 A;  4JJN C;  4ZUX D;  1Z2C B;  5DNM B;  5AVC C;  1P3L B;  4YM6 D;  1S32 C;  1ZLA A;  3WKJ B;  5B2I C;  3AZH D;  3X1U D;  5AV5 A;  1P3P A;  1P3L D;  1KU5 A;  3AZI D;  4H9O B;  3WTP C;  4J8U A;  3REK B;  3W98 B;  4KUD B;  3EPK A;  4WV4 B;  3KXB D;  5B40 C;  4XZQ B;  3LZ0 A;  2F8N A;  3REI D;  4H9S A;  5CHL B;  1KX4 A;  3W97 D;  4KGC D;  2NQB B;  1P3B A;  3REL C;  3B6F A;  2NZD A;  4G92 C;  1KX3 A;  1BH9 B;  4WU8 A;  3H0L C;  4UUZ A;  1P3M C;  5GSU C;  2RVQ C;  2Y2N A;  5BS7 C;  4JJN A;  1M18 B;  5CP6 A;  5B1L B;  2XD5 A;  5E5A D;  2FFF B;  4J8U D;  3AZK C;  5AY8 C;  3AL0 C;  2ZM5 A;  2L5A A;  2HIO D;  5G49 B;  3EG5 B;  1M19 B;  4H9P B;  2CV5 B;  4LD9 A;  1KX4 D;  3KUY A;  5KDM A;  5AVB B;  1P3B D;  1KX3 D;  1WWS A;  5DNN C;  3TU4 D;  4J8W A;  2F8N K;  1P34 C;  3AV1 C;  1M1A C;  1S32 B;  2ZY5 A;  4JJN D;  1JFI A;  2BYM A;  4YS3 B;  1P3A B;  5AV8 A;  5AVC D;  2F8N H;  4R8P C;  5B2I D;  1N1J B;  2XD1 A;  4J8X C;  1BH8 A;  4WNN A;  3WTP D;  5B40 B;  5B1M C;  5BNX A;  5B40 D;  2J8P A;  4LD9 D;  3MGR C;  5B32 B;  5B33 A;  5AV6 B;  1F66 C;  4G92 B;  4J8W D;  4NE3 A;  3REL D;  1T3U A;  3MVD C;  3MGP A;  1P3M B;  2PYO C;  2DQN C;  3NQJ A;  5B2J C;  5F99 A;  1P3M D;  5GSU D;  2RVQ D;  1A7W A;  3AZK B;  1TAF B;  3VH6 W;  5AY8 B;  3REH C;  3AZK D;  5AY8 D;  3AZJ B;  5GXQ C;  1U35 C;  3MGQ C;  1AOI C;  3AFA C;  4QLC B;  3KFU G;  1HQ3 C;  3UTA A;  5DNM C;  3AZG B;  3WKJ C;  3C1C A;  5CPJ C;  5B0Z B;  5DNN B;  3REK C;  1P34 B;  4H9R A;  3W98 C;  5DNN D;  4CSR B;  1P34 D;  3AV1 D;  4XZQ C;  1M1A D;  2F8N G;  5B24 B;  2BG1 A;  2G5H C;  4R8P B;  3C1B C;  2NQB C;  3LZ1 C;  4G91 C;  4Z66 A;  4J8X D;  3WAA A;  3AZL B;  1PZR A;  4Z5T C;  3A1I A;  5CPK A;  1KX5 B;  3W99 A;  3A6N B;  5B1M D;  4J8V A;  2UWX A;  4ZUX A;  5B31 C;  3AZF C;  2W8S A;  4YM6 A;  1M18 C;  3KWQ B;  3AZH A;  5B1L C;  3X1U A;  3MGR D;  5DNM A;  4WU9 C;  1P3L A;  3AZI A;  2BYK B;  3MVD B;  1P3O B;  2YFW B;  1F66 D;  3VH6 T;  3X1S B;  3B0C W;  3KXB A;  3MVD D;  4KUD A;  5CPI C;  4WJ3 C;  2PYO D;  1M19 C;  5B2J D;  2CV5 C;  5AVB C;  4KGC A;  3H0R C;  1U35 B;  3REH D;  4XUJ C;  3MGQ B;  3AZE C;  3UT9 C;  3AFA B;  5CPK D;  2RIQ A;  5GXQ D;  1HQ3 B;  3AZN C;  3MGQ D;  1U35 D;  1P3K C;  4J8V D;  1AOI D;  3NQU B;  3AFA D;  1R4V A;  1BH9 A;  1HQ3 D;  1HTA A;  5CPJ B;  3B6G B;  4YS3 C;  1B6W A;  1P3A C;  5E5A A;  5DNM D;  3LJA B;  3AV2 C;  1ID3 C;  3WKJ D;  1M18 A;  3AYW B;  5B1L A;  3REK D;  3W98 D;  4KUD D;  2HIO A;  4H9N B;  4XZQ D;  5B32 C;  3C1B B;  5JRG B;  3LZ1 B;  4G91 B;  2ZY3 A;  5AV6 C;  3C1B D;  3AZM C;  2NQB D;  4Z5T B;  5AVB A;  3LEL B;  3TU4 A;  4Z5T D;  5B31 B;  3AZF B;  3B0C T;  2LY8 A;  2Y2I A;  5B31 D;  4WU9 B;  5AVC A;  1S32 A;  1M18 D;  5B2I A;  5B1L D;  1P3F C;  4WU9 D;  3MGS B;  3WTP A;  3REJ B;  4DQY B;  3AZJ C;  3AN2 B;  2Y2K A;  5CPI B;  5B0Y C;  3VH5 W;  2ARO C;  4QLC C;  5B40 A;  1M19 D;  3AZG C;  2CV5 D;  2Y2H A;  3AZE B;  4XUJ B;  4WZS B;  5B0Z C;  3UT9 B;  4Z2M H;  5AVB D;  3AZN B;  4X23 B;  4XUJ D;  5AV5 B;  3REL A;  3AZE D;  1P3K B;  3UT9 D;  3B0B A;  4H9Q A;  3AZN D;  1H3O A;  3X1V C;  5FUG B;  2Y2J A;  1P3M A;  5GSU A;  3AV2 B;  5B24 C;  1S32 D;  5BS7 A;  1ID3 B;  4YS3 D;  1P3A D;  5GT3 C;  3X1T C;  3LZ0 B;  1ID3 D;  2F8N B;  3AZK A;  1TAF A;  2FJ7 B;  5AY8 A;  3AZL C;  1KX5 C;  2NZD B;  3A6N C;  4KHA B;  4WU8 B;  3KWQ C;  5B32 D;  3AZM B;  3AZG A;  5AV6 D;  1P3O C;  3AZM D;  5C3I C;  3X1S C;  2YFV B;  5DNN A;  1P34 A;  3AV1 A;  1M1A A;  3VH5 T;  5GT0 C;  3EPJ A;  1P3F B;  5B24 A;  4R8P A;  3UTB B;  1P3F D;  1TZY C;  4J8X A;  5B0Y B;  2ARO B;  3AZJ D;  5B0Y D;  5B1M A;  4QLC D;  3MNN C;  3B6G C;  4ZBJ B;  3KSY A;  3MGR A;  3AZG D;  4Z2M G;  3LJA C;  2BYM B;  3AYW C;  5AV8 B;  5B0Z D;  4CAY B;  1F66 A;  1P3I C;  1BFM A;  3MVD A;  3WA9 C;  3X1V B;  2YFW A;  1BH8 B;  1P3O A;  3V9R A;  2PYO A;  3X1V D;  5B2J A;  2Y2P A;  5GT3 B;  5BNX B;  3X1T B;  5B24 D;  4R8P D;  5JRG C;  3O62 C;  3REH A;  5B33 B;  3LEL C;  1U35 A;  5GXQ A;  3MGQ A;  3AZL D;  1AOI A;  3AFA A;  1KX5 D;  1HQ3 A;  3MGP B;  3A6N D;  1B67 A;  5BO0 B;  3WKJ A;  5CPJ A;  3KWQ D;  5F99 B;  1EQZ C;  3MGS C;  5C3I B;  4H9O A;  3REJ C;  3AN2 C;  3REK A;  1P3O D;  3W98 A;  3X1S D;  3W96 B;  5GT0 B;  4XZQ A;  5AV9 C;  5GT0 D;  1TZY B;  3C1B A;  1ZLA C;  3C1C B;  1P3G B;  2G5I C;  5JRG A;  3LZ1 A;  2NQB A;  4X23 C;  5AV5 C;  1P3P C;  2F2A C;  4Z5T A;  3MNN B;  3LEL A;  4J8U C;  4H9R B;  3MNN D;  5B31 A;  3AZF A;  5CPJ D;  3B6G D;  1Q9C A;  2Y2G A;  3LJA D;  3LZ0 C;  4WU9 A;  1P3I B;  4H9S C;  3AYW D;  2FJ7 C;  3WA9 B;  3VH6 A;  1P3B C;  4Z66 B;  3B6F C;  3WA9 D;  2NZD C;  3WAA B;  5CPI A;  5G49 A;  1KX3 C;  4E45 A;  1M19 A;  4H9P A;  4WU8 C;  3O62 B;  2CV5 A;  4ZUX B;  3R45 B;  5JRG D;  4YM6 B;  3LZ1 D;  2Y2L A;  3B0D B;  3O62 D;  5CP6 C;  3X1U B;  3AZH B;  3AZE A;  4XUJ A;  2HUE C;  3LEL D;  5BNV B;  3UT9 A;  3AZI B;  3AZN A;  3FDD A;  4E44 A;  4X23 A;  1P3K A;  3KXB B;  3AZF D;  5FUG A;  4YS3 A;  1P3A A;  2DF4 C;  1EQZ B;  5BT1 C;  3AV2 A;  1ID3 A;  1N1J A;  3REI B;  3UTB C;  1EQZ D;  4LD9 C;  3KUY C;  4NFT A;  3WTP E;  3MGS D;  3W97 B;  4KGC B;  3REJ D;  3AN2 D;  2FJ7 A;  3A1K A;  5CPI D;  2Y2O A;  5JA4 B;  4J8W C;  5AV9 B;  4ZBJ C;  5B32 A;  4KHA A;  1ZLA B;  5AV9 D;  5AV6 A;  5E5A B;  4DRA A;  5AV8 C;  1P3P B;  3AZM A;  1ZLA D;  4J8U B;  4X23 D;  1P3K D;  5AV5 D;  1P3P D;  2YFV A;  4UPK A;  2HIO B;  3AV2 D;  1KX4 B;  4EO5 B;  1P3F A;  5B33 C;  3LZ0 D;  2F8N D;  1P3B B;  2FJ7 D;  3UTB A;  3AZJ A;  3B6F B;  1KX3 B;  5B0Y A;  2ARO A;  4QLC A;  3TU4 B;  3B6F D;  2NZD D;  3MGP C;  4UUZ B;  4AWL C;  4WU8 D;  4JJN B;  2IO5 C;  5CP6 B;  5F99 C;  2HUE B;  5AVC B;  5B0Z A;  5B2I B;  5CP6 D;  4CAY A;  3EPH A;  3WTP B;  2JE5 A;  4CSR A;  3W96 C;  3X1V A;  3EPL A;  3UTA C;  4LD9 B;  3KUY B;  5BT1 D;  5GT3 A;  4HGA C;  3X1T A;  5KDM B;  3C1C C;  1P3G C;  3UTB D;  3KUY D;  3AZL A;  2ARO D;  4J8W B;  1KX5 A;  3REL B;  3A6N A;  1ULY A;  4H9Q B;  5B31 G;  1JFI B;  1H3O B;  3H0M C;  3KWQ A;  5BO0 A;  5GSU B;  2CWE A;  2BYK A;  5AV8 D;  1F1E A;  4WNN B;  3X1S A;  4Z66 C;  3WAA C;  5CPK C;  3W99 C;  3W96 A;  5GT0 A;  4ZUX C;  3VH5 A;  5GT3 D;  4J8V C;  3X1T D;  4YM6 C;  3B0D C;  3AZH C;  3X1U C;  1TZY A;  5B33 D;  1P3L C;  3AZI C;  1P3G A;  3NQU A;  3KXB C;  3MNN A;  4AWL B;  3MGP D;  3P5J B;  2Y2M A;  3NQJ B;  3AV1 B;  4KUD C;  2IO5 B;  3B6G A;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 4M6B A;  1M1A B;  3LJA A;  5F99 D;  3REI C;  3AYW A;  3F6T A;  3W97 C;  4KGC C;  1P3I A;  3WA9 A;  4J8X B;  4H9N A;  3UTA B;  3W96 D;  5B1M B;  4NE6 A;  5B32 G;  4HGA B;  3UTA D;  3O62 A;  1TZY D;  5E5A C;  3MGR B;  3IP4 C;  3R45 A;  3C1C D;  2JSS A;  1P3G D;  2VQR A;  4NE5 A;  2JCH A;  1F66 B;  5BNV A;  2HIO C;  3V9R B;  2ZY4 A;  2PYO B;  5B2J B;  1KX4 C;  2ZY2 A;  4EO5 C;  1EQZ A;  3MGS A;  1WWI A;  1P3I D;  3REI A;  3REJ A;  3AN2 A;  1W2E A;  3REH B;  3W97 A;  3TU4 C;  5CPK B;  4Z66 D;  5GXQ B;  4DRB A;  3W99 B;  3WAA D;  4J8V B;  1AOI B;  5JA4 A;  3W99 D;  5AV9 A;  4JJN C;  4ZUX D;  1Z2C B;  5DNM B;  5AVC C;  1P3L B;  4YM6 D;  1S32 C;  1ZLA A;  3WKJ B;  5B2I C;  3AZH D;  3X1U D;  5AV5 A;  1P3P A;  1P3L D;  1KU5 A;  3AZI D;  4H9O B;  3WTP C;  4J8U A;  3REK B;  3W98 B;  4KUD B;  3EPK A;  4WV4 B;  3KXB D;  5B40 C;  4XZQ B;  3LZ0 A;  2F8N A;  3REI D;  4H9S A;  5CHL B;  1KX4 A;  3W97 D;  4KGC D;  2NQB B;  1P3B A;  3REL C;  3B6F A;  2NZD A;  4G92 C;  1KX3 A;  1BH9 B;  4WU8 A;  3H0L C;  4UUZ A;  1P3M C;  5GSU C;  2RVQ C;  2Y2N A;  5BS7 C;  4JJN A;  1M18 B;  5CP6 A;  5B1L B;  2XD5 A;  5E5A D;  2FFF B;  4J8U D;  3AZK C;  5AY8 C;  3AL0 C;  2ZM5 A;  2L5A A;  2HIO D;  5G49 B;  3EG5 B;  1M19 B;  4H9P B;  2CV5 B;  4LD9 A;  1KX4 D;  3KUY A;  5KDM A;  5AVB B;  1P3B D;  1KX3 D;  1WWS A;  5DNN C;  3TU4 D;  4J8W A;  2F8N K;  1P34 C;  3AV1 C;  1M1A C;  1S32 B;  2ZY5 A;  4JJN D;  1JFI A;  2BYM A;  4YS3 B;  1P3A B;  5AV8 A;  5AVC D;  2F8N H;  4R8P C;  5B2I D;  1N1J B;  2XD1 A;  4J8X C;  1BH8 A;  4WNN A;  3WTP D;  5B40 B;  5B1M C;  5BNX A;  5B40 D;  2J8P A;  4LD9 D;  3MGR C;  5B32 B;  5B33 A;  5AV6 B;  1F66 C;  4G92 B;  4J8W D;  4NE3 A;  3REL D;  1T3U A;  3MVD C;  3MGP A;  1P3M B;  2PYO C;  2DQN C;  3NQJ A;  5B2J C;  5F99 A;  1P3M D;  5GSU D;  2RVQ D;  1A7W A;  3AZK B;  1TAF B;  3VH6 W;  5AY8 B;  3REH C;  3AZK D;  5AY8 D;  3AZJ B;  5GXQ C;  1U35 C;  3MGQ C;  1AOI C;  3AFA C;  4QLC B;  3KFU G;  1HQ3 C;  3UTA A;  5DNM C;  3AZG B;  3WKJ C;  3C1C A;  5CPJ C;  5B0Z B;  5DNN B;  3REK C;  1P34 B;  4H9R A;  3W98 C;  5DNN D;  4CSR B;  1P34 D;  3AV1 D;  4XZQ C;  1M1A D;  2F8N G;  5B24 B;  2BG1 A;  2G5H C;  4R8P B;  3C1B C;  2NQB C;  3LZ1 C;  4G91 C;  4Z66 A;  4J8X D;  3WAA A;  3AZL B;  1PZR A;  4Z5T C;  3A1I A;  5CPK A;  1KX5 B;  3W99 A;  3A6N B;  5B1M D;  4J8V A;  2UWX A;  4ZUX A;  5B31 C;  3AZF C;  2W8S A;  4YM6 A;  1M18 C;  3KWQ B;  3AZH A;  5B1L C;  3X1U A;  3MGR D;  5DNM A;  4WU9 C;  1P3L A;  3AZI A;  2BYK B;  3MVD B;  1P3O B;  2YFW B;  1F66 D;  3VH6 T;  3X1S B;  3B0C W;  3KXB A;  3MVD D;  4KUD A;  5CPI C;  4WJ3 C;  2PYO D;  1M19 C;  5B2J D;  2CV5 C;  5AVB C;  4KGC A;  3H0R C;  1U35 B;  3REH D;  4XUJ C;  3MGQ B;  3AZE C;  3UT9 C;  3AFA B;  5CPK D;  2RIQ A;  5GXQ D;  1HQ3 B;  3AZN C;  3MGQ D;  1U35 D;  1P3K C;  4J8V D;  1AOI D;  3NQU B;  3AFA D;  1R4V A;  1BH9 A;  1HQ3 D;  1HTA A;  5CPJ B;  3B6G B;  4YS3 C;  1B6W A;  1P3A C;  5E5A A;  5DNM D;  3LJA B;  3AV2 C;  1ID3 C;  3WKJ D;  1M18 A;  3AYW B;  5B1L A;  3REK D;  3W98 D;  4KUD D;  2HIO A;  4H9N B;  4XZQ D;  5B32 C;  3C1B B;  5JRG B;  3LZ1 B;  4G91 B;  2ZY3 A;  5AV6 C;  3C1B D;  3AZM C;  2NQB D;  4Z5T B;  5AVB A;  3LEL B;  3TU4 A;  4Z5T D;  5B31 B;  3AZF B;  3B0C T;  2LY8 A;  2Y2I A;  5B31 D;  4WU9 B;  5AVC A;  1S32 A;  1M18 D;  5B2I A;  5B1L D;  1P3F C;  4WU9 D;  3MGS B;  3WTP A;  3REJ B;  4DQY B;  3AZJ C;  3AN2 B;  2Y2K A;  5CPI B;  5B0Y C;  3VH5 W;  2ARO C;  4QLC C;  5B40 A;  1M19 D;  3AZG C;  2CV5 D;  2Y2H A;  3AZE B;  4XUJ B;  4WZS B;  5B0Z C;  3UT9 B;  4Z2M H;  5AVB D;  3AZN B;  4X23 B;  4XUJ D;  5AV5 B;  3REL A;  3AZE D;  1P3K B;  3UT9 D;  3B0B A;  4H9Q A;  3AZN D;  1H3O A;  3X1V C;  5FUG B;  2Y2J A;  1P3M A;  5GSU A;  3AV2 B;  5B24 C;  1S32 D;  5BS7 A;  1ID3 B;  4YS3 D;  1P3A D;  5GT3 C;  3X1T C;  3LZ0 B;  1ID3 D;  2F8N B;  3AZK A;  1TAF A;  2FJ7 B;  5AY8 A;  3AZL C;  1KX5 C;  2NZD B;  3A6N C;  4KHA B;  4WU8 B;  3KWQ C;  5B32 D;  3AZM B;  3AZG A;  5AV6 D;  1P3O C;  3AZM D;  5C3I C;  3X1S C;  2YFV B;  5DNN A;  1P34 A;  3AV1 A;  1M1A A;  3VH5 T;  5GT0 C;  3EPJ A;  1P3F B;  5B24 A;  4R8P A;  3UTB B;  1P3F D;  1TZY C;  4J8X A;  5B0Y B;  2ARO B;  3AZJ D;  5B0Y D;  5B1M A;  4QLC D;  3MNN C;  3B6G C;  4ZBJ B;  3KSY A;  3MGR A;  3AZG D;  4Z2M G;  3LJA C;  2BYM B;  3AYW C;  5AV8 B;  5B0Z D;  4CAY B;  1F66 A;  1P3I C;  1BFM A;  3MVD A;  3WA9 C;  3X1V B;  2YFW A;  1BH8 B;  1P3O A;  3V9R A;  2PYO A;  3X1V D;  5B2J A;  2Y2P A;  5GT3 B;  5BNX B;  3X1T B;  5B24 D;  4R8P D;  5JRG C;  3O62 C;  3REH A;  5B33 B;  3LEL C;  1U35 A;  5GXQ A;  3MGQ A;  3AZL D;  1AOI A;  3AFA A;  1KX5 D;  1HQ3 A;  3MGP B;  3A6N D;  1B67 A;  5BO0 B;  3WKJ A;  5CPJ A;  3KWQ D;  5F99 B;  1EQZ C;  3MGS C;  5C3I B;  4H9O A;  3REJ C;  3AN2 C;  3REK A;  1P3O D;  3W98 A;  3X1S D;  3W96 B;  5GT0 B;  4XZQ A;  5AV9 C;  5GT0 D;  1TZY B;  3C1B A;  1ZLA C;  3C1C B;  1P3G B;  2G5I C;  5JRG A;  3LZ1 A;  2NQB A;  4X23 C;  5AV5 C;  1P3P C;  2F2A C;  4Z5T A;  3MNN B;  3LEL A;  4J8U C;  4H9R B;  3MNN D;  5B31 A;  3AZF A;  5CPJ D;  3B6G D;  1Q9C A;  2Y2G A;  3LJA D;  3LZ0 C;  4WU9 A;  1P3I B;  4H9S C;  3AYW D;  2FJ7 C;  3WA9 B;  3VH6 A;  1P3B C;  4Z66 B;  3B6F C;  3WA9 D;  2NZD C;  3WAA B;  5CPI A;  5G49 A;  1KX3 C;  4E45 A;  1M19 A;  4H9P A;  4WU8 C;  3O62 B;  2CV5 A;  4ZUX B;  3R45 B;  5JRG D;  4YM6 B;  3LZ1 D;  2Y2L A;  3B0D B;  3O62 D;  5CP6 C;  3X1U B;  3AZH B;  3AZE A;  4XUJ A;  2HUE C;  3LEL D;  5BNV B;  3UT9 A;  3AZI B;  3AZN A;  3FDD A;  4E44 A;  4X23 A;  1P3K A;  3KXB B;  3AZF D;  5FUG A;  4YS3 A;  1P3A A;  2DF4 C;  1EQZ B;  5BT1 C;  3AV2 A;  1ID3 A;  1N1J A;  3REI B;  3UTB C;  1EQZ D;  4LD9 C;  3KUY C;  4NFT A;  3WTP E;  3MGS D;  3W97 B;  4KGC B;  3REJ D;  3AN2 D;  2FJ7 A;  3A1K A;  5CPI D;  2Y2O A;  5JA4 B;  4J8W C;  5AV9 B;  4ZBJ C;  5B32 A;  4KHA A;  1ZLA B;  5AV9 D;  5AV6 A;  5E5A B;  4DRA A;  5AV8 C;  1P3P B;  3AZM A;  1ZLA D;  4J8U B;  4X23 D;  1P3K D;  5AV5 D;  1P3P D;  2YFV A;  4UPK A;  2HIO B;  3AV2 D;  1KX4 B;  4EO5 B;  1P3F A;  5B33 C;  3LZ0 D;  2F8N D;  1P3B B;  2FJ7 D;  3UTB A;  3AZJ A;  3B6F B;  1KX3 B;  5B0Y A;  2ARO A;  4QLC A;  3TU4 B;  3B6F D;  2NZD D;  3MGP C;  4UUZ B;  4AWL C;  4WU8 D;  4JJN B;  2IO5 C;  5CP6 B;  5F99 C;  2HUE B;  5AVC B;  5B0Z A;  5B2I B;  5CP6 D;  4CAY A;  3EPH A;  3WTP B;  2JE5 A;  4CSR A;  3W96 C;  3X1V A;  3EPL A;  3UTA C;  4LD9 B;  3KUY B;  5BT1 D;  5GT3 A;  4HGA C;  3X1T A;  5KDM B;  3C1C C;  1P3G C;  3UTB D;  3KUY D;  3AZL A;  2ARO D;  4J8W B;  1KX5 A;  3REL B;  3A6N A;  1ULY A;  4H9Q B;  5B31 G;  1JFI B;  1H3O B;  3H0M C;  3KWQ A;  5BO0 A;  5GSU B;  2CWE A;  2BYK A;  5AV8 D;  1F1E A;  4WNN B;  3X1S A;  4Z66 C;  3WAA C;  5CPK C;  3W99 C;  3W96 A;  5GT0 A;  4ZUX C;  3VH5 A;  5GT3 D;  4J8V C;  3X1T D;  4YM6 C;  3B0D C;  3AZH C;  3X1U C;  1TZY A;  5B33 D;  1P3L C;  3AZI C;  1P3G A;  3NQU A;  3KXB C;  3MNN A;  4AWL B;  3MGP D;  3P5J B;  2Y2M A;  3NQJ B;  3AV1 B;  4KUD C;  2IO5 B;  3B6G A;  2Y2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...