4J8XD

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xD00
3B6GC 2F8NB 3LZ1D 1HQ3A 5BT1C 3B6FA 4KUDC 3TU4A 5B32C 3B0DC 3B6GA 2NZDD 3AYWB 5CP6B 4AWLB 3B0CT 1KX4B 3LZ0C 5B33D 4KGCB 1BH8A 3AZID 3MGQA 5B40B 3REKC 1P34B 3AZJD 4J8WB 5GXQD 5DNMD 4E45A 5CPKC 4ZUXD 3W98B 4QLCD 5B2JD 4H9OA 5CPKA 5AV9B 1M19B 5B31B 4HGAC 3RELD 5B24C 3O62C 4XZQC 2RVQC 2HIOC 3VH5T 2AROA 3X1TA 3O62A 3NQJB 2NZDB 3VH6T 5JA4B 2HIOA 3W99C 3AZND 2F8NG 4Z5TC 5B33B 4Z66B 5JRGD 1ZLAA 5GT0D 2FJ7C 4WNNB 3REJD 3AZGA 4Z5TA 3AZJB 5GXQB 3WA9A 5DNMB 5CPJC 5CPID 4H9QA 3AZLD 4ZUXB 4H9SA 5AY8D 5B2JB 4J8VA 4R8PA 3MVDD 3AZMA 1EQZD 3W97A 3A6NC 5B1LC 3KXBD 3LELC 3RELB 5E5AC 1P3OA 3LELA 3B6GD 3LJAB 5BT1D 2F8NK 2BYMA 4KUDD 5E5AA 5B32D 3AZNB 5GT3C 4LD9C 5CHLB 3MGRC 3NQUA 3LZ0D 3REIC 3AZFC 1P3MA 5GT3A 4NE5A 1P3AC 3MGRA 4J8XC 1P3LA 4KHAB 3X1UA 3REHB 3REKD 3AZKA 2YFVB 4M6BA 5BNXB 1KX3C 1M18C 3AZLB 1JFIA 5AY8B 4UUZB 4J8UA 1KX3A 1M18A 3MVDB 3MGSC 4Z2MG 1EQZB 3V9RA 3KXBB 3UTBA 5B2IC 5B24D 3O62D 3B6GB 4DRBA 4XZQD 2RVQD 4KUDB 2CV5C 5B32B 4XUJD 3B0DB 3WAAC 1P3IC 3AV2C 3W99D 2CV5A 1BH8B 3LZ0B 4Z5TD 3WAAA 4H9NB 3C1CC 2FJ7D 2HUEC 3AV2A 3REKB 4H9OB 5CPJD 5CPKB 3AFAC 3MGPC 2F8ND 5F99A 3A6ND 5B1LD 1S32C 2BYKB 4YS3A 4HGAB 5B24B 3O62B 3X1VA 4XZQB 1HTAA 2HIOB 1P3PA 1KX4D 1ZLAB 5BNVA 3W99B 5GT3D 4LD9D 4Z5TB 3REHC 3MGRD 1N1JA 2FJ7B 3REID 1WWSA 3AZFD 1P3AD 4J8XD 4H9QB 3R45A 3KSYA 5CPJB 1M18D 1KX3D 1AOIC 3B0BA 1HQ3C 1M19D 3B6FC 1F66A 3TU4C 1P3BC 3MNNC 3MGSD 3A6NB 5B1LB 3LELB 1P3FA 1P3BA 2BYMB 3MNNA 5B2ID 5BO0A 5E5AB 3UTAA 3MGQC 4Z66D 2CV5D 3NQUB 3B0CW 3WAAD 3WTPA 5GT3B 1P3ID 4LD9B 3MGRB 3REIB 5FUGB 3AZFB 1B67A 3C1CD 3WKJA 1P3AB 3W96C 4J8XB 4WU9A 5BS7A 1JFIB 3W96A 1KX3B 1M18B 4CSRA 3KWQC 2AROC 3X1TC 3AFAD 3UTBB 3MGSB 3MGPD 3KWQA 3C1BA 1P3GA 3LJAD 1ZLAC 3KUYA 5B2IB 1S32D 1F1EA 3VH5W 3AZGC 2CV5B 5B1MA 3VH6W 3WAAB 4H9RB 4H9PA 1P3IB 1BH9B 3WA9C 2IO5C 3AV2B 3REHD 2NQBC 4H9SC 4NFTA 3C1CB 5AV5C 2HUEB 2PYOC 2F8NH 4J8VC 4R8PC 4G91B 2NQBA 3AZMC 3W97C 5AV5A 2PYOA 2LY8A 5AV6A 2L5AA 3X1SA 1P3OC 1AOID 1U35A 1HQ3D 3B6FD 3AFAB 3TU4D 3MGPB 5B0ZC 1S32B 1KX5C 4JJNC 5B0ZA 1P3MC 5B0YC 4YM6C 5BNVB 1KX5A 4JJNA 1P3LC 3X1UC 5AVBA 3MGQD 3AZHC 1A7WA 3AZKC 1N1JB 5B0YA 4YM6A 4WV4B 3AZHA 4J8UC 1ID3C 4DRAA 5AVCA 5CPKD 1ID3A 1M1AC 3UTBC 1AOIB 1HQ3B 1M1AA 3B6FB 3AYWA 3TU4B 3KWQD 2AROD 3X1TD 1P3BB 3MNNB 4CAYA 5BO0B 2HIOD 4KGCA 1ZLAD 4Z2MH 4WU8C 3AZGD 1H3OA 3MGQB 4WU8A 3AN2A 2YFWA 3WA9D 4G91C 4ZBJC 5AV9A 3LZ1C 5AV5D 2PYOD 3W96B 4J8VD 4R8PD 3AZEC 3AZMD 5F99C 3LZ1A 3W97D 1WWIA 2JSSA 4YS3C 3AZEA 3X1VC 1P3OD 3LELD 1TZYC 3VH5A 3KWQB 2AROB 3X1TB 1P3PC 3VH6A 5E5AD 4WNNA 4X23C 1TZYA 5B0ZD 3AZIA 1KX5D 3AZJA 4X23A 1P3MD 3AZGB 5B0YD 4YM6D 4QLCC 5DNMA 1P3LD 3X1UD 3AZHD 1Q9CA 1ULYA 3AZKD 3WA9B 4ZUXA 2IO5B 4QLCA 2NQBB 1BFMA 1F66C 5AV5B 2PYOB 4J8UD 1ID3D 4J8VB 4R8PB 3AZMB 3W97B 1P3FC 3UTBD 5JRGC 1P3OB 5GT0C 3UTAC 3REJC 3AZNA 5JRGA 5GT0A 3REJA 5B0ZB 3WTPC 1KX5B 4JJNB 5CPIC 4KHAA 1P3MB 5B0YB 4YM6B 3WKJC 3AV2D 1P3LB 4WU9C 5BS7C 3X1UB 3AZHB 5CPIA 3AZKB 3AZLA 5DNNC 4UUZA 5GSUC 3MVDA 1EQZA 4J8UB 5DNNA 5C3IC 3KXBA 1ID3B 5GSUA 3V9RB 5G49A 3C1BC 3AZED 1P3GC 5F99D 1M1AB 3KUYC 4KUDA 2CWEA 5B32A 4YS3D 4CAYB 3X1VD 1TZYD 3AV1C 5B1MC 1P3KC 1P3PD 3LZ0A 4H9NA 4X23D 3AV1A 1P3KA 1H3OB 4NE6A 5AV8C 4WU8B 3AN2B 3REKA 4G92C 2YFWB 5AV8A 1TAFA 5AV6C 3X1SC 5KDMA 4EO5C 4ZBJB 1U35C 3LZ1B 1KU5A 1F66D 2BYKA 4XUJC 5B24A 3AZEB 5F99B 4XZQA 1P3FD 4YS3B 1P3BD 3MNND 4XUJA 3X1VB 3UTAD 1TZYB 1P3PB 3W99A 5AVBC 3AZIB 3WTPE 4X23B 3UT9C 2FJ7A 3WTPD 3UT9A 4QLCB 3WKJD 5AVCC 4WU9D 5CPJA 3R45B 3W96D 5DNND 5GSUD 2F8NA 1F66B 3AYWC 5CP6C 3A6NA 5B1LA 4AWLC 1KX4C 5B31G 5CP6A 3C1BD 1P3FB 1P3GD 4KGCC 1KX4A 3KUYD 5B40C 5JRGB 1P34C 5GT0B 3UTAB 4J8WC 3REJB 4LD9A 4E44A 3AN2C 5B40A 3AV1D 1P34A 5B1MD 1P3KD 4J8WA 3REIA 5FUGA 3WTPB 3AZFA 3W98C 1P3AA 4J8XA 5CPIB 5AV8D 5AV9C 1M19C 5B31C 3WKJB 3W98A 4WU9B 2NQBD 1M19A 5B31A 5DNNB 5AV6D 4CSRB 5GSUB 3X1SD 3MGSA 2NZDC 5G49B 1U35D 5C3IB 5B33C 1B6WA 4Z66C 5B2IA 3NQJA 2NZDA 5JA4A 3C1BB 1P3GB 3KUYB 5B33A 3AZIC 4Z66A 3AZJC 5GXQC 4H9RA 1P3IA 1BH9A 5DNMC 4JJND 5B1MB 3AV1B 1P3KB 5AVBD 5GXQA 4H9PB 4ZUXC 3UT9D 3C1CA 5B2JC 5AV8B 4G92B 1TAFB 5B2JA 3RELC 5AVCD 5KDMB 5AV6B 1R4VA 3LJAC 3RELA 3X1SB 3AFAA 4EO5B 1U35B 3MGPA 3AZNC 1M1AD 3LJAA 3AYWD 5CP6D 1S32A 4XUJB 4KGCD 5B40D 1P34D 4J8WD 5B32G 4WZSB 5AVBB 4WU8D 3REHA 3AZLC 3AN2D 2YFVA 3UT9B 4NE3A 5AY8C 5BNXA 3W98D 3MVDC 1EQZC 5AY8A 3KXBC 5AV9D 5B31D 5AVCB 1AOIA
chains in the Genus database with same CATH superfamily
3B6GC 2F8NB 3LZ1D 1HQ3A 5BT1C 3B6FA 4KUDC 3TU4A 5B32C 2ZY4A 3B0DC 3B6GA 2NZDD 3AYWB 5CP6B 4AWLB 3B0CT 1KX4B 3LZ0C 5B33D 4KGCB 1BH8A 3AZID 3MGQA 5B40B 2Y2OA 3REKC 3AZJD 1P34B 4J8WB 5GXQD 5DNMD 4E45A 5CPKC 4ZUXD 3W98B 4QLCD 5B2JD 4H9OA 5CPKA 5AV9B 1M19B 5B31B 2G5IC 4HGAC 3RELD 5B24C 3O62C 4XZQC 2RVQC 2HIOC 3VH5T 2AROA 2Y2QA 3X1TA 3O62A 3NQJB 2NZDB 3VH6T 5JA4B 2HIOA 3W99C 3AZND 2F8NG 4Z5TC 5B33B 4Z66B 5JRGD 1ZLAA 5GT0D 2FJ7C 4WNNB 3REJD 3AZGA 4Z5TA 3AZJB 5GXQB 2Y2PA 3WA9A 5DNMB 5CPJC 5CPID 4H9QA 2Y2HA 3AZLD 2ZY2A 4ZUXB 4H9SA 5AY8D 5B2JB 4J8VA 4R8PA 3MVDD 2UWXA 3AZMA 1EQZD 3W97A 3A6NC 5B1LC 3KXBD 3LELC 3RELB 5E5AC 1P3OA 3LELA 3B6GD 3LJAB 5BT1D 2F8NK 2BYMA 4KUDD 5E5AA 5B32D 3AZNB 5GT3C 4LD9C 5CHLB 3MGRC 3NQUA 3LZ0D 3REIC 3AZFC 1P3MA 5GT3A 4NE5A 1P3AC 3MGRA 4J8XC 2XD5A 1P3LA 4KHAB 3X1UA 2ZM5A 3REHB 3REKD 3AZKA 2YFVB 4M6BA 5BNXB 1KX3C 1M18C 3IP4C 3AZLB 1JFIA 3EPHA 5AY8B 3A1KA 4UUZB 4J8UA 1KX3A 1M18A 3MVDB 3MGSC 2RIQA 4Z2MG 1EQZB 3V9RA 3KXBB 3P5JB 3UTBA 5B2IC 5B24D 3O62D 3B6GB 4DRBA 4XZQD 2RVQD 4KUDB 2CV5C 5B32B 4XUJD 3B0DB 3WAAC 1P3IC 3AV2C 3W99D 2CV5A 1BH8B 3LZ0B 4Z5TD 3WAAA 4H9NB 3C1CC 2FJ7D 2HUEC 2JE5A 3AV2A 3REKB 4H9OB 5CPJD 5CPKB 3AFAC 3MGPC 2F8ND 5F99A 3A6ND 5B1LD 1S32C 2BYKB 4YS3A 4HGAB 5B24B 3O62B 3X1VA 4XZQB 1HTAA 2HIOB 1P3PA 1KX4D 1ZLAB 3F6TA 5BNVA 3W99B 5GT3D 4LD9D 4Z5TB 3REHC 2DF4C 3MGRD 1N1JA 2FJ7B 3REID 1WWSA 3AZFD 1P3AD 4J8XD 4H9QB 3R45A 2Y2IA 3KSYA 5CPJB 1M18D 1KX3D 1AOIC 1HQ3C 3B0BA 1M19D 3B6FC 1F66A 3TU4C 1P3BC 3MNNC 3MGSD 3A6NB 5B1LB 3LELB 1P3FA 1P3BA 2BYMB 3MNNA 5B2ID 5BO0A 5E5AB 3UTAA 3MGQC 4Z66D 2CV5D 3NQUB 3AL0C 1W2EA 3B0CW 3WAAD 3WTPA 5GT3B 1P3ID 4LD9B 3MGRB 3REIB 5FUGB 3AZFB 1B67A 3C1CD 3WKJA 1P3AB 2Y2GA 3W96C 4J8XB 4WU9A 5BS7A 1JFIB 3W96A 1KX3B 1M18B 4CSRA 3KWQC 2AROC 3X1TC 3AFAD 3UTBB 3MGSB 3MGPD 3KWQA 3C1BA 1P3GA 3LJAD 1ZLAC 2J8PA 5B2IB 3KUYA 1S32D 4DQYB 1F1EA 3VH5W 3AZGC 2F2AC 2CV5B 5B1MA 3VH6W 3WAAB 4H9RB 4H9PA 1P3IB 1BH9B 3WA9C 2IO5C 3AV2B 3EPKA 3REHD 2NQBC 4H9SC 4NFTA 3C1CB 5AV5C 2HUEB 2PYOC 2F8NH 4J8VC 4R8PC 4G91B 2NQBA 3AZMC 3EG5B 3W97C 5AV5A 2PYOA 2LY8A 5AV6A 2L5AA 3X1SA 3H0MC 1P3OC 1AOID 1U35A 1HQ3D 3B6FD 3AFAB 2Y2LA 3TU4D 3MGPB 5B0ZC 1S32B 1KX5C 4JJNC 5B0ZA 1P3MC 5B0YC 4YM6C 5BNVB 1KX5A 4JJNA 1P3LC 3X1UC 5AVBA 3MGQD 3EPJA 1A7WA 3AZHC 2ZY3A 3AZKC 1N1JB 5B0YA 4YM6A 4WV4B 3AZHA 4J8UC 1ID3C 4DRAA 5AVCA 5CPKD 1ID3A 1M1AC 3UTBC 1AOIB 1HQ3B 1M1AA 3B6FB 3AYWA 3TU4B 3KWQD 2AROD 3X1TD 1P3BB 3MNNB 4CAYA 5BO0B 2HIOD 4KGCA 1ZLAD 4Z2MH 4WU8C 2FFFB 3AZGD 1H3OA 3MGQB 4WU8A 3AN2A 2YFWA 2ZY5A 3WA9D 4G91C 4ZBJC 5AV9A 3LZ1C 5AV5D 2PYOD 3W96B 4J8VD 4R8PD 1T3UA 3AZEC 3AZMD 5F99C 3LZ1A 3W97D 1WWIA 2JSSA 4YS3C 3AZEA 3X1VC 1P3OD 3LELD 1TZYC 3VH5A 3KWQB 2AROB 3X1TB 1P3PC 3VH6A 5E5AD 4WNNA 4X23C 1TZYA 5B0ZD 3AZIA 1KX5D 3AZJA 4X23A 1P3MD 3AZGB 5B0YD 4YM6D 4QLCC 5DNMA 1P3LD 3X1UD 3AZHD 1Q9CA 1ULYA 3AZKD 3WA9B 4ZUXA 2IO5B 4QLCA 4WJ3C 2NQBB 1BFMA 1F66C 5AV5B 2PYOB 4J8UD 3H0LC 1ID3D 4J8VB 4R8PB 3AZMB 3W97B 1P3FC 3UTBD 5JRGC 1P3OB 5GT0C 3UTAC 3REJC 3KFUG 3AZNA 5JRGA 5GT0A 3REJA 5B0ZB 3WTPC 4UPKA 1KX5B 3H0RC 4JJNB 5CPIC 2W8SA 4KHAA 1P3MB 5B0YB 4YM6B 3WKJC 3AV2D 1P3LB 4WU9C 5BS7C 3X1UB 3AZHB 5CPIA 3AZKB 3AZLA 5DNNC 4UUZA 5GSUC 3MVDA 1EQZA 4J8UB 5DNNA 5C3IC 3KXBA 1ID3B 5GSUA 2DQNC 3V9RB 5G49A 3C1BC 3AZED 1P3GC 5F99D 1M1AB 3KUYC 4KUDA 2G5HC 2CWEA 5B32A 4YS3D 4CAYB 3X1VD 1TZYD 3AV1C 5B1MC 1P3KC 1P3PD 3LZ0A 4H9NA 4X23D 3AV1A 1P3KA 1H3OB 4NE6A 5AV8C 4WU8B 3AN2B 3REKA 4G92C 2YFWB 5AV8A 1TAFA 5AV6C 3X1SC 5KDMA 4EO5C 4ZBJB 1U35C 3LZ1B 1KU5A 2Y2JA 1F66D 2BYKA 2Y2MA 4XUJC 5B24A 5F99B 3AZEB 4XZQA 1P3FD 4YS3B 1P3BD 3MNND 4XUJA 3X1VB 2VQRA 3UTAD 2Y2NA 1TZYB 1P3PB 3W99A 5AVBC 3AZIB 3WTPE 4X23B 3UT9C 2FJ7A 3WTPD 3UT9A 2Y2KA 4QLCB 3WKJD 5AVCC 4WU9D 5CPJA 3R45B 1PZRA 3W96D 5DNND 5GSUD 2F8NA 1F66B 3AYWC 5CP6C 3A6NA 5B1LA 4AWLC 1KX4C 5B31G 5CP6A 3C1BD 1P3FB 1P3GD 4KGCC 1KX4A 3KUYD 3FDDA 5B40C 5JRGB 1P34C 5GT0B 3UTAB 4J8WC 3REJB 4LD9A 4E44A 3AN2C 5B40A 3AV1D 1P34A 5B1MD 1P3KD 4J8WA 3REIA 5FUGA 3WTPB 3AZFA 3W98C 1P3AA 4J8XA 5CPIB 5AV8D 5AV9C 1M19C 5B31C 3WKJB 3W98A 4WU9B 2BG1A 2NQBD 1M19A 5B31A 5DNNB 5AV6D 4CSRB 5GSUB 3X1SD 3MGSA 2NZDC 2XD1A 5G49B 1U35D 5C3IB 5B33C 1B6WA 4Z66C 5B2IA 3NQJA 2NZDA 5JA4A 3C1BB 1P3GB 3KUYB 5B33A 3AZIC 4Z66A 3AZJC 3A1IA 5GXQC 4H9RA 1P3IA 1BH9A 5DNMC 4JJND 5B1MB 3AV1B 1P3KB 5AVBD 5GXQA 4H9PB 1Z2CB 4ZUXC 3UT9D 3C1CA 5B2JC 3EPLA 5AV8B 4G92B 1TAFB 5B2JA 3RELC 5AVCD 5KDMB 5AV6B 1R4VA 3LJAC 3RELA 3X1SB 3AFAA 4EO5B 1U35B 3MGPA 3AZNC 1M1AD 3LJAA 3AYWD 5CP6D 1S32A 4XUJB 2JCHA 4KGCD 5B40D 1P34D 4J8WD 5B32G 4WZSB 5AVBB 4WU8D 3REHA 3AZLC 3AN2D 2YFVA 3UT9B 4NE3A 5AY8C 5BNXA 3W98D 3MVDC 1EQZC 5AY8A 3KXBC 5AV9D 5B31D 5AVCB 1AOIA
chains in the Genus database with same CATH topology
3B6GC 2F8NB 3LZ1D 1HQ3A 5BT1C 3B6FA 4KUDC 3TU4A 5B32C 2ZY4A 3B0DC 3B6GA 2NZDD 3AYWB 5CP6B 4AWLB 3B0CT 1KX4B 3LZ0C 5B33D 4KGCB 1BH8A 3AZID 3MGQA 5B40B 2Y2OA 3REKC 3AZJD 1P34B 4J8WB 5GXQD 5DNMD 4E45A 5CPKC 4ZUXD 3W98B 4QLCD 5B2JD 4H9OA 5CPKA 5AV9B 1M19B 5B31B 2G5IC 4HGAC 3RELD 5B24C 3O62C 4XZQC 2RVQC 2HIOC 3VH5T 2AROA 2Y2QA 3X1TA 3O62A 3NQJB 2NZDB 3VH6T 5JA4B 2HIOA 3W99C 3AZND 2F8NG 4Z5TC 5B33B 4Z66B 5JRGD 1ZLAA 5GT0D 2FJ7C 4WNNB 3REJD 3AZGA 4Z5TA 3AZJB 5GXQB 2Y2PA 3WA9A 5DNMB 5CPJC 5CPID 4H9QA 2Y2HA 3AZLD 2ZY2A 4ZUXB 4H9SA 5AY8D 5B2JB 4J8VA 4R8PA 3MVDD 2UWXA 3AZMA 1EQZD 3W97A 3A6NC 5B1LC 3KXBD 3LELC 3RELB 5E5AC 1P3OA 3LELA 3B6GD 3LJAB 5BT1D 2F8NK 2BYMA 4KUDD 5E5AA 5B32D 3AZNB 5GT3C 4LD9C 5CHLB 3MGRC 3NQUA 3LZ0D 3REIC 3AZFC 1P3MA 5GT3A 4NE5A 1P3AC 3MGRA 4J8XC 2XD5A 1P3LA 4KHAB 3X1UA 2ZM5A 3REHB 3REKD 3AZKA 2YFVB 4M6BA 5BNXB 1KX3C 1M18C 3IP4C 3AZLB 1JFIA 3EPHA 5AY8B 3A1KA 4UUZB 4J8UA 1KX3A 1M18A 3MVDB 3MGSC 2RIQA 4Z2MG 1EQZB 3V9RA 3KXBB 3P5JB 3UTBA 5B2IC 5B24D 3O62D 3B6GB 4DRBA 4XZQD 2RVQD 4KUDB 2CV5C 5B32B 4XUJD 3B0DB 3WAAC 1P3IC 3AV2C 3W99D 2CV5A 1BH8B 3LZ0B 4Z5TD 3WAAA 4H9NB 3C1CC 2FJ7D 2HUEC 2JE5A 3AV2A 3REKB 4H9OB 5CPJD 5CPKB 3AFAC 3MGPC 2F8ND 5F99A 3A6ND 5B1LD 1S32C 2BYKB 4YS3A 4HGAB 5B24B 3O62B 3X1VA 4XZQB 1HTAA 2HIOB 1P3PA 1KX4D 1ZLAB 3F6TA 5BNVA 3W99B 5GT3D 4LD9D 4Z5TB 3REHC 2DF4C 3MGRD 1N1JA 2FJ7B 3REID 1WWSA 3AZFD 1P3AD 4J8XD 4H9QB 3R45A 2Y2IA 3KSYA 5CPJB 1M18D 1KX3D 1AOIC 1HQ3C 3B0BA 1M19D 3B6FC 1F66A 3TU4C 1P3BC 3MNNC 3MGSD 3A6NB 5B1LB 3LELB 1P3FA 1P3BA 2BYMB 3MNNA 5B2ID 5BO0A 5E5AB 3UTAA 3MGQC 4Z66D 2CV5D 3NQUB 3AL0C 1W2EA 3B0CW 3WAAD 3WTPA 5GT3B 1P3ID 4LD9B 3MGRB 3REIB 5FUGB 3AZFB 1B67A 3C1CD 3WKJA 1P3AB 2Y2GA 3W96C 4J8XB 4WU9A 5BS7A 1JFIB 3W96A 1KX3B 1M18B 4CSRA 3KWQC 2AROC 3X1TC 3AFAD 3UTBB 3MGSB 3MGPD 3KWQA 3C1BA 1P3GA 3LJAD 1ZLAC 2J8PA 5B2IB 3KUYA 1S32D 4DQYB 1F1EA 3VH5W 3AZGC 2F2AC 2CV5B 5B1MA 3VH6W 3WAAB 4H9RB 4H9PA 1P3IB 1BH9B 3WA9C 2IO5C 3AV2B 3EPKA 3REHD 2NQBC 4H9SC 4NFTA 3C1CB 5AV5C 2HUEB 2PYOC 2F8NH 4J8VC 4R8PC 4G91B 2NQBA 3AZMC 3EG5B 3W97C 5AV5A 2PYOA 2LY8A 5AV6A 2L5AA 3X1SA 3H0MC 1P3OC 1AOID 1U35A 1HQ3D 3B6FD 3AFAB 2Y2LA 3TU4D 3MGPB 5B0ZC 1S32B 1KX5C 4JJNC 5B0ZA 1P3MC 5B0YC 4YM6C 5BNVB 1KX5A 4JJNA 1P3LC 3X1UC 5AVBA 3MGQD 3EPJA 1A7WA 3AZHC 2ZY3A 3AZKC 1N1JB 5B0YA 4YM6A 4WV4B 3AZHA 4J8UC 1ID3C 4DRAA 5AVCA 5CPKD 1ID3A 1M1AC 3UTBC 1AOIB 1HQ3B 1M1AA 3B6FB 3AYWA 3TU4B 3KWQD 2AROD 3X1TD 1P3BB 3MNNB 4CAYA 5BO0B 2HIOD 4KGCA 1ZLAD 4Z2MH 4WU8C 2FFFB 3AZGD 1H3OA 3MGQB 4WU8A 3AN2A 2YFWA 2ZY5A 3WA9D 4G91C 4ZBJC 5AV9A 3LZ1C 5AV5D 2PYOD 3W96B 4J8VD 4R8PD 1T3UA 3AZEC 3AZMD 5F99C 3LZ1A 3W97D 1WWIA 2JSSA 4YS3C 3AZEA 3X1VC 1P3OD 3LELD 1TZYC 3VH5A 3KWQB 2AROB 3X1TB 1P3PC 3VH6A 5E5AD 4WNNA 4X23C 1TZYA 5B0ZD 3AZIA 1KX5D 3AZJA 4X23A 1P3MD 3AZGB 5B0YD 4YM6D 4QLCC 5DNMA 1P3LD 3X1UD 3AZHD 1Q9CA 1ULYA 3AZKD 3WA9B 4ZUXA 2IO5B 4QLCA 4WJ3C 2NQBB 1BFMA 1F66C 5AV5B 2PYOB 4J8UD 3H0LC 1ID3D 4J8VB 4R8PB 3AZMB 3W97B 1P3FC 3UTBD 5JRGC 1P3OB 5GT0C 3UTAC 3REJC 3KFUG 3AZNA 5JRGA 5GT0A 3REJA 5B0ZB 3WTPC 4UPKA 1KX5B 3H0RC 4JJNB 5CPIC 2W8SA 4KHAA 1P3MB 5B0YB 4YM6B 3WKJC 3AV2D 1P3LB 4WU9C 5BS7C 3X1UB 3AZHB 5CPIA 3AZKB 3AZLA 5DNNC 4UUZA 5GSUC 3MVDA 1EQZA 4J8UB 5DNNA 5C3IC 3KXBA 1ID3B 5GSUA 2DQNC 3V9RB 5G49A 3C1BC 3AZED 1P3GC 5F99D 1M1AB 3KUYC 4KUDA 2G5HC 2CWEA 5B32A 4YS3D 4CAYB 3X1VD 1TZYD 3AV1C 5B1MC 1P3KC 1P3PD 3LZ0A 4H9NA 4X23D 3AV1A 1P3KA 1H3OB 4NE6A 5AV8C 4WU8B 3AN2B 3REKA 4G92C 2YFWB 5AV8A 1TAFA 5AV6C 3X1SC 5KDMA 4EO5C 4ZBJB 1U35C 3LZ1B 1KU5A 2Y2JA 1F66D 2BYKA 2Y2MA 4XUJC 5B24A 5F99B 3AZEB 4XZQA 1P3FD 4YS3B 1P3BD 3MNND 4XUJA 3X1VB 2VQRA 3UTAD 2Y2NA 1TZYB 1P3PB 3W99A 5AVBC 3AZIB 3WTPE 4X23B 3UT9C 2FJ7A 3WTPD 3UT9A 2Y2KA 4QLCB 3WKJD 5AVCC 4WU9D 5CPJA 3R45B 1PZRA 3W96D 5DNND 5GSUD 2F8NA 1F66B 3AYWC 5CP6C 3A6NA 5B1LA 4AWLC 1KX4C 5B31G 5CP6A 3C1BD 1P3FB 1P3GD 4KGCC 1KX4A 3KUYD 3FDDA 5B40C 5JRGB 1P34C 5GT0B 3UTAB 4J8WC 3REJB 4LD9A 4E44A 3AN2C 5B40A 3AV1D 1P34A 5B1MD 1P3KD 4J8WA 3REIA 5FUGA 3WTPB 3AZFA 3W98C 1P3AA 4J8XA 5CPIB 5AV8D 5AV9C 1M19C 5B31C 3WKJB 3W98A 4WU9B 2BG1A 2NQBD 1M19A 5B31A 5DNNB 5AV6D 4CSRB 5GSUB 3X1SD 3MGSA 2NZDC 2XD1A 5G49B 1U35D 5C3IB 5B33C 1B6WA 4Z66C 5B2IA 3NQJA 2NZDA 5JA4A 3C1BB 1P3GB 3KUYB 5B33A 3AZIC 4Z66A 3AZJC 3A1IA 5GXQC 4H9RA 1P3IA 1BH9A 5DNMC 4JJND 5B1MB 3AV1B 1P3KB 5AVBD 5GXQA 4H9PB 1Z2CB 4ZUXC 3UT9D 3C1CA 5B2JC 3EPLA 5AV8B 4G92B 1TAFB 5B2JA 3RELC 5AVCD 5KDMB 5AV6B 1R4VA 3LJAC 3RELA 3X1SB 3AFAA 4EO5B 1U35B 3MGPA 3AZNC 1M1AD 3LJAA 3AYWD 5CP6D 1S32A 4XUJB 2JCHA 4KGCD 5B40D 1P34D 4J8WD 5B32G 4WZSB 5AVBB 4WU8D 3REHA 3AZLC 3AN2D 2YFVA 3UT9B 4NE3A 5AY8C 5BNXA 3W98D 3MVDC 1EQZC 5AY8A 3KXBC 5AV9D 5B31D 5AVCB 1AOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G C;  2F8N B;  3LZ1 D;  1HQ3 A;  5BT1 C;  3B6F A;  4KUD C;  3TU4 A;  5B32 C;  3B0D C;  3B6G A;  2NZD D;  3AYW B;  5CP6 B;  4AWL B;  3B0C T;  1KX4 B;  3LZ0 C;  5B33 D;  4KGC B;  1BH8 A;  3AZI D;  3MGQ A;  5B40 B;  3REK C;  1P34 B;  3AZJ D;  4J8W B;  5GXQ D;  5DNM D;  4E45 A;  5CPK C;  4ZUX D;  3W98 B;  4QLC D;  5B2J D;  4H9O A;  5CPK A;  5AV9 B;  1M19 B;  5B31 B;  4HGA C;  3REL D;  5B24 C;  3O62 C;  4XZQ C;  2RVQ C;  2HIO C;  3VH5 T;  2ARO A;  3X1T A;  3O62 A;  3NQJ B;  2NZD B;  3VH6 T;  5JA4 B;  2HIO A;  3W99 C;  3AZN D;  2F8N G;  4Z5T C;  5B33 B;  4Z66 B;  5JRG D;  1ZLA A;  5GT0 D;  2FJ7 C;  4WNN B;  3REJ D;  3AZG A;  4Z5T A;  3AZJ B;  5GXQ B;  3WA9 A;  5DNM B;  5CPJ C;  5CPI D;  4H9Q A;  3AZL D;  4ZUX B;  4H9S A;  5AY8 D;  5B2J B;  4J8V A;  4R8P A;  3MVD D;  3AZM A;  1EQZ D;  3W97 A;  3A6N C;  5B1L C;  3KXB D;  3LEL C;  3REL B;  5E5A C;  1P3O A;  3LEL A;  3B6G D;  3LJA B;  5BT1 D;  2F8N K;  2BYM A;  4KUD D;  5E5A A;  5B32 D;  3AZN B;  5GT3 C;  4LD9 C;  5CHL B;  3MGR C;  3NQU A;  3LZ0 D;  3REI C;  3AZF C;  1P3M A;  5GT3 A;  4NE5 A;  1P3A C;  3MGR A;  4J8X C;  1P3L A;  4KHA B;  3X1U A;  3REH B;  3REK D;  3AZK A;  2YFV B;  4M6B A;  5BNX B;  1KX3 C;  1M18 C;  3AZL B;  1JFI A;  5AY8 B;  4UUZ B;  4J8U A;  1KX3 A;  1M18 A;  3MVD B;  3MGS C;  4Z2M G;  1EQZ B;  3V9R A;  3KXB B;  3UTB A;  5B2I C;  5B24 D;  3O62 D;  3B6G B;  4DRB A;  4XZQ D;  2RVQ D;  4KUD B;  2CV5 C;  5B32 B;  4XUJ D;  3B0D B;  3WAA C;  1P3I C;  3AV2 C;  3W99 D;  2CV5 A;  1BH8 B;  3LZ0 B;  4Z5T D;  3WAA A;  4H9N B;  3C1C C;  2FJ7 D;  2HUE C;  3AV2 A;  3REK B;  4H9O B;  5CPJ D;  5CPK B;  3AFA C;  3MGP C;  2F8N D;  5F99 A;  3A6N D;  5B1L D;  1S32 C;  2BYK B;  4YS3 A;  4HGA B;  5B24 B;  3O62 B;  3X1V A;  4XZQ B;  1HTA A;  2HIO B;  1P3P A;  1KX4 D;  1ZLA B;  5BNV A;  3W99 B;  5GT3 D;  4LD9 D;  4Z5T B;  3REH C;  3MGR D;  1N1J A;  2FJ7 B;  3REI D;  1WWS A;  3AZF D;  1P3A D;  4J8X D;  4H9Q B;  3R45 A;  3KSY A;  5CPJ B;  1M18 D;  1KX3 D;  1AOI C;  3B0B A;  1HQ3 C;  1M19 D;  3B6F C;  1F66 A;  3TU4 C;  1P3B C;  3MNN C;  3MGS D;  3A6N B;  5B1L B;  3LEL B;  1P3F A;  1P3B A;  2BYM B;  3MNN A;  5B2I D;  5BO0 A;  5E5A B;  3UTA A;  3MGQ C;  4Z66 D;  2CV5 D;  3NQU B;  3B0C W;  3WAA D;  3WTP A;  5GT3 B;  1P3I D;  4LD9 B;  3MGR B;  3REI B;  5FUG B;  3AZF B;  1B67 A;  3C1C D;  3WKJ A;  1P3A B;  3W96 C;  4J8X B;  4WU9 A;  5BS7 A;  1JFI B;  3W96 A;  1KX3 B;  1M18 B;  4CSR A;  3KWQ C;  2ARO C;  3X1T C;  3AFA D;  3UTB B;  3MGS B;  3MGP D;  3KWQ A;  3C1B A;  1P3G A;  3LJA D;  1ZLA C;  3KUY A;  5B2I B;  1S32 D;  1F1E A;  3VH5 W;  3AZG C;  2CV5 B;  5B1M A;  3VH6 W;  3WAA B;  4H9R B;  4H9P A;  1P3I B;  1BH9 B;  3WA9 C;  2IO5 C;  3AV2 B;  3REH D;  2NQB C;  4H9S C;  4NFT A;  3C1C B;  5AV5 C;  2HUE B;  2PYO C;  2F8N H;  4J8V C;  4R8P C;  4G91 B;  2NQB A;  3AZM C;  3W97 C;  5AV5 A;  2PYO A;  2LY8 A;  5AV6 A;  2L5A A;  3X1S A;  1P3O C;  1AOI D;  1U35 A;  1HQ3 D;  3B6F D;  3AFA B;  3TU4 D;  3MGP B;  5B0Z C;  1S32 B;  1KX5 C;  4JJN C;  5B0Z A;  1P3M C;  5B0Y C;  4YM6 C;  5BNV B;  1KX5 A;  4JJN A;  1P3L C;  3X1U C;  5AVB A;  3MGQ D;  3AZH C;  1A7W A;  3AZK C;  1N1J B;  5B0Y A;  4YM6 A;  4WV4 B;  3AZH A;  4J8U C;  1ID3 C;  4DRA A;  5AVC A;  5CPK D;  1ID3 A;  1M1A C;  3UTB C;  1AOI B;  1HQ3 B;  1M1A A;  3B6F B;  3AYW A;  3TU4 B;  3KWQ D;  2ARO D;  3X1T D;  1P3B B;  3MNN B;  4CAY A;  5BO0 B;  2HIO D;  4KGC A;  1ZLA D;  4Z2M H;  4WU8 C;  3AZG D;  1H3O A;  3MGQ B;  4WU8 A;  3AN2 A;  2YFW A;  3WA9 D;  4G91 C;  4ZBJ C;  5AV9 A;  3LZ1 C;  5AV5 D;  2PYO D;  3W96 B;  4J8V D;  4R8P D;  3AZE C;  3AZM D;  5F99 C;  3LZ1 A;  3W97 D;  1WWI A;  2JSS A;  4YS3 C;  3AZE A;  3X1V C;  1P3O D;  3LEL D;  1TZY C;  3VH5 A;  3KWQ B;  2ARO B;  3X1T B;  1P3P C;  3VH6 A;  5E5A D;  4WNN A;  4X23 C;  1TZY A;  5B0Z D;  3AZI A;  1KX5 D;  3AZJ A;  4X23 A;  1P3M D;  3AZG B;  5B0Y D;  4YM6 D;  4QLC C;  5DNM A;  1P3L D;  3X1U D;  3AZH D;  1Q9C A;  1ULY A;  3AZK D;  3WA9 B;  4ZUX A;  2IO5 B;  4QLC A;  2NQB B;  1BFM A;  1F66 C;  5AV5 B;  2PYO B;  4J8U D;  1ID3 D;  4J8V B;  4R8P B;  3AZM B;  3W97 B;  1P3F C;  3UTB D;  5JRG C;  1P3O B;  5GT0 C;  3UTA C;  3REJ C;  3AZN A;  5JRG A;  5GT0 A;  3REJ A;  5B0Z B;  3WTP C;  1KX5 B;  4JJN B;  5CPI C;  4KHA A;  1P3M B;  5B0Y B;  4YM6 B;  3WKJ C;  3AV2 D;  1P3L B;  4WU9 C;  5BS7 C;  3X1U B;  3AZH B;  5CPI A;  3AZK B;  3AZL A;  5DNN C;  4UUZ A;  5GSU C;  3MVD A;  1EQZ A;  4J8U B;  5DNN A;  5C3I C;  3KXB A;  1ID3 B;  5GSU A;  3V9R B;  5G49 A;  3C1B C;  3AZE D;  1P3G C;  5F99 D;  1M1A B;  3KUY C;  4KUD A;  2CWE A;  5B32 A;  4YS3 D;  4CAY B;  3X1V D;  1TZY D;  3AV1 C;  5B1M C;  1P3K C;  1P3P D;  3LZ0 A;  4H9N A;  4X23 D;  3AV1 A;  1P3K A;  1H3O B;  4NE6 A;  5AV8 C;  4WU8 B;  3AN2 B;  3REK A;  4G92 C;  2YFW B;  5AV8 A;  1TAF A;  5AV6 C;  3X1S C;  5KDM A;  4EO5 C;  4ZBJ B;  1U35 C;  3LZ1 B;  1KU5 A;  1F66 D;  2BYK A;  4XUJ C;  5B24 A;  3AZE B;  5F99 B;  4XZQ A;  1P3F D;  4YS3 B;  1P3B D;  3MNN D;  4XUJ A;  3X1V B;  3UTA D;  1TZY B;  1P3P B;  3W99 A;  5AVB C;  3AZI B;  3WTP E;  4X23 B;  3UT9 C;  2FJ7 A;  3WTP D;  3UT9 A;  4QLC B;  3WKJ D;  5AVC C;  4WU9 D;  5CPJ A;  3R45 B;  3W96 D;  5DNN D;  5GSU D;  2F8N A;  1F66 B;  3AYW C;  5CP6 C;  3A6N A;  5B1L A;  4AWL C;  1KX4 C;  5B31 G;  5CP6 A;  3C1B D;  1P3F B;  1P3G D;  4KGC C;  1KX4 A;  3KUY D;  5B40 C;  5JRG B;  1P34 C;  5GT0 B;  3UTA B;  4J8W C;  3REJ B;  4LD9 A;  4E44 A;  3AN2 C;  5B40 A;  3AV1 D;  1P34 A;  5B1M D;  1P3K D;  4J8W A;  3REI A;  5FUG A;  3WTP B;  3AZF A;  3W98 C;  1P3A A;  4J8X A;  5CPI B;  5AV8 D;  5AV9 C;  1M19 C;  5B31 C;  3WKJ B;  3W98 A;  4WU9 B;  2NQB D;  1M19 A;  5B31 A;  5DNN B;  5AV6 D;  4CSR B;  5GSU B;  3X1S D;  3MGS A;  2NZD C;  5G49 B;  1U35 D;  5C3I B;  5B33 C;  1B6W A;  4Z66 C;  5B2I A;  3NQJ A;  2NZD A;  5JA4 A;  3C1B B;  1P3G B;  3KUY B;  5B33 A;  3AZI C;  4Z66 A;  3AZJ C;  5GXQ C;  4H9R A;  1P3I A;  1BH9 A;  5DNM C;  4JJN D;  5B1M B;  3AV1 B;  1P3K B;  5AVB D;  5GXQ A;  4H9P B;  4ZUX C;  3UT9 D;  3C1C A;  5B2J C;  5AV8 B;  4G92 B;  1TAF B;  5B2J A;  3REL C;  5AVC D;  5KDM B;  5AV6 B;  1R4V A;  3LJA C;  3REL A;  3X1S B;  3AFA A;  4EO5 B;  1U35 B;  3MGP A;  3AZN C;  1M1A D;  3LJA A;  3AYW D;  5CP6 D;  1S32 A;  4XUJ B;  4KGC D;  5B40 D;  1P34 D;  4J8W D;  5B32 G;  4WZS B;  5AVB B;  4WU8 D;  3REH A;  3AZL C;  3AN2 D;  2YFV A;  3UT9 B;  4NE3 A;  5AY8 C;  5BNX A;  3W98 D;  3MVD C;  1EQZ C;  5AY8 A;  3KXB C;  5AV9 D;  5B31 D;  5AVC B;  1AOI A; 
#chains in the Genus database with same CATH topology
 3B6G C;  2F8N B;  3LZ1 D;  1HQ3 A;  5BT1 C;  3B6F A;  4KUD C;  3TU4 A;  5B32 C;  2ZY4 A;  3B0D C;  3B6G A;  2NZD D;  3AYW B;  5CP6 B;  4AWL B;  3B0C T;  1KX4 B;  3LZ0 C;  5B33 D;  4KGC B;  1BH8 A;  3AZI D;  3MGQ A;  5B40 B;  2Y2O A;  3REK C;  3AZJ D;  1P34 B;  4J8W B;  5GXQ D;  5DNM D;  4E45 A;  5CPK C;  4ZUX D;  3W98 B;  4QLC D;  5B2J D;  4H9O A;  5CPK A;  5AV9 B;  1M19 B;  5B31 B;  2G5I C;  4HGA C;  3REL D;  5B24 C;  3O62 C;  4XZQ C;  2RVQ C;  2HIO C;  3VH5 T;  2ARO A;  2Y2Q A;  3X1T A;  3O62 A;  3NQJ B;  2NZD B;  3VH6 T;  5JA4 B;  2HIO A;  3W99 C;  3AZN D;  2F8N G;  4Z5T C;  5B33 B;  4Z66 B;  5JRG D;  1ZLA A;  5GT0 D;  2FJ7 C;  4WNN B;  3REJ D;  3AZG A;  4Z5T A;  3AZJ B;  5GXQ B;  2Y2P A;  3WA9 A;  5DNM B;  5CPJ C;  5CPI D;  4H9Q A;  2Y2H A;  3AZL D;  2ZY2 A;  4ZUX B;  4H9S A;  5AY8 D;  5B2J B;  4J8V A;  4R8P A;  3MVD D;  2UWX A;  3AZM A;  1EQZ D;  3W97 A;  3A6N C;  5B1L C;  3KXB D;  3LEL C;  3REL B;  5E5A C;  1P3O A;  3LEL A;  3B6G D;  3LJA B;  5BT1 D;  2F8N K;  2BYM A;  4KUD D;  5E5A A;  5B32 D;  3AZN B;  5GT3 C;  4LD9 C;  5CHL B;  3MGR C;  3NQU A;  3LZ0 D;  3REI C;  3AZF C;  1P3M A;  5GT3 A;  4NE5 A;  1P3A C;  3MGR A;  4J8X C;  2XD5 A;  1P3L A;  4KHA B;  3X1U A;  2ZM5 A;  3REH B;  3REK D;  3AZK A;  2YFV B;  4M6B A;  5BNX B;  1KX3 C;  1M18 C;  3IP4 C;  3AZL B;  1JFI A;  3EPH A;  5AY8 B;  3A1K A;  4UUZ B;  4J8U A;  1KX3 A;  1M18 A;  3MVD B;  3MGS C;  2RIQ A;  4Z2M G;  1EQZ B;  3V9R A;  3KXB B;  3P5J B;  3UTB A;  5B2I C;  5B24 D;  3O62 D;  3B6G B;  4DRB A;  4XZQ D;  2RVQ D;  4KUD B;  2CV5 C;  5B32 B;  4XUJ D;  3B0D B;  3WAA C;  1P3I C;  3AV2 C;  3W99 D;  2CV5 A;  1BH8 B;  3LZ0 B;  4Z5T D;  3WAA A;  4H9N B;  3C1C C;  2FJ7 D;  2HUE C;  2JE5 A;  3AV2 A;  3REK B;  4H9O B;  5CPJ D;  5CPK B;  3AFA C;  3MGP C;  2F8N D;  5F99 A;  3A6N D;  5B1L D;  1S32 C;  2BYK B;  4YS3 A;  4HGA B;  5B24 B;  3O62 B;  3X1V A;  4XZQ B;  1HTA A;  2HIO B;  1P3P A;  1KX4 D;  1ZLA B;  3F6T A;  5BNV A;  3W99 B;  5GT3 D;  4LD9 D;  4Z5T B;  3REH C;  2DF4 C;  3MGR D;  1N1J A;  2FJ7 B;  3REI D;  1WWS A;  3AZF D;  1P3A D;  4J8X D;  4H9Q B;  3R45 A;  2Y2I A;  3KSY A;  5CPJ B;  1M18 D;  1KX3 D;  1AOI C;  1HQ3 C;  3B0B A;  1M19 D;  3B6F C;  1F66 A;  3TU4 C;  1P3B C;  3MNN C;  3MGS D;  3A6N B;  5B1L B;  3LEL B;  1P3F A;  1P3B A;  2BYM B;  3MNN A;  5B2I D;  5BO0 A;  5E5A B;  3UTA A;  3MGQ C;  4Z66 D;  2CV5 D;  3NQU B;  3AL0 C;  1W2E A;  3B0C W;  3WAA D;  3WTP A;  5GT3 B;  1P3I D;  4LD9 B;  3MGR B;  3REI B;  5FUG B;  3AZF B;  1B67 A;  3C1C D;  3WKJ A;  1P3A B;  2Y2G A;  3W96 C;  4J8X B;  4WU9 A;  5BS7 A;  1JFI B;  3W96 A;  1KX3 B;  1M18 B;  4CSR A;  3KWQ C;  2ARO C;  3X1T C;  3AFA D;  3UTB B;  3MGS B;  3MGP D;  3KWQ A;  3C1B A;  1P3G A;  3LJA D;  1ZLA C;  2J8P A;  5B2I B;  3KUY A;  1S32 D;  4DQY B;  1F1E A;  3VH5 W;  3AZG C;  2F2A C;  2CV5 B;  5B1M A;  3VH6 W;  3WAA B;  4H9R B;  4H9P A;  1P3I B;  1BH9 B;  3WA9 C;  2IO5 C;  3AV2 B;  3EPK A;  3REH D;  2NQB C;  4H9S C;  4NFT A;  3C1C B;  5AV5 C;  2HUE B;  2PYO C;  2F8N H;  4J8V C;  4R8P C;  4G91 B;  2NQB A;  3AZM C;  3EG5 B;  3W97 C;  5AV5 A;  2PYO A;  2LY8 A;  5AV6 A;  2L5A A;  3X1S A;  3H0M C;  1P3O C;  1AOI D;  1U35 A;  1HQ3 D;  3B6F D;  3AFA B;  2Y2L A;  3TU4 D;  3MGP B;  5B0Z C;  1S32 B;  1KX5 C;  4JJN C;  5B0Z A;  1P3M C;  5B0Y C;  4YM6 C;  5BNV B;  1KX5 A;  4JJN A;  1P3L C;  3X1U C;  5AVB A;  3MGQ D;  3EPJ A;  1A7W A;  3AZH C;  2ZY3 A;  3AZK C;  1N1J B;  5B0Y A;  4YM6 A;  4WV4 B;  3AZH A;  4J8U C;  1ID3 C;  4DRA A;  5AVC A;  5CPK D;  1ID3 A;  1M1A C;  3UTB C;  1AOI B;  1HQ3 B;  1M1A A;  3B6F B;  3AYW A;  3TU4 B;  3KWQ D;  2ARO D;  3X1T D;  1P3B B;  3MNN B;  4CAY A;  5BO0 B;  2HIO D;  4KGC A;  1ZLA D;  4Z2M H;  4WU8 C;  2FFF B;  3AZG D;  1H3O A;  3MGQ B;  4WU8 A;  3AN2 A;  2YFW A;  2ZY5 A;  3WA9 D;  4G91 C;  4ZBJ C;  5AV9 A;  3LZ1 C;  5AV5 D;  2PYO D;  3W96 B;  4J8V D;  4R8P D;  1T3U A;  3AZE C;  3AZM D;  5F99 C;  3LZ1 A;  3W97 D;  1WWI A;  2JSS A;  4YS3 C;  3AZE A;  3X1V C;  1P3O D;  3LEL D;  1TZY C;  3VH5 A;  3KWQ B;  2ARO B;  3X1T B;  1P3P C;  3VH6 A;  5E5A D;  4WNN A;  4X23 C;  1TZY A;  5B0Z D;  3AZI A;  1KX5 D;  3AZJ A;  4X23 A;  1P3M D;  3AZG B;  5B0Y D;  4YM6 D;  4QLC C;  5DNM A;  1P3L D;  3X1U D;  3AZH D;  1Q9C A;  1ULY A;  3AZK D;  3WA9 B;  4ZUX A;  2IO5 B;  4QLC A;  4WJ3 C;  2NQB B;  1BFM A;  1F66 C;  5AV5 B;  2PYO B;  4J8U D;  3H0L C;  1ID3 D;  4J8V B;  4R8P B;  3AZM B;  3W97 B;  1P3F C;  3UTB D;  5JRG C;  1P3O B;  5GT0 C;  3UTA C;  3REJ C;  3KFU G;  3AZN A;  5JRG A;  5GT0 A;  3REJ A;  5B0Z B;  3WTP C;  4UPK A;  1KX5 B;  3H0R C;  4JJN B;  5CPI C;  2W8S A;  4KHA A;  1P3M B;  5B0Y B;  4YM6 B;  3WKJ C;  3AV2 D;  1P3L B;  4WU9 C;  5BS7 C;  3X1U B;  3AZH B;  5CPI A;  3AZK B;  3AZL A;  5DNN C;  4UUZ A;  5GSU C;  3MVD A;  1EQZ A;  4J8U B;  5DNN A;  5C3I C;  3KXB A;  1ID3 B;  5GSU A;  2DQN C;  3V9R B;  5G49 A;  3C1B C;  3AZE D;  1P3G C;  5F99 D;  1M1A B;  3KUY C;  4KUD A;  2G5H C;  2CWE A;  5B32 A;  4YS3 D;  4CAY B;  3X1V D;  1TZY D;  3AV1 C;  5B1M C;  1P3K C;  1P3P D;  3LZ0 A;  4H9N A;  4X23 D;  3AV1 A;  1P3K A;  1H3O B;  4NE6 A;  5AV8 C;  4WU8 B;  3AN2 B;  3REK A;  4G92 C;  2YFW B;  5AV8 A;  1TAF A;  5AV6 C;  3X1S C;  5KDM A;  4EO5 C;  4ZBJ B;  1U35 C;  3LZ1 B;  1KU5 A;  2Y2J A;  1F66 D;  2BYK A;  2Y2M A;  4XUJ C;  5B24 A;  5F99 B;  3AZE B;  4XZQ A;  1P3F D;  4YS3 B;  1P3B D;  3MNN D;  4XUJ A;  3X1V B;  2VQR A;  3UTA D;  2Y2N A;  1TZY B;  1P3P B;  3W99 A;  5AVB C;  3AZI B;  3WTP E;  4X23 B;  3UT9 C;  2FJ7 A;  3WTP D;  3UT9 A;  2Y2K A;  4QLC B;  3WKJ D;  5AVC C;  4WU9 D;  5CPJ A;  3R45 B;  1PZR A;  3W96 D;  5DNN D;  5GSU D;  2F8N A;  1F66 B;  3AYW C;  5CP6 C;  3A6N A;  5B1L A;  4AWL C;  1KX4 C;  5B31 G;  5CP6 A;  3C1B D;  1P3F B;  1P3G D;  4KGC C;  1KX4 A;  3KUY D;  3FDD A;  5B40 C;  5JRG B;  1P34 C;  5GT0 B;  3UTA B;  4J8W C;  3REJ B;  4LD9 A;  4E44 A;  3AN2 C;  5B40 A;  3AV1 D;  1P34 A;  5B1M D;  1P3K D;  4J8W A;  3REI A;  5FUG A;  3WTP B;  3AZF A;  3W98 C;  1P3A A;  4J8X A;  5CPI B;  5AV8 D;  5AV9 C;  1M19 C;  5B31 C;  3WKJ B;  3W98 A;  4WU9 B;  2BG1 A;  2NQB D;  1M19 A;  5B31 A;  5DNN B;  5AV6 D;  4CSR B;  5GSU B;  3X1S D;  3MGS A;  2NZD C;  2XD1 A;  5G49 B;  1U35 D;  5C3I B;  5B33 C;  1B6W A;  4Z66 C;  5B2I A;  3NQJ A;  2NZD A;  5JA4 A;  3C1B B;  1P3G B;  3KUY B;  5B33 A;  3AZI C;  4Z66 A;  3AZJ C;  3A1I A;  5GXQ C;  4H9R A;  1P3I A;  1BH9 A;  5DNM C;  4JJN D;  5B1M B;  3AV1 B;  1P3K B;  5AVB D;  5GXQ A;  4H9P B;  1Z2C B;  4ZUX C;  3UT9 D;  3C1C A;  5B2J C;  3EPL A;  5AV8 B;  4G92 B;  1TAF B;  5B2J A;  3REL C;  5AVC D;  5KDM B;  5AV6 B;  1R4V A;  3LJA C;  3REL A;  3X1S B;  3AFA A;  4EO5 B;  1U35 B;  3MGP A;  3AZN C;  1M1A D;  3LJA A;  3AYW D;  5CP6 D;  1S32 A;  4XUJ B;  2JCH A;  4KGC D;  5B40 D;  1P34 D;  4J8W D;  5B32 G;  4WZS B;  5AVB B;  4WU8 D;  3REH A;  3AZL C;  3AN2 D;  2YFV A;  3UT9 B;  4NE3 A;  5AY8 C;  5BNX A;  3W98 D;  3MVD C;  1EQZ C;  5AY8 A;  3KXB C;  5AV9 D;  5B31 D;  5AVC B;  1AOI A; 
#chains in the Genus database with same CATH homology
 3B6G C;  2F8N B;  3LZ1 D;  1HQ3 A;  5BT1 C;  3B6F A;  4KUD C;  3TU4 A;  5B32 C;  2ZY4 A;  3B0D C;  3B6G A;  2NZD D;  3AYW B;  5CP6 B;  4AWL B;  3B0C T;  1KX4 B;  3LZ0 C;  5B33 D;  4KGC B;  1BH8 A;  3AZI D;  3MGQ A;  5B40 B;  2Y2O A;  3REK C;  3AZJ D;  1P34 B;  4J8W B;  5GXQ D;  5DNM D;  4E45 A;  5CPK C;  4ZUX D;  3W98 B;  4QLC D;  5B2J D;  4H9O A;  5CPK A;  5AV9 B;  1M19 B;  5B31 B;  2G5I C;  4HGA C;  3REL D;  5B24 C;  3O62 C;  4XZQ C;  2RVQ C;  2HIO C;  3VH5 T;  2ARO A;  2Y2Q A;  3X1T A;  3O62 A;  3NQJ B;  2NZD B;  3VH6 T;  5JA4 B;  2HIO A;  3W99 C;  3AZN D;  2F8N G;  4Z5T C;  5B33 B;  4Z66 B;  5JRG D;  1ZLA A;  5GT0 D;  2FJ7 C;  4WNN B;  3REJ D;  3AZG A;  4Z5T A;  3AZJ B;  5GXQ B;  2Y2P A;  3WA9 A;  5DNM B;  5CPJ C;  5CPI D;  4H9Q A;  2Y2H A;  3AZL D;  2ZY2 A;  4ZUX B;  4H9S A;  5AY8 D;  5B2J B;  4J8V A;  4R8P A;  3MVD D;  2UWX A;  3AZM A;  1EQZ D;  3W97 A;  3A6N C;  5B1L C;  3KXB D;  3LEL C;  3REL B;  5E5A C;  1P3O A;  3LEL A;  3B6G D;  3LJA B;  5BT1 D;  2F8N K;  2BYM A;  4KUD D;  5E5A A;  5B32 D;  3AZN B;  5GT3 C;  4LD9 C;  5CHL B;  3MGR C;  3NQU A;  3LZ0 D;  3REI C;  3AZF C;  1P3M A;  5GT3 A;  4NE5 A;  1P3A C;  3MGR A;  4J8X C;  2XD5 A;  1P3L A;  4KHA B;  3X1U A;  2ZM5 A;  3REH B;  3REK D;  3AZK A;  2YFV B;  4M6B A;  5BNX B;  1KX3 C;  1M18 C;  3IP4 C;  3AZL B;  1JFI A;  3EPH A;  5AY8 B;  3A1K A;  4UUZ B;  4J8U A;  1KX3 A;  1M18 A;  3MVD B;  3MGS C;  2RIQ A;  4Z2M G;  1EQZ B;  3V9R A;  3KXB B;  3P5J B;  3UTB A;  5B2I C;  5B24 D;  3O62 D;  3B6G B;  4DRB A;  4XZQ D;  2RVQ D;  4KUD B;  2CV5 C;  5B32 B;  4XUJ D;  3B0D B;  3WAA C;  1P3I C;  3AV2 C;  3W99 D;  2CV5 A;  1BH8 B;  3LZ0 B;  4Z5T D;  3WAA A;  4H9N B;  3C1C C;  2FJ7 D;  2HUE C;  2JE5 A;  3AV2 A;  3REK B;  4H9O B;  5CPJ D;  5CPK B;  3AFA C;  3MGP C;  2F8N D;  5F99 A;  3A6N D;  5B1L D;  1S32 C;  2BYK B;  4YS3 A;  4HGA B;  5B24 B;  3O62 B;  3X1V A;  4XZQ B;  1HTA A;  2HIO B;  1P3P A;  1KX4 D;  1ZLA B;  3F6T A;  5BNV A;  3W99 B;  5GT3 D;  4LD9 D;  4Z5T B;  3REH C;  2DF4 C;  3MGR D;  1N1J A;  2FJ7 B;  3REI D;  1WWS A;  3AZF D;  1P3A D;  4J8X D;  4H9Q B;  3R45 A;  2Y2I A;  3KSY A;  5CPJ B;  1M18 D;  1KX3 D;  1AOI C;  1HQ3 C;  3B0B A;  1M19 D;  3B6F C;  1F66 A;  3TU4 C;  1P3B C;  3MNN C;  3MGS D;  3A6N B;  5B1L B;  3LEL B;  1P3F A;  1P3B A;  2BYM B;  3MNN A;  5B2I D;  5BO0 A;  5E5A B;  3UTA A;  3MGQ C;  4Z66 D;  2CV5 D;  3NQU B;  3AL0 C;  1W2E A;  3B0C W;  3WAA D;  3WTP A;  5GT3 B;  1P3I D;  4LD9 B;  3MGR B;  3REI B;  5FUG B;  3AZF B;  1B67 A;  3C1C D;  3WKJ A;  1P3A B;  2Y2G A;  3W96 C;  4J8X B;  4WU9 A;  5BS7 A;  1JFI B;  3W96 A;  1KX3 B;  1M18 B;  4CSR A;  3KWQ C;  2ARO C;  3X1T C;  3AFA D;  3UTB B;  3MGS B;  3MGP D;  3KWQ A;  3C1B A;  1P3G A;  3LJA D;  1ZLA C;  2J8P A;  5B2I B;  3KUY A;  1S32 D;  4DQY B;  1F1E A;  3VH5 W;  3AZG C;  2F2A C;  2CV5 B;  5B1M A;  3VH6 W;  3WAA B;  4H9R B;  4H9P A;  1P3I B;  1BH9 B;  3WA9 C;  2IO5 C;  3AV2 B;  3EPK A;  3REH D;  2NQB C;  4H9S C;  4NFT A;  3C1C B;  5AV5 C;  2HUE B;  2PYO C;  2F8N H;  4J8V C;  4R8P C;  4G91 B;  2NQB A;  3AZM C;  3EG5 B;  3W97 C;  5AV5 A;  2PYO A;  2LY8 A;  5AV6 A;  2L5A A;  3X1S A;  3H0M C;  1P3O C;  1AOI D;  1U35 A;  1HQ3 D;  3B6F D;  3AFA B;  2Y2L A;  3TU4 D;  3MGP B;  5B0Z C;  1S32 B;  1KX5 C;  4JJN C;  5B0Z A;  1P3M C;  5B0Y C;  4YM6 C;  5BNV B;  1KX5 A;  4JJN A;  1P3L C;  3X1U C;  5AVB A;  3MGQ D;  3EPJ A;  1A7W A;  3AZH C;  2ZY3 A;  3AZK C;  1N1J B;  5B0Y A;  4YM6 A;  4WV4 B;  3AZH A;  4J8U C;  1ID3 C;  4DRA A;  5AVC A;  5CPK D;  1ID3 A;  1M1A C;  3UTB C;  1AOI B;  1HQ3 B;  1M1A A;  3B6F B;  3AYW A;  3TU4 B;  3KWQ D;  2ARO D;  3X1T D;  1P3B B;  3MNN B;  4CAY A;  5BO0 B;  2HIO D;  4KGC A;  1ZLA D;  4Z2M H;  4WU8 C;  2FFF B;  3AZG D;  1H3O A;  3MGQ B;  4WU8 A;  3AN2 A;  2YFW A;  2ZY5 A;  3WA9 D;  4G91 C;  4ZBJ C;  5AV9 A;  3LZ1 C;  5AV5 D;  2PYO D;  3W96 B;  4J8V D;  4R8P D;  1T3U A;  3AZE C;  3AZM D;  5F99 C;  3LZ1 A;  3W97 D;  1WWI A;  2JSS A;  4YS3 C;  3AZE A;  3X1V C;  1P3O D;  3LEL D;  1TZY C;  3VH5 A;  3KWQ B;  2ARO B;  3X1T B;  1P3P C;  3VH6 A;  5E5A D;  4WNN A;  4X23 C;  1TZY A;  5B0Z D;  3AZI A;  1KX5 D;  3AZJ A;  4X23 A;  1P3M D;  3AZG B;  5B0Y D;  4YM6 D;  4QLC C;  5DNM A;  1P3L D;  3X1U D;  3AZH D;  1Q9C A;  1ULY A;  3AZK D;  3WA9 B;  4ZUX A;  2IO5 B;  4QLC A;  4WJ3 C;  2NQB B;  1BFM A;  1F66 C;  5AV5 B;  2PYO B;  4J8U D;  3H0L C;  1ID3 D;  4J8V B;  4R8P B;  3AZM B;  3W97 B;  1P3F C;  3UTB D;  5JRG C;  1P3O B;  5GT0 C;  3UTA C;  3REJ C;  3KFU G;  3AZN A;  5JRG A;  5GT0 A;  3REJ A;  5B0Z B;  3WTP C;  4UPK A;  1KX5 B;  3H0R C;  4JJN B;  5CPI C;  2W8S A;  4KHA A;  1P3M B;  5B0Y B;  4YM6 B;  3WKJ C;  3AV2 D;  1P3L B;  4WU9 C;  5BS7 C;  3X1U B;  3AZH B;  5CPI A;  3AZK B;  3AZL A;  5DNN C;  4UUZ A;  5GSU C;  3MVD A;  1EQZ A;  4J8U B;  5DNN A;  5C3I C;  3KXB A;  1ID3 B;  5GSU A;  2DQN C;  3V9R B;  5G49 A;  3C1B C;  3AZE D;  1P3G C;  5F99 D;  1M1A B;  3KUY C;  4KUD A;  2G5H C;  2CWE A;  5B32 A;  4YS3 D;  4CAY B;  3X1V D;  1TZY D;  3AV1 C;  5B1M C;  1P3K C;  1P3P D;  3LZ0 A;  4H9N A;  4X23 D;  3AV1 A;  1P3K A;  1H3O B;  4NE6 A;  5AV8 C;  4WU8 B;  3AN2 B;  3REK A;  4G92 C;  2YFW B;  5AV8 A;  1TAF A;  5AV6 C;  3X1S C;  5KDM A;  4EO5 C;  4ZBJ B;  1U35 C;  3LZ1 B;  1KU5 A;  2Y2J A;  1F66 D;  2BYK A;  2Y2M A;  4XUJ C;  5B24 A;  5F99 B;  3AZE B;  4XZQ A;  1P3F D;  4YS3 B;  1P3B D;  3MNN D;  4XUJ A;  3X1V B;  2VQR A;  3UTA D;  2Y2N A;  1TZY B;  1P3P B;  3W99 A;  5AVB C;  3AZI B;  3WTP E;  4X23 B;  3UT9 C;  2FJ7 A;  3WTP D;  3UT9 A;  2Y2K A;  4QLC B;  3WKJ D;  5AVC C;  4WU9 D;  5CPJ A;  3R45 B;  1PZR A;  3W96 D;  5DNN D;  5GSU D;  2F8N A;  1F66 B;  3AYW C;  5CP6 C;  3A6N A;  5B1L A;  4AWL C;  1KX4 C;  5B31 G;  5CP6 A;  3C1B D;  1P3F B;  1P3G D;  4KGC C;  1KX4 A;  3KUY D;  3FDD A;  5B40 C;  5JRG B;  1P34 C;  5GT0 B;  3UTA B;  4J8W C;  3REJ B;  4LD9 A;  4E44 A;  3AN2 C;  5B40 A;  3AV1 D;  1P34 A;  5B1M D;  1P3K D;  4J8W A;  3REI A;  5FUG A;  3WTP B;  3AZF A;  3W98 C;  1P3A A;  4J8X A;  5CPI B;  5AV8 D;  5AV9 C;  1M19 C;  5B31 C;  3WKJ B;  3W98 A;  4WU9 B;  2BG1 A;  2NQB D;  1M19 A;  5B31 A;  5DNN B;  5AV6 D;  4CSR B;  5GSU B;  3X1S D;  3MGS A;  2NZD C;  2XD1 A;  5G49 B;  1U35 D;  5C3I B;  5B33 C;  1B6W A;  4Z66 C;  5B2I A;  3NQJ A;  2NZD A;  5JA4 A;  3C1B B;  1P3G B;  3KUY B;  5B33 A;  3AZI C;  4Z66 A;  3AZJ C;  3A1I A;  5GXQ C;  4H9R A;  1P3I A;  1BH9 A;  5DNM C;  4JJN D;  5B1M B;  3AV1 B;  1P3K B;  5AVB D;  5GXQ A;  4H9P B;  1Z2C B;  4ZUX C;  3UT9 D;  3C1C A;  5B2J C;  3EPL A;  5AV8 B;  4G92 B;  1TAF B;  5B2J A;  3REL C;  5AVC D;  5KDM B;  5AV6 B;  1R4V A;  3LJA C;  3REL A;  3X1S B;  3AFA A;  4EO5 B;  1U35 B;  3MGP A;  3AZN C;  1M1A D;  3LJA A;  3AYW D;  5CP6 D;  1S32 A;  4XUJ B;  2JCH A;  4KGC D;  5B40 D;  1P34 D;  4J8W D;  5B32 G;  4WZS B;  5AVB B;  4WU8 D;  3REH A;  3AZL C;  3AN2 D;  2YFV A;  3UT9 B;  4NE3 A;  5AY8 C;  5BNX A;  3W98 D;  3MVD C;  1EQZ C;  5AY8 A;  3KXB C;  5AV9 D;  5B31 D;  5AVC B;  1AOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...