5DNMB

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmB00
3UTBD 4HGAB 5GT3D 5DNNA 3AN2B 4AWLC 5B32C 1U35B 1WWIA 5AY8B 1P3LC 3LJAB 3X1TB 5KDMB 5CP6B 3WAAC 1F66D 5AV8A 3X1TD 1AOIA 4QLCD 4KUDC 1P3LB 4KGCA 2AROB 2F8NH 3LZ0A 3AYWC 3W97B 2YFWB 2RVQC 3REJC 5AV8D 3AZKB 5G49B 1F66A 1P3IB 2PYOB 1Q9CA 4G91C 3AZKD 2FJ7A 3V9RB 3B0CT 2IO5C 4H9OB 3A6ND 5B32A 2HUEC 3KSYA 5AVCC 5DNNC 1ID3D 3REHD 3MGQA 4XUJC 3UTAD 5B0YD 2CV5A 1JFIA 2HUEB 3W98D 1ID3B 1ZLAA 2L5AA 3O62C 3UT9B 3UTAB 5B0YA 1P3MB 2CWEA 3KWQA 3A6NA 3R45A 3AZHD 3REJB 3AZMA 1M19D 3B6FD 3AFAC 2YFVA 1KX5B 4DRAA 1S32A 3MGPB 5DNMB 3X1VA 5BNVA 4ZUXD 3X1UA 4J8WC 1P3KC 4H9SA 3W96D 3REKC 4QLCC 4KUDD 5AY8D 5B2IB 3W96A 3AZMD 5CPKA 3VH6W 3AZLC 5B2ID 4ZBJB 5B33A 5FUGA 4ZUXA 2AROD 5GXQD 1P3IC 3KXBA 4J8UC 5AVCD 3AZNB 5CPJC 3AZID 1ULYA 3MGQC 1KX3B 4WV4B 2JSSA 5AVCB 5B40A 5JRGB 5B1MC 2BYMB 5GSUB 2NQBD 3MGSB 2F8NA 4XZQA 3B6GB 2FJ7C 5B24C 1P3OA 4Z66A 3WKJB 5CPIC 3MGSD 3KXBD 4Z5TC 1P3MC 3B6FA 4YM6C 5B1LA 3LZ1C 4CAYA 1P3OD 4Z66B 4R8PC 3WKJA 3AYWA 5GXQC 3AV1C 2NQBA 3VH5W 3LZ1A 4R8PB 3MGSA 1BH9B 3LZ0D 4WU9B 1P3FB 4Z5TA 1P3GB 5GT3C 4JJNC 1P3GC 3WAAA 2F8NG 5JA4B 3W99B 2NZDB 3AZNA 3AZKC 1KX5D 1P3KD 5JA4A 2NZDA 4KGCD 1TZYA 5B31G 2HIOB 3W96B 3C1CC 5B24B 1BH8B 1BH9A 4R8PA 3MVDA 5CPKC 4DRBA 3X1UB 3AYWB 5DNMA 4YM6A 3MGPA 1KX3C 5CHLB 4Z66C 5B1LB 4AWLB 5GXQB 5B32D 3AZHA 3MGRA 1M1AA 3C1BD 3R45B 4XZQB 5GT0D 3X1SA 3AZLB 5B31B 1KX3A 5CPJA 5AV5D 5F99D 3B6GD 1F1EA 4ZUXC 3X1SD 1HQ3D 2CV5B 3KXBB 3AZGC 3MGQB 4NE5A 3UTBB 3AN2D 5GT3B 2CV5D 4KHAB 4G92B 1TZYC 3KUYA 1P34A 4QLCA 1M19C 3X1TC 4E44A 5B2IA 1F66B 4WU9D 1P3FD 4J8XD 3AZKA 4NE6A 1P3AB 1B6WA 1N1JA 1P3LD 3W97A 5BNVB 3W99D 3NQJB 3MGPC 2YFVB 1P3KB 3KUYD 5AV8B 3REJA 1WWSA 3NQJA 3KWQB 3LJAA 5B1LC 3O62A 3AFAD 1U35A 1P3MA 3B6FC 5DNNB 5AV8C 2NZDC 3LELA 4XUJA 3C1CD 5BNXA 3AYWD 4G92C 3VH5T 3MNND 1JFIB 3UT9C 1B67A 3C1CB 1HQ3C 1P34B 4KHAA 5B32B 1KX4D 5GT3A 4H9OA 3KUYC 1F66C 5E5AD 1P34D 2IO5B 1P3IA 1KX4B 5BT1D 3WA9C 5BNXB 3LELB 5CPJB 5B31A 3AZLA 3X1SB 3W96C 3O62B 4NE3A 1KX4C 2AROA 5AV9C 3VH6A 3REKA 3W97C 1TZYD 3AZGD 1AOIB 4YM6D 2RVQD 3MGRB 1M1AB 3WTPD 3AV2C 3X1UC 1P3KA 3B0DB 3AZHC 3X1TA 1AOID 1H3OB 5B0ZC 4YM6B 3MGRD 1P3PC 1M1AD 3AFAA 1U35D 1N1JB 5GT0C 3MVDB 1P3AA 5DNMC 4J8UA 3AZIC 4EO5B 5B33C 3MVDD 3KWQC 3AZND 3AZGA 4QLCB 4J8UD 5B0YC 4EO5C 3KUYB 4H9PA 4WU8C 2PYOD 5B32G 1KX3D 3UTBA 5BO0B 5GT0A 4UUZA 3REHB 3WAAB 4H9SC 3WKJD 1BFMA 3X1VC 3AV2A 1S32C 4WZSB 3MGRC 1M1AC 1P3GA 4H9NB 3UT9D 3W98A 5AV5A 4WU9A 1P3FA 5C3IC 4Z2MH 3LZ1B 5AVBC 2F8NK 3AV1A 3AZHB 5GXQA 1P3GD 4JJNB 5C3IB 3WKJC 3B6FB 1TAFA 3B0BA 3AZJC 4JJND 5CPJD 3B0CW 4H9QA 3B6GA 4X23A 1BH8A 5B24A 3O62D 4LD9B 5B40B 5AVCA 4XZQC 4KUDB 2BYKB 1M19B 5B1MA 2HIOA 3AZNC 5B33D 4XUJD 3UTAC 5B40C 1TZYB 3WA9B 5DNMD 5AV6D 4J8VD 4ZUXB 5FUGB 3LJAD 5B24D 5CPKD 3AZJA 5B33B 1EQZD 1U35C 3KXBC 4YS3A 1M18A 3MGSC 3W99A 5B1MD 2NQBC 5CPKB 3VH5A 5BS7C 1P3BA 1EQZB 4Z2MG 5B1LD 3RELC 4KGCC 4Z5TB 1S32D 3C1BB 5AVBA 5GSUD 2NQBB 3RELB 5AV5C 4XZQD 1S32B 4CAYB 3AZLD 3AZFD 4H9RB 3AZIB 3AZEB 5B2IC 3WAAD 5JRGD 1P3OB 5E5AC 1HQ3B 3A6NB 1P34C 4CSRB 3AZMC 4LD9C 2F8NB 3UTBC 2BYMA 5GSUA 4E45A 4WU8A 4R8PD 5JRGA 3B0DC 4CSRA 5B0YB 3MNNA 1ID3C 3LZ1D 2F8ND 3MNNC 3AN2C 1ID3A 1ZLAB 3REIC 4H9RA 3AZIA 4J8WD 2NZDD 5AV6A 4J8VA 2FJ7D 4WNNB 1ZLAD 3X1SC 5B2JB 3TU4A 5AVBB 3REJD 2FJ7B 2PYOA 1R4VA 5B2JD 3TU4D 4LD9D 5G49A 3MGPD 2AROC 3REHC 5B2JA 3TU4B 3WA9D 5BT1C 3X1VB 4WNNA 3A6NC 3KWQD 3MVDC 5AV6B 4J8VB 4KGCB 4NFTA 1HTAA 4G91B 4M6BA 5DNND 3WTPE 1KX5A 3WA9A 3AZMB 5B1MB 5AY8C 5GSUC 4KUDA 5CP6C 3MNNB 1ZLAC 1AOIC 4LD9A 4WU8B 2CV5C 4Z5TD 3X1UD 3WTPC 3AV2D 1HQ3A 3UTAA 3UT9A 3RELD 1P3PB 1TAFB 5E5AB 5F99B 3AZEA 1P3PA 3WTPA 4JJNA 4X23C 3LELC 3B6GC 5F99C 4HGAC 3VH6T 3AZFB 3MGQD 3AZED 2LY8A 1EQZC 3LJAC 1KU5A 3RELA 3REIB 3AZFC 3V9RA 3C1BA 5AV5B 3C1BC 3LZ0C 4YS3D 1M18D 3W99C 5AV9B 3NQUB 4YS3C 3AZJD 1P3BB 4Z66D 5B2JC 1M18C 4ZBJC 1EQZA 4J8XB 4UUZB 3REHA 5CPIA 2YFWA 4YS3B 1P3AD 1M18B 1P3OC 4J8WB 4WU9C 1P3FC 3AZJB 1P3BD 3LZ0B 3AZEC 2HIOC 1P3LA 4H9PB 4X23D 5AVBD 2BYKA 1M19A 1A7WA 5AV6C 4J8VC 3W97D 5KDMA 5CP6A 4X23B 4J8UB 4H9QB 5AY8A 3AN2A 3AFAB 1KX5C 1H3OA 2HIOD 1P3ID 3X1VD 5JRGC 1P3AC 3AV1B 3REKB 5B0ZA 3W98C 4J8XC 3AV1D 4WU8D 4J8WA 2PYOC 4H9NA 3W98B 3REKD 5CPIB 4J8XA 3AV2B 3TU4C 3NQUA 1P3MD 5AV9A 1P3PD 5B0ZD 1KX4A 5CPID 3LELD 5GT0B 5B31C 3REIA 5BO0A 5B31D 5B0ZB 5BS7A 1P3BC 3AZFA 3C1CA 3REID 3AZGB 5B40D 3WTPB 5F99A 5E5AA 5CP6D 4XUJB 5AV9D
chains in the Genus database with same CATH superfamily
3UTBD 4HGAB 5GT3D 5DNNA 3AN2B 3IP4C 4AWLC 5B32C 1U35B 1WWIA 5AY8B 1P3LC 3LJAB 3X1TB 5KDMB 5CP6B 1W2EA 3WAAC 1F66D 5AV8A 3X1TD 1AOIA 4QLCD 4KUDC 2VQRA 1P3LB 4KGCA 2AROB 2Y2OA 3LZ0A 2F8NH 3AYWC 3W97B 2YFWB 2RVQC 3REJC 5AV8D 3AZKB 5G49B 1F66A 1P3IB 3A1IA 2PYOB 1Q9CA 4G91C 3AZKD 2FJ7A 3V9RB 3B0CT 2IO5C 2ZY4A 4H9OB 3A6ND 5B32A 2HUEC 3KSYA 5AVCC 5DNNC 1ID3D 3REHD 3MGQA 4XUJC 3UTAD 5B0YD 2CV5A 1JFIA 2HUEB 3W98D 1ID3B 1ZLAA 2L5AA 3O62C 3UT9B 3UTAB 5B0YA 1P3MB 2CWEA 3KWQA 2Y2JA 3A6NA 3R45A 3AZHD 3REJB 3AZMA 1M19D 3B6FD 3AFAC 2YFVA 1KX5B 4DRAA 2RIQA 1S32A 3MGPB 5DNMB 4DQYB 3X1VA 5BNVA 4ZUXD 3X1UA 4J8WC 1P3KC 4H9SA 3W96D 3REKC 4QLCC 4KUDD 5AY8D 5B2IB 3W96A 3AZMD 2ZY3A 3VH6W 3AZLC 5CPKA 5B2ID 4ZBJB 5B33A 5FUGA 4ZUXA 2AROD 5GXQD 1P3IC 3KXBA 4J8UC 5AVCD 3AZNB 5CPJC 3AZID 1ULYA 3MGQC 1KX3B 4WV4B 2JSSA 5AVCB 5B40A 5JRGB 5B1MC 2BYMB 5GSUB 2NQBD 3MGSB 2F8NA 4XZQA 3B6GB 2FJ7C 5B24C 1P3OA 4Z66A 3WKJB 5CPIC 3MGSD 2Y2HA 3KXBD 4Z5TC 1P3MC 3B6FA 4YM6C 5B1LA 3LZ1C 4CAYA 1P3OD 4Z66B 4R8PC 3WKJA 2XD1A 3AYWA 5GXQC 3AV1C 2NQBA 3VH5W 3LZ1A 4R8PB 3MGSA 1BH9B 3LZ0D 4WU9B 1P3FB 4Z5TA 1P3GB 5GT3C 4JJNC 1P3GC 3WAAA 2F8NG 5JA4B 3W99B 2NZDB 3AZNA 3AZKC 1KX5D 1P3KD 5JA4A 2NZDA 4KGCD 1TZYA 5B31G 2HIOB 3W96B 1Z2CB 3C1CC 5B24B 1BH8B 1BH9A 4R8PA 3MVDA 5CPKC 4DRBA 3X1UB 3AYWB 5DNMA 4YM6A 3MGPA 1KX3C 5CHLB 4Z66C 5B1LB 4AWLB 5GXQB 5B32D 3AZHA 3MGRA 1M1AA 3C1BD 2FFFB 3R45B 4XZQB 5GT0D 3X1SA 3AZLB 5B31B 1KX3A 5CPJA 5AV5D 5F99D 3B6GD 1F1EA 4ZUXC 3X1SD 1HQ3D 2CV5B 3KXBB 3AZGC 3MGQB 4NE5A 4UPKA 3UTBB 5GT3B 3AN2D 2CV5D 4KHAB 4G92B 1TZYC 3KUYA 1P34A 4QLCA 1M19C 2JE5A 4E44A 5B2IA 3X1TC 1F66B 4WU9D 1P3FD 2Y2QA 4J8XD 3AZKA 4NE6A 3EG5B 1P3AB 2UWXA 1B6WA 1N1JA 1P3LD 3W97A 5BNVB 3W99D 3NQJB 3MGPC 2YFVB 1P3KB 3KUYD 5AV8B 3EPLA 3REJA 1WWSA 3KFUG 3NQJA 3KWQB 3LJAA 5B1LC 3O62A 3AFAD 1U35A 1P3MA 3B6FC 5DNNB 5AV8C 2NZDC 3LELA 4XUJA 3C1CD 5BNXA 3AYWD 4G92C 3VH5T 3MNND 1JFIB 3UT9C 1B67A 4WJ3C 3C1CB 1HQ3C 3H0LC 1P34B 2F2AC 4KHAA 5B32B 1KX4D 5GT3A 4H9OA 2Y2MA 3KUYC 1F66C 5E5AD 1P34D 2IO5B 1P3IA 1KX4B 2Y2PA 5BT1D 3WA9C 5BNXB 3LELB 5CPJB 5B31A 3AZLA 3X1SB 3W96C 3O62B 3EPKA 4NE3A 1KX4C 2AROA 5AV9C 3VH6A 3REKA 3W97C 1TZYD 3AZGD 1AOIB 4YM6D 2RVQD 3MGRB 1M1AB 3WTPD 3AV2C 3X1UC 1P3KA 3B0DB 3AZHC 3X1TA 1AOID 1H3OB 5B0ZC 4YM6B 3MGRD 1P3PC 1M1AD 3AFAA 1U35D 1N1JB 5GT0C 3MVDB 1P3AA 5DNMC 4J8UA 3AZIC 4EO5B 5B33C 3MVDD 3KWQC 3AZND 3AZGA 4QLCB 4J8UD 5B0YC 4EO5C 3KUYB 4H9PA 2W8SA 4WU8C 2PYOD 5B32G 1KX3D 1PZRA 3UTBA 5BO0B 5GT0A 4UUZA 3REHB 3WAAB 4H9SC 3WKJD 1BFMA 3X1VC 3AV2A 3FDDA 1S32C 4WZSB 3MGRC 1M1AC 1P3GA 4H9NB 3UT9D 3W98A 5AV5A 4WU9A 1P3FA 5C3IC 4Z2MH 3LZ1B 5AVBC 2F8NK 3AV1A 3AZHB 5GXQA 1P3GD 4JJNB 5C3IB 3WKJC 3B6FB 1TAFA 3AL0C 3B0BA 3AZJC 4JJND 3H0MC 5CPJD 3B0CW 4H9QA 3B6GA 4X23A 1BH8A 5B24A 2Y2GA 3O62D 4LD9B 5B40B 5AVCA 3EPHA 4XZQC 4KUDB 2BYKB 1M19B 2ZY5A 2HIOA 5B1MA 3AZNC 5B33D 4XUJD 3UTAC 5B40C 1TZYB 3WA9B 2ZM5A 5DNMD 5AV6D 4J8VD 4ZUXB 5FUGB 3LJAD 5B24D 5CPKD 3AZJA 5B33B 1EQZD 1U35C 3KXBC 4YS3A 1M18A 3MGSC 3A1KA 5B1MD 3W99A 2NQBC 5CPKB 3VH5A 5BS7C 1P3BA 1EQZB 4Z2MG 2DQNC 5B1LD 3RELC 4KGCC 4Z5TB 1S32D 3C1BB 5AVBA 5GSUD 2Y2LA 3RELB 2NQBB 5AV5C 2G5IC 4XZQD 1S32B 4CAYB 2BG1A 3AZLD 3AZFD 4H9RB 3AZIB 3AZEB 5B2IC 3WAAD 5JRGD 1P3OB 2JCHA 5E5AC 1HQ3B 3A6NB 1P34C 4CSRB 3AZMC 4LD9C 2F8NB 3UTBC 2BYMA 5GSUA 4E45A 4WU8A 4R8PD 3B0DC 4CSRA 5B0YB 5JRGA 3MNNA 1ID3C 3LZ1D 2F8ND 3MNNC 3AN2C 1ID3A 1ZLAB 3REIC 4H9RA 3AZIA 4J8WD 3H0RC 3P5JB 2NZDD 5AV6A 4J8VA 2FJ7D 4WNNB 1ZLAD 3X1SC 5B2JB 3TU4A 5AVBB 3REJD 2FJ7B 2PYOA 1R4VA 5B2JD 3TU4D 2G5HC 2Y2KA 4LD9D 5G49A 3MGPD 2AROC 3REHC 5B2JA 3TU4B 3WA9D 5BT1C 3X1VB 4WNNA 3A6NC 3KWQD 3MVDC 5AV6B 4J8VB 4KGCB 4NFTA 1HTAA 4G91B 4M6BA 5DNND 3WTPE 1KX5A 3WA9A 3AZMB 5B1MB 5AY8C 2DF4C 5GSUC 2J8PA 4KUDA 2Y2IA 5CP6C 3MNNB 1ZLAC 1AOIC 4LD9A 4WU8B 2ZY2A 2CV5C 4Z5TD 3X1UD 3WTPC 3AV2D 1HQ3A 3UTAA 3UT9A 3RELD 1P3PB 1TAFB 5E5AB 5F99B 3AZEA 1P3PA 3WTPA 4JJNA 4X23C 3LELC 3B6GC 5F99C 4HGAC 3VH6T 3AZFB 3MGQD 3AZED 2LY8A 1EQZC 3LJAC 1KU5A 3RELA 3REIB 3AZFC 3V9RA 3C1BA 5AV5B 3F6TA 3C1BC 3LZ0C 4YS3D 1M18D 3W99C 5AV9B 3NQUB 4YS3C 3AZJD 1P3BB 4Z66D 5B2JC 1M18C 4ZBJC 1EQZA 4J8XB 4UUZB 3REHA 5CPIA 2YFWA 4YS3B 1P3AD 1M18B 1P3OC 4J8WB 4WU9C 1P3FC 3AZJB 1P3BD 3LZ0B 3AZEC 2HIOC 1P3LA 4H9PB 4X23D 5AVBD 2BYKA 1M19A 1A7WA 5AV6C 4J8VC 3W97D 5KDMA 5CP6A 4X23B 4J8UB 4H9QB 5AY8A 3AN2A 3AFAB 1KX5C 1H3OA 2HIOD 1P3ID 3X1VD 5JRGC 1P3AC 3AV1B 2Y2NA 3REKB 5B0ZA 3W98C 4J8XC 3AV1D 4WU8D 4J8WA 2PYOC 4H9NA 3W98B 3REKD 5CPIB 4J8XA 3AV2B 3TU4C 3NQUA 1P3MD 5AV9A 1P3PD 5B0ZD 2XD5A 1KX4A 5CPID 3LELD 5GT0B 5B31C 3REIA 5BO0A 5B31D 5B0ZB 5BS7A 1P3BC 3AZFA 3EPJA 3C1CA 3REID 3AZGB 5B40D 3WTPB 5F99A 1T3UA 5E5AA 5CP6D 4XUJB 5AV9D
chains in the Genus database with same CATH topology
3UTBD 4HGAB 5GT3D 5DNNA 3AN2B 3IP4C 4AWLC 5B32C 1U35B 1WWIA 5AY8B 1P3LC 3LJAB 3X1TB 5KDMB 5CP6B 1W2EA 3WAAC 1F66D 5AV8A 3X1TD 1AOIA 4QLCD 4KUDC 2VQRA 1P3LB 4KGCA 2AROB 2Y2OA 3LZ0A 2F8NH 3AYWC 3W97B 2YFWB 2RVQC 3REJC 5AV8D 3AZKB 5G49B 1F66A 1P3IB 3A1IA 2PYOB 1Q9CA 4G91C 3AZKD 2FJ7A 3V9RB 3B0CT 2IO5C 2ZY4A 4H9OB 3A6ND 5B32A 2HUEC 3KSYA 5AVCC 5DNNC 1ID3D 3REHD 3MGQA 4XUJC 3UTAD 5B0YD 2CV5A 1JFIA 2HUEB 3W98D 1ID3B 1ZLAA 2L5AA 3O62C 3UT9B 3UTAB 5B0YA 1P3MB 2CWEA 3KWQA 2Y2JA 3A6NA 3R45A 3AZHD 3REJB 3AZMA 1M19D 3B6FD 3AFAC 2YFVA 1KX5B 4DRAA 2RIQA 1S32A 3MGPB 5DNMB 4DQYB 3X1VA 5BNVA 4ZUXD 3X1UA 4J8WC 1P3KC 4H9SA 3W96D 3REKC 4QLCC 4KUDD 5AY8D 5B2IB 3W96A 3AZMD 2ZY3A 3VH6W 3AZLC 5CPKA 5B2ID 4ZBJB 5B33A 5FUGA 4ZUXA 2AROD 5GXQD 1P3IC 3KXBA 4J8UC 5AVCD 3AZNB 5CPJC 3AZID 1ULYA 3MGQC 1KX3B 4WV4B 2JSSA 5AVCB 5B40A 5JRGB 5B1MC 2BYMB 5GSUB 2NQBD 3MGSB 2F8NA 4XZQA 3B6GB 2FJ7C 5B24C 1P3OA 4Z66A 3WKJB 5CPIC 3MGSD 2Y2HA 3KXBD 4Z5TC 1P3MC 3B6FA 4YM6C 5B1LA 3LZ1C 4CAYA 1P3OD 4Z66B 4R8PC 3WKJA 2XD1A 3AYWA 5GXQC 3AV1C 2NQBA 3VH5W 3LZ1A 4R8PB 3MGSA 1BH9B 3LZ0D 4WU9B 1P3FB 4Z5TA 1P3GB 5GT3C 4JJNC 1P3GC 3WAAA 2F8NG 5JA4B 3W99B 2NZDB 3AZNA 3AZKC 1KX5D 1P3KD 5JA4A 2NZDA 4KGCD 1TZYA 5B31G 2HIOB 3W96B 1Z2CB 3C1CC 5B24B 1BH8B 1BH9A 4R8PA 3MVDA 5CPKC 4DRBA 3X1UB 3AYWB 5DNMA 4YM6A 3MGPA 1KX3C 5CHLB 4Z66C 5B1LB 4AWLB 5GXQB 5B32D 3AZHA 3MGRA 1M1AA 3C1BD 2FFFB 3R45B 4XZQB 5GT0D 3X1SA 3AZLB 5B31B 1KX3A 5CPJA 5AV5D 5F99D 3B6GD 1F1EA 4ZUXC 3X1SD 1HQ3D 2CV5B 3KXBB 3AZGC 3MGQB 4NE5A 4UPKA 3UTBB 5GT3B 3AN2D 2CV5D 4KHAB 4G92B 1TZYC 3KUYA 1P34A 4QLCA 1M19C 2JE5A 4E44A 5B2IA 3X1TC 1F66B 4WU9D 1P3FD 2Y2QA 4J8XD 3AZKA 4NE6A 3EG5B 1P3AB 2UWXA 1B6WA 1N1JA 1P3LD 3W97A 5BNVB 3W99D 3NQJB 3MGPC 2YFVB 1P3KB 3KUYD 5AV8B 3EPLA 3REJA 1WWSA 3KFUG 3NQJA 3KWQB 3LJAA 5B1LC 3O62A 3AFAD 1U35A 1P3MA 3B6FC 5DNNB 5AV8C 2NZDC 3LELA 4XUJA 3C1CD 5BNXA 3AYWD 4G92C 3VH5T 3MNND 1JFIB 3UT9C 1B67A 4WJ3C 3C1CB 1HQ3C 3H0LC 1P34B 2F2AC 4KHAA 5B32B 1KX4D 5GT3A 4H9OA 2Y2MA 3KUYC 1F66C 5E5AD 1P34D 2IO5B 1P3IA 1KX4B 2Y2PA 5BT1D 3WA9C 5BNXB 3LELB 5CPJB 5B31A 3AZLA 3X1SB 3W96C 3O62B 3EPKA 4NE3A 1KX4C 2AROA 5AV9C 3VH6A 3REKA 3W97C 1TZYD 3AZGD 1AOIB 4YM6D 2RVQD 3MGRB 1M1AB 3WTPD 3AV2C 3X1UC 1P3KA 3B0DB 3AZHC 3X1TA 1AOID 1H3OB 5B0ZC 4YM6B 3MGRD 1P3PC 1M1AD 3AFAA 1U35D 1N1JB 5GT0C 3MVDB 1P3AA 5DNMC 4J8UA 3AZIC 4EO5B 5B33C 3MVDD 3KWQC 3AZND 3AZGA 4QLCB 4J8UD 5B0YC 4EO5C 3KUYB 4H9PA 2W8SA 4WU8C 2PYOD 5B32G 1KX3D 1PZRA 3UTBA 5BO0B 5GT0A 4UUZA 3REHB 3WAAB 4H9SC 3WKJD 1BFMA 3X1VC 3AV2A 3FDDA 1S32C 4WZSB 3MGRC 1M1AC 1P3GA 4H9NB 3UT9D 3W98A 5AV5A 4WU9A 1P3FA 5C3IC 4Z2MH 3LZ1B 5AVBC 2F8NK 3AV1A 3AZHB 5GXQA 1P3GD 4JJNB 5C3IB 3WKJC 3B6FB 1TAFA 3AL0C 3B0BA 3AZJC 4JJND 3H0MC 5CPJD 3B0CW 4H9QA 3B6GA 4X23A 1BH8A 5B24A 2Y2GA 3O62D 4LD9B 5B40B 5AVCA 3EPHA 4XZQC 4KUDB 2BYKB 1M19B 2ZY5A 2HIOA 5B1MA 3AZNC 5B33D 4XUJD 3UTAC 5B40C 1TZYB 3WA9B 2ZM5A 5DNMD 5AV6D 4J8VD 4ZUXB 5FUGB 3LJAD 5B24D 5CPKD 3AZJA 5B33B 1EQZD 1U35C 3KXBC 4YS3A 1M18A 3MGSC 3A1KA 5B1MD 3W99A 2NQBC 5CPKB 3VH5A 5BS7C 1P3BA 1EQZB 4Z2MG 2DQNC 5B1LD 3RELC 4KGCC 4Z5TB 1S32D 3C1BB 5AVBA 5GSUD 2Y2LA 3RELB 2NQBB 5AV5C 2G5IC 4XZQD 1S32B 4CAYB 2BG1A 3AZLD 3AZFD 4H9RB 3AZIB 3AZEB 5B2IC 3WAAD 5JRGD 1P3OB 2JCHA 5E5AC 1HQ3B 3A6NB 1P34C 4CSRB 3AZMC 4LD9C 2F8NB 3UTBC 2BYMA 5GSUA 4E45A 4WU8A 4R8PD 3B0DC 4CSRA 5B0YB 5JRGA 3MNNA 1ID3C 3LZ1D 2F8ND 3MNNC 3AN2C 1ID3A 1ZLAB 3REIC 4H9RA 3AZIA 4J8WD 3H0RC 3P5JB 2NZDD 5AV6A 4J8VA 2FJ7D 4WNNB 1ZLAD 3X1SC 5B2JB 3TU4A 5AVBB 3REJD 2FJ7B 2PYOA 1R4VA 5B2JD 3TU4D 2G5HC 2Y2KA 4LD9D 5G49A 3MGPD 2AROC 3REHC 5B2JA 3TU4B 3WA9D 5BT1C 3X1VB 4WNNA 3A6NC 3KWQD 3MVDC 5AV6B 4J8VB 4KGCB 4NFTA 1HTAA 4G91B 4M6BA 5DNND 3WTPE 1KX5A 3WA9A 3AZMB 5B1MB 5AY8C 2DF4C 5GSUC 2J8PA 4KUDA 2Y2IA 5CP6C 3MNNB 1ZLAC 1AOIC 4LD9A 4WU8B 2ZY2A 2CV5C 4Z5TD 3X1UD 3WTPC 3AV2D 1HQ3A 3UTAA 3UT9A 3RELD 1P3PB 1TAFB 5E5AB 5F99B 3AZEA 1P3PA 3WTPA 4JJNA 4X23C 3LELC 3B6GC 5F99C 4HGAC 3VH6T 3AZFB 3MGQD 3AZED 2LY8A 1EQZC 3LJAC 1KU5A 3RELA 3REIB 3AZFC 3V9RA 3C1BA 5AV5B 3F6TA 3C1BC 3LZ0C 4YS3D 1M18D 3W99C 5AV9B 3NQUB 4YS3C 3AZJD 1P3BB 4Z66D 5B2JC 1M18C 4ZBJC 1EQZA 4J8XB 4UUZB 3REHA 5CPIA 2YFWA 4YS3B 1P3AD 1M18B 1P3OC 4J8WB 4WU9C 1P3FC 3AZJB 1P3BD 3LZ0B 3AZEC 2HIOC 1P3LA 4H9PB 4X23D 5AVBD 2BYKA 1M19A 1A7WA 5AV6C 4J8VC 3W97D 5KDMA 5CP6A 4X23B 4J8UB 4H9QB 5AY8A 3AN2A 3AFAB 1KX5C 1H3OA 2HIOD 1P3ID 3X1VD 5JRGC 1P3AC 3AV1B 2Y2NA 3REKB 5B0ZA 3W98C 4J8XC 3AV1D 4WU8D 4J8WA 2PYOC 4H9NA 3W98B 3REKD 5CPIB 4J8XA 3AV2B 3TU4C 3NQUA 1P3MD 5AV9A 1P3PD 5B0ZD 2XD5A 1KX4A 5CPID 3LELD 5GT0B 5B31C 3REIA 5BO0A 5B31D 5B0ZB 5BS7A 1P3BC 3AZFA 3EPJA 3C1CA 3REID 3AZGB 5B40D 3WTPB 5F99A 1T3UA 5E5AA 5CP6D 4XUJB 5AV9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB D;  4HGA B;  5GT3 D;  5DNN A;  3AN2 B;  4AWL C;  5B32 C;  1U35 B;  1WWI A;  5AY8 B;  1P3L C;  3LJA B;  3X1T B;  5KDM B;  5CP6 B;  3WAA C;  1F66 D;  5AV8 A;  3X1T D;  1AOI A;  4QLC D;  4KUD C;  1P3L B;  4KGC A;  2ARO B;  2F8N H;  3LZ0 A;  3AYW C;  3W97 B;  2YFW B;  2RVQ C;  3REJ C;  5AV8 D;  3AZK B;  5G49 B;  1F66 A;  1P3I B;  2PYO B;  1Q9C A;  4G91 C;  3AZK D;  2FJ7 A;  3V9R B;  3B0C T;  2IO5 C;  4H9O B;  3A6N D;  5B32 A;  2HUE C;  3KSY A;  5AVC C;  5DNN C;  1ID3 D;  3REH D;  3MGQ A;  4XUJ C;  3UTA D;  5B0Y D;  2CV5 A;  1JFI A;  2HUE B;  3W98 D;  1ID3 B;  1ZLA A;  2L5A A;  3O62 C;  3UT9 B;  3UTA B;  5B0Y A;  1P3M B;  2CWE A;  3KWQ A;  3A6N A;  3R45 A;  3AZH D;  3REJ B;  3AZM A;  1M19 D;  3B6F D;  3AFA C;  2YFV A;  1KX5 B;  4DRA A;  1S32 A;  3MGP B;  5DNM B;  3X1V A;  5BNV A;  4ZUX D;  3X1U A;  4J8W C;  1P3K C;  4H9S A;  3W96 D;  3REK C;  4QLC C;  4KUD D;  5AY8 D;  5B2I B;  3W96 A;  3AZM D;  5CPK A;  3VH6 W;  3AZL C;  5B2I D;  4ZBJ B;  5B33 A;  5FUG A;  4ZUX A;  2ARO D;  5GXQ D;  1P3I C;  3KXB A;  4J8U C;  5AVC D;  3AZN B;  5CPJ C;  3AZI D;  1ULY A;  3MGQ C;  1KX3 B;  4WV4 B;  2JSS A;  5AVC B;  5B40 A;  5JRG B;  5B1M C;  2BYM B;  5GSU B;  2NQB D;  3MGS B;  2F8N A;  4XZQ A;  3B6G B;  2FJ7 C;  5B24 C;  1P3O A;  4Z66 A;  3WKJ B;  5CPI C;  3MGS D;  3KXB D;  4Z5T C;  1P3M C;  3B6F A;  4YM6 C;  5B1L A;  3LZ1 C;  4CAY A;  1P3O D;  4Z66 B;  4R8P C;  3WKJ A;  3AYW A;  5GXQ C;  3AV1 C;  2NQB A;  3VH5 W;  3LZ1 A;  4R8P B;  3MGS A;  1BH9 B;  3LZ0 D;  4WU9 B;  1P3F B;  4Z5T A;  1P3G B;  5GT3 C;  4JJN C;  1P3G C;  3WAA A;  2F8N G;  5JA4 B;  3W99 B;  2NZD B;  3AZN A;  3AZK C;  1KX5 D;  1P3K D;  5JA4 A;  2NZD A;  4KGC D;  1TZY A;  5B31 G;  2HIO B;  3W96 B;  3C1C C;  5B24 B;  1BH8 B;  1BH9 A;  4R8P A;  3MVD A;  5CPK C;  4DRB A;  3X1U B;  3AYW B;  5DNM A;  4YM6 A;  3MGP A;  1KX3 C;  5CHL B;  4Z66 C;  5B1L B;  4AWL B;  5GXQ B;  5B32 D;  3AZH A;  3MGR A;  1M1A A;  3C1B D;  3R45 B;  4XZQ B;  5GT0 D;  3X1S A;  3AZL B;  5B31 B;  1KX3 A;  5CPJ A;  5AV5 D;  5F99 D;  3B6G D;  1F1E A;  4ZUX C;  3X1S D;  1HQ3 D;  2CV5 B;  3KXB B;  3AZG C;  3MGQ B;  4NE5 A;  3UTB B;  3AN2 D;  5GT3 B;  2CV5 D;  4KHA B;  4G92 B;  1TZY C;  3KUY A;  1P34 A;  4QLC A;  1M19 C;  3X1T C;  4E44 A;  5B2I A;  1F66 B;  4WU9 D;  1P3F D;  4J8X D;  3AZK A;  4NE6 A;  1P3A B;  1B6W A;  1N1J A;  1P3L D;  3W97 A;  5BNV B;  3W99 D;  3NQJ B;  3MGP C;  2YFV B;  1P3K B;  3KUY D;  5AV8 B;  3REJ A;  1WWS A;  3NQJ A;  3KWQ B;  3LJA A;  5B1L C;  3O62 A;  3AFA D;  1U35 A;  1P3M A;  3B6F C;  5DNN B;  5AV8 C;  2NZD C;  3LEL A;  4XUJ A;  3C1C D;  5BNX A;  3AYW D;  4G92 C;  3VH5 T;  3MNN D;  1JFI B;  3UT9 C;  1B67 A;  3C1C B;  1HQ3 C;  1P34 B;  4KHA A;  5B32 B;  1KX4 D;  5GT3 A;  4H9O A;  3KUY C;  1F66 C;  5E5A D;  1P34 D;  2IO5 B;  1P3I A;  1KX4 B;  5BT1 D;  3WA9 C;  5BNX B;  3LEL B;  5CPJ B;  5B31 A;  3AZL A;  3X1S B;  3W96 C;  3O62 B;  4NE3 A;  1KX4 C;  2ARO A;  5AV9 C;  3VH6 A;  3REK A;  3W97 C;  1TZY D;  3AZG D;  1AOI B;  4YM6 D;  2RVQ D;  3MGR B;  1M1A B;  3WTP D;  3AV2 C;  3X1U C;  1P3K A;  3B0D B;  3AZH C;  3X1T A;  1AOI D;  1H3O B;  5B0Z C;  4YM6 B;  3MGR D;  1P3P C;  1M1A D;  3AFA A;  1U35 D;  1N1J B;  5GT0 C;  3MVD B;  1P3A A;  5DNM C;  4J8U A;  3AZI C;  4EO5 B;  5B33 C;  3MVD D;  3KWQ C;  3AZN D;  3AZG A;  4QLC B;  4J8U D;  5B0Y C;  4EO5 C;  3KUY B;  4H9P A;  4WU8 C;  2PYO D;  5B32 G;  1KX3 D;  3UTB A;  5BO0 B;  5GT0 A;  4UUZ A;  3REH B;  3WAA B;  4H9S C;  3WKJ D;  1BFM A;  3X1V C;  3AV2 A;  1S32 C;  4WZS B;  3MGR C;  1M1A C;  1P3G A;  4H9N B;  3UT9 D;  3W98 A;  5AV5 A;  4WU9 A;  1P3F A;  5C3I C;  4Z2M H;  3LZ1 B;  5AVB C;  2F8N K;  3AV1 A;  3AZH B;  5GXQ A;  1P3G D;  4JJN B;  5C3I B;  3WKJ C;  3B6F B;  1TAF A;  3B0B A;  3AZJ C;  4JJN D;  5CPJ D;  3B0C W;  4H9Q A;  3B6G A;  4X23 A;  1BH8 A;  5B24 A;  3O62 D;  4LD9 B;  5B40 B;  5AVC A;  4XZQ C;  4KUD B;  2BYK B;  1M19 B;  5B1M A;  2HIO A;  3AZN C;  5B33 D;  4XUJ D;  3UTA C;  5B40 C;  1TZY B;  3WA9 B;  5DNM D;  5AV6 D;  4J8V D;  4ZUX B;  5FUG B;  3LJA D;  5B24 D;  5CPK D;  3AZJ A;  5B33 B;  1EQZ D;  1U35 C;  3KXB C;  4YS3 A;  1M18 A;  3MGS C;  3W99 A;  5B1M D;  2NQB C;  5CPK B;  3VH5 A;  5BS7 C;  1P3B A;  1EQZ B;  4Z2M G;  5B1L D;  3REL C;  4KGC C;  4Z5T B;  1S32 D;  3C1B B;  5AVB A;  5GSU D;  2NQB B;  3REL B;  5AV5 C;  4XZQ D;  1S32 B;  4CAY B;  3AZL D;  3AZF D;  4H9R B;  3AZI B;  3AZE B;  5B2I C;  3WAA D;  5JRG D;  1P3O B;  5E5A C;  1HQ3 B;  3A6N B;  1P34 C;  4CSR B;  3AZM C;  4LD9 C;  2F8N B;  3UTB C;  2BYM A;  5GSU A;  4E45 A;  4WU8 A;  4R8P D;  5JRG A;  3B0D C;  4CSR A;  5B0Y B;  3MNN A;  1ID3 C;  3LZ1 D;  2F8N D;  3MNN C;  3AN2 C;  1ID3 A;  1ZLA B;  3REI C;  4H9R A;  3AZI A;  4J8W D;  2NZD D;  5AV6 A;  4J8V A;  2FJ7 D;  4WNN B;  1ZLA D;  3X1S C;  5B2J B;  3TU4 A;  5AVB B;  3REJ D;  2FJ7 B;  2PYO A;  1R4V A;  5B2J D;  3TU4 D;  4LD9 D;  5G49 A;  3MGP D;  2ARO C;  3REH C;  5B2J A;  3TU4 B;  3WA9 D;  5BT1 C;  3X1V B;  4WNN A;  3A6N C;  3KWQ D;  3MVD C;  5AV6 B;  4J8V B;  4KGC B;  4NFT A;  1HTA A;  4G91 B;  4M6B A;  5DNN D;  3WTP E;  1KX5 A;  3WA9 A;  3AZM B;  5B1M B;  5AY8 C;  5GSU C;  4KUD A;  5CP6 C;  3MNN B;  1ZLA C;  1AOI C;  4LD9 A;  4WU8 B;  2CV5 C;  4Z5T D;  3X1U D;  3WTP C;  3AV2 D;  1HQ3 A;  3UTA A;  3UT9 A;  3REL D;  1P3P B;  1TAF B;  5E5A B;  5F99 B;  3AZE A;  1P3P A;  3WTP A;  4JJN A;  4X23 C;  3LEL C;  3B6G C;  5F99 C;  4HGA C;  3VH6 T;  3AZF B;  3MGQ D;  3AZE D;  2LY8 A;  1EQZ C;  3LJA C;  1KU5 A;  3REL A;  3REI B;  3AZF C;  3V9R A;  3C1B A;  5AV5 B;  3C1B C;  3LZ0 C;  4YS3 D;  1M18 D;  3W99 C;  5AV9 B;  3NQU B;  4YS3 C;  3AZJ D;  1P3B B;  4Z66 D;  5B2J C;  1M18 C;  4ZBJ C;  1EQZ A;  4J8X B;  4UUZ B;  3REH A;  5CPI A;  2YFW A;  4YS3 B;  1P3A D;  1M18 B;  1P3O C;  4J8W B;  4WU9 C;  1P3F C;  3AZJ B;  1P3B D;  3LZ0 B;  3AZE C;  2HIO C;  1P3L A;  4H9P B;  4X23 D;  5AVB D;  2BYK A;  1M19 A;  1A7W A;  5AV6 C;  4J8V C;  3W97 D;  5KDM A;  5CP6 A;  4X23 B;  4J8U B;  4H9Q B;  5AY8 A;  3AN2 A;  3AFA B;  1KX5 C;  1H3O A;  2HIO D;  1P3I D;  3X1V D;  5JRG C;  1P3A C;  3AV1 B;  3REK B;  5B0Z A;  3W98 C;  4J8X C;  3AV1 D;  4WU8 D;  4J8W A;  2PYO C;  4H9N A;  3W98 B;  3REK D;  5CPI B;  4J8X A;  3AV2 B;  3TU4 C;  3NQU A;  1P3M D;  5AV9 A;  1P3P D;  5B0Z D;  1KX4 A;  5CPI D;  3LEL D;  5GT0 B;  5B31 C;  3REI A;  5BO0 A;  5B31 D;  5B0Z B;  5BS7 A;  1P3B C;  3AZF A;  3C1C A;  3REI D;  3AZG B;  5B40 D;  3WTP B;  5F99 A;  5E5A A;  5CP6 D;  4XUJ B;  5AV9 D; 
#chains in the Genus database with same CATH topology
 3UTB D;  4HGA B;  5GT3 D;  5DNN A;  3AN2 B;  3IP4 C;  4AWL C;  5B32 C;  1U35 B;  1WWI A;  5AY8 B;  1P3L C;  3LJA B;  3X1T B;  5KDM B;  5CP6 B;  1W2E A;  3WAA C;  1F66 D;  5AV8 A;  3X1T D;  1AOI A;  4QLC D;  4KUD C;  2VQR A;  1P3L B;  4KGC A;  2ARO B;  2Y2O A;  3LZ0 A;  2F8N H;  3AYW C;  3W97 B;  2YFW B;  2RVQ C;  3REJ C;  5AV8 D;  3AZK B;  5G49 B;  1F66 A;  1P3I B;  3A1I A;  2PYO B;  1Q9C A;  4G91 C;  3AZK D;  2FJ7 A;  3V9R B;  3B0C T;  2IO5 C;  2ZY4 A;  4H9O B;  3A6N D;  5B32 A;  2HUE C;  3KSY A;  5AVC C;  5DNN C;  1ID3 D;  3REH D;  3MGQ A;  4XUJ C;  3UTA D;  5B0Y D;  2CV5 A;  1JFI A;  2HUE B;  3W98 D;  1ID3 B;  1ZLA A;  2L5A A;  3O62 C;  3UT9 B;  3UTA B;  5B0Y A;  1P3M B;  2CWE A;  3KWQ A;  2Y2J A;  3A6N A;  3R45 A;  3AZH D;  3REJ B;  3AZM A;  1M19 D;  3B6F D;  3AFA C;  2YFV A;  1KX5 B;  4DRA A;  2RIQ A;  1S32 A;  3MGP B;  5DNM B;  4DQY B;  3X1V A;  5BNV A;  4ZUX D;  3X1U A;  4J8W C;  1P3K C;  4H9S A;  3W96 D;  3REK C;  4QLC C;  4KUD D;  5AY8 D;  5B2I B;  3W96 A;  3AZM D;  2ZY3 A;  3VH6 W;  3AZL C;  5CPK A;  5B2I D;  4ZBJ B;  5B33 A;  5FUG A;  4ZUX A;  2ARO D;  5GXQ D;  1P3I C;  3KXB A;  4J8U C;  5AVC D;  3AZN B;  5CPJ C;  3AZI D;  1ULY A;  3MGQ C;  1KX3 B;  4WV4 B;  2JSS A;  5AVC B;  5B40 A;  5JRG B;  5B1M C;  2BYM B;  5GSU B;  2NQB D;  3MGS B;  2F8N A;  4XZQ A;  3B6G B;  2FJ7 C;  5B24 C;  1P3O A;  4Z66 A;  3WKJ B;  5CPI C;  3MGS D;  2Y2H A;  3KXB D;  4Z5T C;  1P3M C;  3B6F A;  4YM6 C;  5B1L A;  3LZ1 C;  4CAY A;  1P3O D;  4Z66 B;  4R8P C;  3WKJ A;  2XD1 A;  3AYW A;  5GXQ C;  3AV1 C;  2NQB A;  3VH5 W;  3LZ1 A;  4R8P B;  3MGS A;  1BH9 B;  3LZ0 D;  4WU9 B;  1P3F B;  4Z5T A;  1P3G B;  5GT3 C;  4JJN C;  1P3G C;  3WAA A;  2F8N G;  5JA4 B;  3W99 B;  2NZD B;  3AZN A;  3AZK C;  1KX5 D;  1P3K D;  5JA4 A;  2NZD A;  4KGC D;  1TZY A;  5B31 G;  2HIO B;  3W96 B;  1Z2C B;  3C1C C;  5B24 B;  1BH8 B;  1BH9 A;  4R8P A;  3MVD A;  5CPK C;  4DRB A;  3X1U B;  3AYW B;  5DNM A;  4YM6 A;  3MGP A;  1KX3 C;  5CHL B;  4Z66 C;  5B1L B;  4AWL B;  5GXQ B;  5B32 D;  3AZH A;  3MGR A;  1M1A A;  3C1B D;  2FFF B;  3R45 B;  4XZQ B;  5GT0 D;  3X1S A;  3AZL B;  5B31 B;  1KX3 A;  5CPJ A;  5AV5 D;  5F99 D;  3B6G D;  1F1E A;  4ZUX C;  3X1S D;  1HQ3 D;  2CV5 B;  3KXB B;  3AZG C;  3MGQ B;  4NE5 A;  4UPK A;  3UTB B;  5GT3 B;  3AN2 D;  2CV5 D;  4KHA B;  4G92 B;  1TZY C;  3KUY A;  1P34 A;  4QLC A;  1M19 C;  2JE5 A;  4E44 A;  5B2I A;  3X1T C;  1F66 B;  4WU9 D;  1P3F D;  2Y2Q A;  4J8X D;  3AZK A;  4NE6 A;  3EG5 B;  1P3A B;  2UWX A;  1B6W A;  1N1J A;  1P3L D;  3W97 A;  5BNV B;  3W99 D;  3NQJ B;  3MGP C;  2YFV B;  1P3K B;  3KUY D;  5AV8 B;  3EPL A;  3REJ A;  1WWS A;  3KFU G;  3NQJ A;  3KWQ B;  3LJA A;  5B1L C;  3O62 A;  3AFA D;  1U35 A;  1P3M A;  3B6F C;  5DNN B;  5AV8 C;  2NZD C;  3LEL A;  4XUJ A;  3C1C D;  5BNX A;  3AYW D;  4G92 C;  3VH5 T;  3MNN D;  1JFI B;  3UT9 C;  1B67 A;  4WJ3 C;  3C1C B;  1HQ3 C;  3H0L C;  1P34 B;  2F2A C;  4KHA A;  5B32 B;  1KX4 D;  5GT3 A;  4H9O A;  2Y2M A;  3KUY C;  1F66 C;  5E5A D;  1P34 D;  2IO5 B;  1P3I A;  1KX4 B;  2Y2P A;  5BT1 D;  3WA9 C;  5BNX B;  3LEL B;  5CPJ B;  5B31 A;  3AZL A;  3X1S B;  3W96 C;  3O62 B;  3EPK A;  4NE3 A;  1KX4 C;  2ARO A;  5AV9 C;  3VH6 A;  3REK A;  3W97 C;  1TZY D;  3AZG D;  1AOI B;  4YM6 D;  2RVQ D;  3MGR B;  1M1A B;  3WTP D;  3AV2 C;  3X1U C;  1P3K A;  3B0D B;  3AZH C;  3X1T A;  1AOI D;  1H3O B;  5B0Z C;  4YM6 B;  3MGR D;  1P3P C;  1M1A D;  3AFA A;  1U35 D;  1N1J B;  5GT0 C;  3MVD B;  1P3A A;  5DNM C;  4J8U A;  3AZI C;  4EO5 B;  5B33 C;  3MVD D;  3KWQ C;  3AZN D;  3AZG A;  4QLC B;  4J8U D;  5B0Y C;  4EO5 C;  3KUY B;  4H9P A;  2W8S A;  4WU8 C;  2PYO D;  5B32 G;  1KX3 D;  1PZR A;  3UTB A;  5BO0 B;  5GT0 A;  4UUZ A;  3REH B;  3WAA B;  4H9S C;  3WKJ D;  1BFM A;  3X1V C;  3AV2 A;  3FDD A;  1S32 C;  4WZS B;  3MGR C;  1M1A C;  1P3G A;  4H9N B;  3UT9 D;  3W98 A;  5AV5 A;  4WU9 A;  1P3F A;  5C3I C;  4Z2M H;  3LZ1 B;  5AVB C;  2F8N K;  3AV1 A;  3AZH B;  5GXQ A;  1P3G D;  4JJN B;  5C3I B;  3WKJ C;  3B6F B;  1TAF A;  3AL0 C;  3B0B A;  3AZJ C;  4JJN D;  3H0M C;  5CPJ D;  3B0C W;  4H9Q A;  3B6G A;  4X23 A;  1BH8 A;  5B24 A;  2Y2G A;  3O62 D;  4LD9 B;  5B40 B;  5AVC A;  3EPH A;  4XZQ C;  4KUD B;  2BYK B;  1M19 B;  2ZY5 A;  2HIO A;  5B1M A;  3AZN C;  5B33 D;  4XUJ D;  3UTA C;  5B40 C;  1TZY B;  3WA9 B;  2ZM5 A;  5DNM D;  5AV6 D;  4J8V D;  4ZUX B;  5FUG B;  3LJA D;  5B24 D;  5CPK D;  3AZJ A;  5B33 B;  1EQZ D;  1U35 C;  3KXB C;  4YS3 A;  1M18 A;  3MGS C;  3A1K A;  5B1M D;  3W99 A;  2NQB C;  5CPK B;  3VH5 A;  5BS7 C;  1P3B A;  1EQZ B;  4Z2M G;  2DQN C;  5B1L D;  3REL C;  4KGC C;  4Z5T B;  1S32 D;  3C1B B;  5AVB A;  5GSU D;  2Y2L A;  3REL B;  2NQB B;  5AV5 C;  2G5I C;  4XZQ D;  1S32 B;  4CAY B;  2BG1 A;  3AZL D;  3AZF D;  4H9R B;  3AZI B;  3AZE B;  5B2I C;  3WAA D;  5JRG D;  1P3O B;  2JCH A;  5E5A C;  1HQ3 B;  3A6N B;  1P34 C;  4CSR B;  3AZM C;  4LD9 C;  2F8N B;  3UTB C;  2BYM A;  5GSU A;  4E45 A;  4WU8 A;  4R8P D;  3B0D C;  4CSR A;  5B0Y B;  5JRG A;  3MNN A;  1ID3 C;  3LZ1 D;  2F8N D;  3MNN C;  3AN2 C;  1ID3 A;  1ZLA B;  3REI C;  4H9R A;  3AZI A;  4J8W D;  3H0R C;  3P5J B;  2NZD D;  5AV6 A;  4J8V A;  2FJ7 D;  4WNN B;  1ZLA D;  3X1S C;  5B2J B;  3TU4 A;  5AVB B;  3REJ D;  2FJ7 B;  2PYO A;  1R4V A;  5B2J D;  3TU4 D;  2G5H C;  2Y2K A;  4LD9 D;  5G49 A;  3MGP D;  2ARO C;  3REH C;  5B2J A;  3TU4 B;  3WA9 D;  5BT1 C;  3X1V B;  4WNN A;  3A6N C;  3KWQ D;  3MVD C;  5AV6 B;  4J8V B;  4KGC B;  4NFT A;  1HTA A;  4G91 B;  4M6B A;  5DNN D;  3WTP E;  1KX5 A;  3WA9 A;  3AZM B;  5B1M B;  5AY8 C;  2DF4 C;  5GSU C;  2J8P A;  4KUD A;  2Y2I A;  5CP6 C;  3MNN B;  1ZLA C;  1AOI C;  4LD9 A;  4WU8 B;  2ZY2 A;  2CV5 C;  4Z5T D;  3X1U D;  3WTP C;  3AV2 D;  1HQ3 A;  3UTA A;  3UT9 A;  3REL D;  1P3P B;  1TAF B;  5E5A B;  5F99 B;  3AZE A;  1P3P A;  3WTP A;  4JJN A;  4X23 C;  3LEL C;  3B6G C;  5F99 C;  4HGA C;  3VH6 T;  3AZF B;  3MGQ D;  3AZE D;  2LY8 A;  1EQZ C;  3LJA C;  1KU5 A;  3REL A;  3REI B;  3AZF C;  3V9R A;  3C1B A;  5AV5 B;  3F6T A;  3C1B C;  3LZ0 C;  4YS3 D;  1M18 D;  3W99 C;  5AV9 B;  3NQU B;  4YS3 C;  3AZJ D;  1P3B B;  4Z66 D;  5B2J C;  1M18 C;  4ZBJ C;  1EQZ A;  4J8X B;  4UUZ B;  3REH A;  5CPI A;  2YFW A;  4YS3 B;  1P3A D;  1M18 B;  1P3O C;  4J8W B;  4WU9 C;  1P3F C;  3AZJ B;  1P3B D;  3LZ0 B;  3AZE C;  2HIO C;  1P3L A;  4H9P B;  4X23 D;  5AVB D;  2BYK A;  1M19 A;  1A7W A;  5AV6 C;  4J8V C;  3W97 D;  5KDM A;  5CP6 A;  4X23 B;  4J8U B;  4H9Q B;  5AY8 A;  3AN2 A;  3AFA B;  1KX5 C;  1H3O A;  2HIO D;  1P3I D;  3X1V D;  5JRG C;  1P3A C;  3AV1 B;  2Y2N A;  3REK B;  5B0Z A;  3W98 C;  4J8X C;  3AV1 D;  4WU8 D;  4J8W A;  2PYO C;  4H9N A;  3W98 B;  3REK D;  5CPI B;  4J8X A;  3AV2 B;  3TU4 C;  3NQU A;  1P3M D;  5AV9 A;  1P3P D;  5B0Z D;  2XD5 A;  1KX4 A;  5CPI D;  3LEL D;  5GT0 B;  5B31 C;  3REI A;  5BO0 A;  5B31 D;  5B0Z B;  5BS7 A;  1P3B C;  3AZF A;  3EPJ A;  3C1C A;  3REI D;  3AZG B;  5B40 D;  3WTP B;  5F99 A;  1T3U A;  5E5A A;  5CP6 D;  4XUJ B;  5AV9 D; 
#chains in the Genus database with same CATH homology
 3UTB D;  4HGA B;  5GT3 D;  5DNN A;  3AN2 B;  3IP4 C;  4AWL C;  5B32 C;  1U35 B;  1WWI A;  5AY8 B;  1P3L C;  3LJA B;  3X1T B;  5KDM B;  5CP6 B;  1W2E A;  3WAA C;  1F66 D;  5AV8 A;  3X1T D;  1AOI A;  4QLC D;  4KUD C;  2VQR A;  1P3L B;  4KGC A;  2ARO B;  2Y2O A;  3LZ0 A;  2F8N H;  3AYW C;  3W97 B;  2YFW B;  2RVQ C;  3REJ C;  5AV8 D;  3AZK B;  5G49 B;  1F66 A;  1P3I B;  3A1I A;  2PYO B;  1Q9C A;  4G91 C;  3AZK D;  2FJ7 A;  3V9R B;  3B0C T;  2IO5 C;  2ZY4 A;  4H9O B;  3A6N D;  5B32 A;  2HUE C;  3KSY A;  5AVC C;  5DNN C;  1ID3 D;  3REH D;  3MGQ A;  4XUJ C;  3UTA D;  5B0Y D;  2CV5 A;  1JFI A;  2HUE B;  3W98 D;  1ID3 B;  1ZLA A;  2L5A A;  3O62 C;  3UT9 B;  3UTA B;  5B0Y A;  1P3M B;  2CWE A;  3KWQ A;  2Y2J A;  3A6N A;  3R45 A;  3AZH D;  3REJ B;  3AZM A;  1M19 D;  3B6F D;  3AFA C;  2YFV A;  1KX5 B;  4DRA A;  2RIQ A;  1S32 A;  3MGP B;  5DNM B;  4DQY B;  3X1V A;  5BNV A;  4ZUX D;  3X1U A;  4J8W C;  1P3K C;  4H9S A;  3W96 D;  3REK C;  4QLC C;  4KUD D;  5AY8 D;  5B2I B;  3W96 A;  3AZM D;  2ZY3 A;  3VH6 W;  3AZL C;  5CPK A;  5B2I D;  4ZBJ B;  5B33 A;  5FUG A;  4ZUX A;  2ARO D;  5GXQ D;  1P3I C;  3KXB A;  4J8U C;  5AVC D;  3AZN B;  5CPJ C;  3AZI D;  1ULY A;  3MGQ C;  1KX3 B;  4WV4 B;  2JSS A;  5AVC B;  5B40 A;  5JRG B;  5B1M C;  2BYM B;  5GSU B;  2NQB D;  3MGS B;  2F8N A;  4XZQ A;  3B6G B;  2FJ7 C;  5B24 C;  1P3O A;  4Z66 A;  3WKJ B;  5CPI C;  3MGS D;  2Y2H A;  3KXB D;  4Z5T C;  1P3M C;  3B6F A;  4YM6 C;  5B1L A;  3LZ1 C;  4CAY A;  1P3O D;  4Z66 B;  4R8P C;  3WKJ A;  2XD1 A;  3AYW A;  5GXQ C;  3AV1 C;  2NQB A;  3VH5 W;  3LZ1 A;  4R8P B;  3MGS A;  1BH9 B;  3LZ0 D;  4WU9 B;  1P3F B;  4Z5T A;  1P3G B;  5GT3 C;  4JJN C;  1P3G C;  3WAA A;  2F8N G;  5JA4 B;  3W99 B;  2NZD B;  3AZN A;  3AZK C;  1KX5 D;  1P3K D;  5JA4 A;  2NZD A;  4KGC D;  1TZY A;  5B31 G;  2HIO B;  3W96 B;  1Z2C B;  3C1C C;  5B24 B;  1BH8 B;  1BH9 A;  4R8P A;  3MVD A;  5CPK C;  4DRB A;  3X1U B;  3AYW B;  5DNM A;  4YM6 A;  3MGP A;  1KX3 C;  5CHL B;  4Z66 C;  5B1L B;  4AWL B;  5GXQ B;  5B32 D;  3AZH A;  3MGR A;  1M1A A;  3C1B D;  2FFF B;  3R45 B;  4XZQ B;  5GT0 D;  3X1S A;  3AZL B;  5B31 B;  1KX3 A;  5CPJ A;  5AV5 D;  5F99 D;  3B6G D;  1F1E A;  4ZUX C;  3X1S D;  1HQ3 D;  2CV5 B;  3KXB B;  3AZG C;  3MGQ B;  4NE5 A;  4UPK A;  3UTB B;  5GT3 B;  3AN2 D;  2CV5 D;  4KHA B;  4G92 B;  1TZY C;  3KUY A;  1P34 A;  4QLC A;  1M19 C;  2JE5 A;  4E44 A;  5B2I A;  3X1T C;  1F66 B;  4WU9 D;  1P3F D;  2Y2Q A;  4J8X D;  3AZK A;  4NE6 A;  3EG5 B;  1P3A B;  2UWX A;  1B6W A;  1N1J A;  1P3L D;  3W97 A;  5BNV B;  3W99 D;  3NQJ B;  3MGP C;  2YFV B;  1P3K B;  3KUY D;  5AV8 B;  3EPL A;  3REJ A;  1WWS A;  3KFU G;  3NQJ A;  3KWQ B;  3LJA A;  5B1L C;  3O62 A;  3AFA D;  1U35 A;  1P3M A;  3B6F C;  5DNN B;  5AV8 C;  2NZD C;  3LEL A;  4XUJ A;  3C1C D;  5BNX A;  3AYW D;  4G92 C;  3VH5 T;  3MNN D;  1JFI B;  3UT9 C;  1B67 A;  4WJ3 C;  3C1C B;  1HQ3 C;  3H0L C;  1P34 B;  2F2A C;  4KHA A;  5B32 B;  1KX4 D;  5GT3 A;  4H9O A;  2Y2M A;  3KUY C;  1F66 C;  5E5A D;  1P34 D;  2IO5 B;  1P3I A;  1KX4 B;  2Y2P A;  5BT1 D;  3WA9 C;  5BNX B;  3LEL B;  5CPJ B;  5B31 A;  3AZL A;  3X1S B;  3W96 C;  3O62 B;  3EPK A;  4NE3 A;  1KX4 C;  2ARO A;  5AV9 C;  3VH6 A;  3REK A;  3W97 C;  1TZY D;  3AZG D;  1AOI B;  4YM6 D;  2RVQ D;  3MGR B;  1M1A B;  3WTP D;  3AV2 C;  3X1U C;  1P3K A;  3B0D B;  3AZH C;  3X1T A;  1AOI D;  1H3O B;  5B0Z C;  4YM6 B;  3MGR D;  1P3P C;  1M1A D;  3AFA A;  1U35 D;  1N1J B;  5GT0 C;  3MVD B;  1P3A A;  5DNM C;  4J8U A;  3AZI C;  4EO5 B;  5B33 C;  3MVD D;  3KWQ C;  3AZN D;  3AZG A;  4QLC B;  4J8U D;  5B0Y C;  4EO5 C;  3KUY B;  4H9P A;  2W8S A;  4WU8 C;  2PYO D;  5B32 G;  1KX3 D;  1PZR A;  3UTB A;  5BO0 B;  5GT0 A;  4UUZ A;  3REH B;  3WAA B;  4H9S C;  3WKJ D;  1BFM A;  3X1V C;  3AV2 A;  3FDD A;  1S32 C;  4WZS B;  3MGR C;  1M1A C;  1P3G A;  4H9N B;  3UT9 D;  3W98 A;  5AV5 A;  4WU9 A;  1P3F A;  5C3I C;  4Z2M H;  3LZ1 B;  5AVB C;  2F8N K;  3AV1 A;  3AZH B;  5GXQ A;  1P3G D;  4JJN B;  5C3I B;  3WKJ C;  3B6F B;  1TAF A;  3AL0 C;  3B0B A;  3AZJ C;  4JJN D;  3H0M C;  5CPJ D;  3B0C W;  4H9Q A;  3B6G A;  4X23 A;  1BH8 A;  5B24 A;  2Y2G A;  3O62 D;  4LD9 B;  5B40 B;  5AVC A;  3EPH A;  4XZQ C;  4KUD B;  2BYK B;  1M19 B;  2ZY5 A;  2HIO A;  5B1M A;  3AZN C;  5B33 D;  4XUJ D;  3UTA C;  5B40 C;  1TZY B;  3WA9 B;  2ZM5 A;  5DNM D;  5AV6 D;  4J8V D;  4ZUX B;  5FUG B;  3LJA D;  5B24 D;  5CPK D;  3AZJ A;  5B33 B;  1EQZ D;  1U35 C;  3KXB C;  4YS3 A;  1M18 A;  3MGS C;  3A1K A;  5B1M D;  3W99 A;  2NQB C;  5CPK B;  3VH5 A;  5BS7 C;  1P3B A;  1EQZ B;  4Z2M G;  2DQN C;  5B1L D;  3REL C;  4KGC C;  4Z5T B;  1S32 D;  3C1B B;  5AVB A;  5GSU D;  2Y2L A;  3REL B;  2NQB B;  5AV5 C;  2G5I C;  4XZQ D;  1S32 B;  4CAY B;  2BG1 A;  3AZL D;  3AZF D;  4H9R B;  3AZI B;  3AZE B;  5B2I C;  3WAA D;  5JRG D;  1P3O B;  2JCH A;  5E5A C;  1HQ3 B;  3A6N B;  1P34 C;  4CSR B;  3AZM C;  4LD9 C;  2F8N B;  3UTB C;  2BYM A;  5GSU A;  4E45 A;  4WU8 A;  4R8P D;  3B0D C;  4CSR A;  5B0Y B;  5JRG A;  3MNN A;  1ID3 C;  3LZ1 D;  2F8N D;  3MNN C;  3AN2 C;  1ID3 A;  1ZLA B;  3REI C;  4H9R A;  3AZI A;  4J8W D;  3H0R C;  3P5J B;  2NZD D;  5AV6 A;  4J8V A;  2FJ7 D;  4WNN B;  1ZLA D;  3X1S C;  5B2J B;  3TU4 A;  5AVB B;  3REJ D;  2FJ7 B;  2PYO A;  1R4V A;  5B2J D;  3TU4 D;  2G5H C;  2Y2K A;  4LD9 D;  5G49 A;  3MGP D;  2ARO C;  3REH C;  5B2J A;  3TU4 B;  3WA9 D;  5BT1 C;  3X1V B;  4WNN A;  3A6N C;  3KWQ D;  3MVD C;  5AV6 B;  4J8V B;  4KGC B;  4NFT A;  1HTA A;  4G91 B;  4M6B A;  5DNN D;  3WTP E;  1KX5 A;  3WA9 A;  3AZM B;  5B1M B;  5AY8 C;  2DF4 C;  5GSU C;  2J8P A;  4KUD A;  2Y2I A;  5CP6 C;  3MNN B;  1ZLA C;  1AOI C;  4LD9 A;  4WU8 B;  2ZY2 A;  2CV5 C;  4Z5T D;  3X1U D;  3WTP C;  3AV2 D;  1HQ3 A;  3UTA A;  3UT9 A;  3REL D;  1P3P B;  1TAF B;  5E5A B;  5F99 B;  3AZE A;  1P3P A;  3WTP A;  4JJN A;  4X23 C;  3LEL C;  3B6G C;  5F99 C;  4HGA C;  3VH6 T;  3AZF B;  3MGQ D;  3AZE D;  2LY8 A;  1EQZ C;  3LJA C;  1KU5 A;  3REL A;  3REI B;  3AZF C;  3V9R A;  3C1B A;  5AV5 B;  3F6T A;  3C1B C;  3LZ0 C;  4YS3 D;  1M18 D;  3W99 C;  5AV9 B;  3NQU B;  4YS3 C;  3AZJ D;  1P3B B;  4Z66 D;  5B2J C;  1M18 C;  4ZBJ C;  1EQZ A;  4J8X B;  4UUZ B;  3REH A;  5CPI A;  2YFW A;  4YS3 B;  1P3A D;  1M18 B;  1P3O C;  4J8W B;  4WU9 C;  1P3F C;  3AZJ B;  1P3B D;  3LZ0 B;  3AZE C;  2HIO C;  1P3L A;  4H9P B;  4X23 D;  5AVB D;  2BYK A;  1M19 A;  1A7W A;  5AV6 C;  4J8V C;  3W97 D;  5KDM A;  5CP6 A;  4X23 B;  4J8U B;  4H9Q B;  5AY8 A;  3AN2 A;  3AFA B;  1KX5 C;  1H3O A;  2HIO D;  1P3I D;  3X1V D;  5JRG C;  1P3A C;  3AV1 B;  2Y2N A;  3REK B;  5B0Z A;  3W98 C;  4J8X C;  3AV1 D;  4WU8 D;  4J8W A;  2PYO C;  4H9N A;  3W98 B;  3REK D;  5CPI B;  4J8X A;  3AV2 B;  3TU4 C;  3NQU A;  1P3M D;  5AV9 A;  1P3P D;  5B0Z D;  2XD5 A;  1KX4 A;  5CPI D;  3LEL D;  5GT0 B;  5B31 C;  3REI A;  5BO0 A;  5B31 D;  5B0Z B;  5BS7 A;  1P3B C;  3AZF A;  3EPJ A;  3C1C A;  3REI D;  3AZG B;  5B40 D;  3WTP B;  5F99 A;  1T3U A;  5E5A A;  5CP6 D;  4XUJ B;  5AV9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...