5DNMB

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmB00
4G92C 5DNMB 3RELC 5B24C 5B1LB 5BT1D 3LELA 4UUZA 3MNNB 3AV1C 4Z66D 5C3IC 3AZLC 4WU8A 3RELB 3X1SC 3B6GA 3AV1B 3UTAA 3X1UC 3MGPA 1P3OD 3X1SB 4HGAB 3LZ1A 4NFTA 5CPKD 4J8VD 2YFWA 5B0YA 3X1UB 4KHAB 1WWSA 1P3ID 4Z5TA 5GSUD 1P3PA 3VH5T 5KDMA 4X23D 3UT9C 3AZGA 3AZED 3LJAA 1S32A 3W96A 1JFIB 5AVCA 2F8NH 2PYOA 5B1MA 3UT9B 3KWQD 5F99C 4Z2MH 1U35C 2BYMB 3A6NC 3MGQB 4J8UC 3W97D 1U35B 5B24D 3A6NB 3REIA 5B40C 1ID3A 4NE5A 4YS3C 2BYKA 3AZLD 5GT3A 3AN2A 3WTPC 3O62A 5B31C 5B40B 4KUDC 1P3BD 3WTPB 5B31B 3UTAC 4KUDB 2FJ7A 4E44A 3B0BA 5E5AC 4WU8B 3B6GB 4ZUXD 2AROC 1P34D 1KX5D 1ZLAD 2YFVA 3UTAB 1P3OA 2NQBC 5E5AB 4G91C 4J8VA 5B0ZD 3X1VC 2AROB 1KX5B 2YFWB 4R8PD 3WAAD 4YM6C 3UTBD 3WKJD 3KSYA 2NQBB 4G91B 5GSUA 5DNNC 3NQUA 3MGRA 4Z5TB 5BS7C 3X1VB 4H9PA 5F99D 4X23A 2RVQC 5JRGA 4J8XC 1S32B 2F8NG 1N1JA 4J8UD 4M6BA 4Z2MG 5B32G 4J8XB 5B1LA 4ZBJC 4YS3D 3MNNA 4H9RB 1P3LC 1EQZC 3RELA 5B24A 4KGCD 4EO5B 4ZBJB 3B0CW 1P3LB 3AZLA 3X1SA 5BT1C 1TZYD 4Z66C 1P3FD 3X1UA 4KHAA 2NQBD 3WA9D 3REHC 4Z66B 1M19D 3W98C 1BH8A 5B2ID 4YM6D 5CPKC 5DNND 3KUYD 3W98B 1JFIA 1P3OB 3B0DC 3UT9A 1P3IC 5CPKB 3UTBA 2RVQD 4H9QA 3REKD 3AFAC 1P3IB 1BFMA 5GSUB 3AZEC 5GXQD 5F99A 1P3MD 1U35A 4H9PB 4LD9D 3A6NA 5CP6D 3AFAB 3KWQC 3AZEB 1P3LD 1EQZD 4H9NB 5JA4B 4J8UA 4WV4B 5B33C 1N1JB 3C1BC 3KWQB 5B40A 3VH6A 3W97C 4YS3A 5B33B 4H9OB 3WTPA 3TU4D 3C1BB 5B31A 4KUDA 1R4VA 4G92B 3W97B 2IO5C 4QLCD 5B24B 4XZQC 3REHD 5C3IB 1P3BC 2F8NK 3W98D 5E5AA 3AZLB 2IO5B 1P3AD 1P3FA 2AROA 3AZFD 1P3KD 4XZQB 1P3BB 2NQBA 3AZJC 4ZUXC 1P34C 4CSRB 3X1VA 5AVBD 2HUEC 4E45A 1KX5C 1ZLAC 4YM6A 1BH8B 4CAYB 1F66C 5B0ZC 4ZUXB 5DNNA 3AFAD 3KUYA 1P34B 4R8PC 3WAAC 3VH5W 5BS7A 3UTBC 5AV8C 1KX4C 1F1EA 3AV2C 3WKJC 5B0ZB 2CV5C 4R8PB 1AOID 3WAAB 4J8XA 3X1TD 3UTBB 3WKJB 3AV2B 3B6FC 2HIOC 5B33D 4H9QB 3AYWD 1M18D 4H9RA 3W99C 3C1BD 4DRAA 5F99B 3LZ0D 3B6FB 4WNNB 1P3LA 1EQZA 3VH5A 4J8UB 3MVDD 4XZQD 3NQJB 4KGCC 4J8WD 4YS3B 1Q9CA 4Z66A 1P3GD 4QLCA 4KGCB 1TZYC 4AWLC 3AZJD 1P3FC 3REHA 3W98A 3KXBD 3WA9C 1TZYB 4AWLB 3AZFA 5CPKA 1P3KA 1P3FB 1M19C 1F66D 1ZLAB 1KX4D 5B2IC 5AV8D 3AV2D 3WA9B 1P3IA 5CHLB 3KUYC 2CV5D 1M19B 2NZDD 5B2IB 5G49B 4YM6B 3B6FD 2HIOD 2LY8A 1TAFB 5CPIC 3AFAA 1H3OB 3AZEA 1HTAA 3W99D 5DNNB 4H9NA 3KUYB 5JA4A 1WWIA 3MGSC 1KX3D 3REKC 3KWQA 5GXQC 1M1AC 1P3MC 3AZHD 3MGSB 5B33A 4H9OA 4LD9C 3REKB 5CP6C 3C1BA 5GXQB 3LZ0A 1M1AB 5CPJD 3W97A 1P3MB 4LD9B 5CP6B 4JJNC 1EQZB 3R45B 4XUJD 3TU4C 3C1CD 4XZQA 1P3BA 4QLCC 2L5AA 4CSRA 3TU4B 3REJC 4CAYA 3AZJA 1P3AC 4QLCB 4ZUXA 5BNXB 3AZKC 3AZFC 1P34A 3AZNC 1P3KC 1KX5A 3LELD 3REHB 1ZLAA 3REJB 1F66A 5B0ZA 1P3AB 5AVBC 1KX4A 3AZFB 5CPID 4R8PA 1P3KB 3WAAA 4WU9C 3WKJA 5AV8A 3AV2A 3MGSD 3B0DB 2CV5A 5AV5C 2NZDA 5BNVB 5AVBB 3LZ1D 4WU9B 1M1AD 5B0YD 3B6FA 2HIOA 4WNNA 3W99A 1AOIC 4WZSB 3X1TC 1P3PD 3AYWC 4H9SC 1M18C 1AOIB 4JJND 3LZ0C 3NQJA 4DRBA 3AZGD 3X1TB 3VH6T 3AYWB 5B31G 1M18B 3W96D 2PYOD 5B1MD 5AV9C 3LZ0B 3AZIC 4KGCA 3MVDC 5AV9B 3REJD 4J8WC 1TZYA 3MVDB 1P3GC 3AZKD 3AZND 5DNMC 4J8WB 3WA9A 5B32C 1M19A 2F8NB 3AN2D 1P3GB 5B2IA 3O62D 5G49A 4WU9D 3KXBC 2JSSA 1TAFA 5B32B 3AZJB 1H3OA 5AV5D 2HUEB 5AY8C 3KXBB 2FJ7D 3WTPE 5CPIA 4HGAC 1F66B 2NZDC 1KX4B 5AY8B 5FUGB 3MGSA 5AV8B 3REKA 5GT0C 2CV5B 2NZDB 5GXQA 1M1AA 1P3MA 1KU5A 1KX3C 4LD9A 2HIOB 5CP6A 5GT0B 3W99B 3AZHC 3R45A 3MGRD 1KX3B 1A7WA 5AV9D 3AZID 4JJNA 5CPJC 3AZHB 1ULYA 5JRGD 1BH9A 3TU4A 2F8ND 5AV6C 5CPJB 4XUJC 3MGQC 3AZMC 5DNMD 5BNXA 3C1CC 5B1LD 5B32D 5B2JC 3MNND 1B67A 3REJA 5AV6B 4XUJB 3AZMB 1P3AA 3RELD 3C1CB 3AZKA 3AZNA 3V9RA 1HQ3C 5B2JB 3AV1D 5AY8D 4NE6A 5BNVA 5AVBA 3X1SD 3LELC 4WU9A 1HQ3B 5BO0A 3X1UD 4WU8C 3B6GC 1B6WA 5AV5A 5GT0D 3LELB 4UUZB 3MGPC 5CPIB 3LZ1C 1AOIA 3X1TA 5B0YC 3AYWA 4H9SA 3MGPB 1M18A 3UT9D 3LZ1B 4Z5TC 1P3PC 5B0YB 3AZGC 1P3PB 5AV9A 3LJAC 3AZIA 5AV6D 1S32C 3W96C 3MGQD 3AZMD 3MVDA 5AVCC 1U35D 2PYOC 5KDMB 5B1MC 3A6ND 4JJNB 5B2JD 3AZGB 3LJAB 4J8WA 3W96B 5AVCB 1BH9B 1P3GA 2F8NA 5B1MB 2PYOB 1HQ3D 5B40D 5DNMA 5B32A 4EO5C 3WTPD 3REIC 5B31D 1ID3C 3KXBA 4KUDD 3B0CT 5GT3C 3AN2C 3AZKB 3AV1A 4WU8D 3O62C 3AZNB 3B6GD 5AY8A 5FUGA 3V9RB 3REIB 3UTAD 1ID3B 5E5AD 2BYKB 3MGPD 5GT3B 3AN2B 3O62B 2AROD 2FJ7C 5BO0B 5GT0A 5AV5B 3X1VD 4Z5TD 1KX3A 1P3OC 2CWEA 2FJ7B 4J8VC 3AZHA 2YFVB 3LJAD 1S32D 5AVCD 5GSUC 3VH6W 4J8VB 5CPJA 3MGRC 4J8XD 2BYMA 4X23C 5AV6A 3NQUB 4XUJA 4NE3A 5JRGC 3MGQA 3MGRB 3AZIB 3AZMA 3C1CA 4X23B 5B2JA 3REID 5JRGB 1ID3D 5B1LC 3MNNC 5GT3D 1HQ3A
chains in the Genus database with same CATH superfamily
4G92C 5DNMB 3RELC 5B24C 5B1LB 5BT1D 3LELA 4UUZA 3MNNB 3AV1C 1T3UA 4Z66D 5C3IC 3AZLC 4WU8A 3RELB 3X1SC 3B6GA 3AV1B 3UTAA 3X1UC 3MGPA 1P3OD 3EG5B 3X1SB 4HGAB 3LZ1A 4NFTA 5CPKD 4J8VD 2YFWA 5B0YA 3X1UB 4KHAB 1WWSA 1P3ID 4Z5TA 5GSUD 1P3PA 2Y2PA 3VH5T 5KDMA 4X23D 2Y2MA 3UT9C 3AZGA 3AZED 3LJAA 1S32A 3W96A 1JFIB 5AVCA 2F8NH 2PYOA 5B1MA 3UT9B 3KWQD 5F99C 4Z2MH 1U35C 2BYMB 3A6NC 3MGQB 2UWXA 4J8UC 3W97D 1U35B 5B24D 3A6NB 3REIA 5B40C 1ID3A 4NE5A 4YS3C 2BYKA 3AZLD 5GT3A 3AN2A 3WTPC 3O62A 3IP4C 5B31C 5B40B 4KUDC 1P3BD 3EPJA 3WTPB 5B31B 3UTAC 4KUDB 2FJ7A 4E44A 3B0BA 3FDDA 5E5AC 4WU8B 3B6GB 4ZUXD 2AROC 1P34D 1KX5D 1ZLAD 2YFVA 3UTAB 1P3OA 2NQBC 5E5AB 4G91C 4J8VA 5B0ZD 3X1VC 2AROB 1KX5B 2YFWB 4R8PD 3WAAD 4YM6C 3UTBD 3WKJD 3KSYA 2NQBB 4G91B 5GSUA 5DNNC 3NQUA 3MGRA 4Z5TB 5BS7C 3X1VB 4H9PA 5F99D 2DQNC 4X23A 3A1IA 3A1KA 2Y2GA 2RVQC 5JRGA 4J8XC 1S32B 2F8NG 1N1JA 4J8UD 4M6BA 4Z2MG 5B32G 4J8XB 5B1LA 4ZBJC 4YS3D 3MNNA 4H9RB 1P3LC 1EQZC 3RELA 5B24A 4KGCD 4EO5B 4ZBJB 3B0CW 1P3LB 3AZLA 3X1SA 5BT1C 1TZYD 4Z66C 1P3FD 3X1UA 1Z2CB 4KHAA 2NQBD 3H0LC 3WA9D 2JCHA 4Z66B 3REHC 1M19D 3W98C 1BH8A 5B2ID 4YM6D 5CPKC 5DNND 3KUYD 3W98B 1JFIA 1P3OB 3B0DC 3UT9A 1P3IC 2Y2KA 5CPKB 3EPLA 3UTBA 2RVQD 4H9QA 3REKD 3AFAC 1P3IB 1BFMA 5GSUB 3AZEC 5GXQD 5F99A 1P3MD 1U35A 4H9PB 4LD9D 3A6NA 5CP6D 3AFAB 3KWQC 3AZEB 1P3LD 1EQZD 4H9NB 5JA4B 4J8UA 4WV4B 5B33C 1N1JB 3C1BC 3KWQB 5B40A 2VQRA 3VH6A 3W97C 4YS3A 5B33B 4H9OB 3WTPA 3TU4D 3C1BB 5B31A 4KUDA 1R4VA 4G92B 3W97B 2IO5C 4QLCD 5B24B 4XZQC 3REHD 5C3IB 1P3BC 2F8NK 3W98D 5E5AA 3AZLB 2IO5B 1P3AD 1P3FA 2AROA 3AZFD 1P3KD 4XZQB 2J8PA 1P3BB 2NQBA 3AZJC 4ZUXC 1P34C 4CSRB 3X1VA 5AVBD 2HUEC 4E45A 1KX5C 1ZLAC 4YM6A 1BH8B 4CAYB 3H0RC 1F66C 5B0ZC 4ZUXB 5DNNA 3AFAD 3KUYA 1P34B 4R8PC 3WAAC 3VH5W 5BS7A 3UTBC 5AV8C 1KX4C 1F1EA 3AV2C 3WKJC 5B0ZB 2CV5C 2Y2HA 4R8PB 1AOID 3WAAB 4J8XA 3X1TD 3UTBB 3WKJB 3AV2B 3B6FC 2HIOC 5B33D 4H9QB 3AYWD 1M18D 4H9RA 3W99C 3C1BD 4DRAA 5F99B 3LZ0D 3B6FB 2ZY3A 4WNNB 1P3LA 1EQZA 3EPHA 3VH5A 4J8UB 3MVDD 2Y2NA 4XZQD 3NQJB 4KGCC 2JE5A 4J8WD 4YS3B 1Q9CA 4Z66A 1P3GD 4QLCA 4KGCB 1TZYC 4AWLC 3AZJD 1P3FC 3REHA 2XD1A 3W98A 3KXBD 3WA9C 1TZYB 4AWLB 3AZFA 5CPKA 1P3KA 1P3FB 1M19C 1F66D 1ZLAB 1KX4D 5B2IC 5AV8D 3AV2D 3WA9B 1P3IA 5CHLB 3KUYC 2CV5D 1M19B 2NZDD 5B2IB 5G49B 4YM6B 3B6FD 2HIOD 2LY8A 1TAFB 5CPIC 3AFAA 1H3OB 2G5IC 3AZEA 1HTAA 3W99D 5DNNB 4H9NA 3KUYB 2Y2LA 1WWIA 5JA4A 3MGSC 1KX3D 3KFUG 3REKC 3KWQA 5GXQC 1M1AC 1P3MC 3AZHD 3MGSB 5B33A 4H9OA 4LD9C 3REKB 5CP6C 3C1BA 5GXQB 3LZ0A 1M1AB 5CPJD 3W97A 1P3MB 3AL0C 2DF4C 4LD9B 5CP6B 4JJNC 1EQZB 3R45B 4XUJD 3TU4C 3C1CD 4XZQA 3P5JB 1P3BA 4QLCC 2L5AA 2Y2JA 4CSRA 3TU4B 3REJC 4CAYA 3AZJA 1P3AC 4QLCB 4ZUXA 5BNXB 3AZKC 3AZFC 1P34A 3AZNC 1P3KC 1KX5A 3LELD 3REHB 1ZLAA 3REJB 1F66A 5B0ZA 1P3AB 5AVBC 1KX4A 3AZFB 5CPID 4R8PA 1P3KB 3WAAA 4WU9C 3WKJA 5AV8A 2Y2OA 3AV2A 3MGSD 3B0DB 2CV5A 5AV5C 2NZDA 5BNVB 5AVBB 3LZ1D 4WU9B 1M1AD 5B0YD 3B6FA 2HIOA 3H0MC 4WNNA 3W99A 1AOIC 4WZSB 3X1TC 2BG1A 1P3PD 3AYWC 4H9SC 1M18C 1AOIB 4JJND 3LZ0C 3NQJA 4DRBA 3AZGD 3X1TB 3VH6T 3AYWB 5B31G 1M18B 3W96D 2PYOD 5B1MD 5AV9C 3LZ0B 3AZIC 4KGCA 4DQYB 3MVDC 4UPKA 5AV9B 3REJD 4J8WC 1TZYA 3MVDB 2RIQA 1P3GC 3AZKD 3AZND 5DNMC 4J8WB 3WA9A 5B32C 2ZM5A 1M19A 3AN2D 1P3GB 2F8NB 5B2IA 3O62D 5G49A 4WU9D 3KXBC 2JSSA 2W8SA 1TAFA 5B32B 3AZJB 1H3OA 5AV5D 2HUEB 5AY8C 3KXBB 2FJ7D 3WTPE 2ZY5A 4HGAC 5CPIA 1F66B 2NZDC 1KX4B 2F2AC 5AY8B 5FUGB 3MGSA 5AV8B 3EPKA 3REKA 5GT0C 2CV5B 2NZDB 5GXQA 1M1AA 1P3MA 1KU5A 1KX3C 2G5HC 2Y2IA 4LD9A 2HIOB 5CP6A 5GT0B 3W99B 3AZHC 3R45A 3MGRD 1KX3B 1A7WA 5AV9D 3AZID 2FFFB 4WJ3C 4JJNA 5CPJC 3AZHB 1ULYA 5JRGD 1W2EA 1BH9A 3TU4A 2F8ND 5AV6C 5CPJB 4XUJC 3MGQC 3AZMC 5DNMD 5BNXA 3C1CC 5B1LD 5B32D 5B2JC 3MNND 1B67A 3REJA 5AV6B 4XUJB 3AZMB 1P3AA 3RELD 3C1CB 3AZKA 3AZNA 3V9RA 1HQ3C 5B2JB 3AV1D 5AY8D 4NE6A 5BNVA 5AVBA 3X1SD 3LELC 4WU9A 1HQ3B 5BO0A 3X1UD 4WU8C 3B6GC 1B6WA 5AV5A 2ZY2A 5GT0D 3LELB 4UUZB 2XD5A 3MGPC 5CPIB 3LZ1C 1AOIA 3X1TA 5B0YC 3AYWA 4H9SA 3MGPB 1M18A 3UT9D 3LZ1B 4Z5TC 1P3PC 5B0YB 3AZGC 1P3PB 5AV9A 3LJAC 3AZIA 5AV6D 1S32C 3W96C 3MGQD 3AZMD 3MVDA 5AVCC 1U35D 2PYOC 5KDMB 5B1MC 3A6ND 4JJNB 5B2JD 3AZGB 3LJAB 4J8WA 3W96B 5AVCB 1BH9B 1P3GA 2F8NA 5B1MB 2PYOB 1HQ3D 5DNMA 5B40D 2Y2QA 5B32A 4EO5C 3WTPD 3REIC 5B31D 1ID3C 3KXBA 2ZY4A 4KUDD 3B0CT 5GT3C 3AN2C 3AZKB 3AV1A 4WU8D 3O62C 3AZNB 3B6GD 5AY8A 5FUGA 3V9RB 3REIB 3UTAD 1ID3B 5E5AD 2BYKB 3MGPD 5GT3B 3AN2B 3O62B 2AROD 2FJ7C 5BO0B 5GT0A 5AV5B 3X1VD 4Z5TD 1KX3A 1P3OC 2CWEA 2FJ7B 4J8VC 3AZHA 1PZRA 2YFVB 3LJAD 1S32D 5AVCD 5GSUC 3VH6W 4J8VB 5CPJA 3MGRC 4J8XD 2BYMA 4X23C 5AV6A 3NQUB 4XUJA 4NE3A 5JRGC 3MGQA 3MGRB 3AZIB 3AZMA 3C1CA 4X23B 3F6TA 5B2JA 3REID 5JRGB 1ID3D 5B1LC 3MNNC 5GT3D 1HQ3A
chains in the Genus database with same CATH topology
4G92C 5DNMB 3RELC 5B24C 5B1LB 5BT1D 3LELA 4UUZA 3MNNB 3AV1C 1T3UA 4Z66D 5C3IC 3AZLC 4WU8A 3RELB 3X1SC 3B6GA 3AV1B 3UTAA 3X1UC 3MGPA 1P3OD 3EG5B 3X1SB 4HGAB 3LZ1A 4NFTA 5CPKD 4J8VD 2YFWA 5B0YA 3X1UB 4KHAB 1WWSA 1P3ID 4Z5TA 5GSUD 1P3PA 2Y2PA 3VH5T 5KDMA 4X23D 2Y2MA 3UT9C 3AZGA 3AZED 3LJAA 1S32A 3W96A 1JFIB 5AVCA 2F8NH 2PYOA 5B1MA 3UT9B 3KWQD 5F99C 4Z2MH 1U35C 2BYMB 3A6NC 3MGQB 2UWXA 4J8UC 3W97D 1U35B 5B24D 3A6NB 3REIA 5B40C 1ID3A 4NE5A 4YS3C 2BYKA 3AZLD 5GT3A 3AN2A 3WTPC 3O62A 3IP4C 5B31C 5B40B 4KUDC 1P3BD 3EPJA 3WTPB 5B31B 3UTAC 4KUDB 2FJ7A 4E44A 3B0BA 3FDDA 5E5AC 4WU8B 3B6GB 4ZUXD 2AROC 1P34D 1KX5D 1ZLAD 2YFVA 3UTAB 1P3OA 2NQBC 5E5AB 4G91C 4J8VA 5B0ZD 3X1VC 2AROB 1KX5B 2YFWB 4R8PD 3WAAD 4YM6C 3UTBD 3WKJD 3KSYA 2NQBB 4G91B 5GSUA 5DNNC 3NQUA 3MGRA 4Z5TB 5BS7C 3X1VB 4H9PA 5F99D 2DQNC 4X23A 3A1IA 3A1KA 2Y2GA 2RVQC 5JRGA 4J8XC 1S32B 2F8NG 1N1JA 4J8UD 4M6BA 4Z2MG 5B32G 4J8XB 5B1LA 4ZBJC 4YS3D 3MNNA 4H9RB 1P3LC 1EQZC 3RELA 5B24A 4KGCD 4EO5B 4ZBJB 3B0CW 1P3LB 3AZLA 3X1SA 5BT1C 1TZYD 4Z66C 1P3FD 3X1UA 1Z2CB 4KHAA 2NQBD 3H0LC 3WA9D 2JCHA 4Z66B 3REHC 1M19D 3W98C 1BH8A 5B2ID 4YM6D 5CPKC 5DNND 3KUYD 3W98B 1JFIA 1P3OB 3B0DC 3UT9A 1P3IC 2Y2KA 5CPKB 3EPLA 3UTBA 2RVQD 4H9QA 3REKD 3AFAC 1P3IB 1BFMA 5GSUB 3AZEC 5GXQD 5F99A 1P3MD 1U35A 4H9PB 4LD9D 3A6NA 5CP6D 3AFAB 3KWQC 3AZEB 1P3LD 1EQZD 4H9NB 5JA4B 4J8UA 4WV4B 5B33C 1N1JB 3C1BC 3KWQB 5B40A 2VQRA 3VH6A 3W97C 4YS3A 5B33B 4H9OB 3WTPA 3TU4D 3C1BB 5B31A 4KUDA 1R4VA 4G92B 3W97B 2IO5C 4QLCD 5B24B 4XZQC 3REHD 5C3IB 1P3BC 2F8NK 3W98D 5E5AA 3AZLB 2IO5B 1P3AD 1P3FA 2AROA 3AZFD 1P3KD 4XZQB 2J8PA 1P3BB 2NQBA 3AZJC 4ZUXC 1P34C 4CSRB 3X1VA 5AVBD 2HUEC 4E45A 1KX5C 1ZLAC 4YM6A 1BH8B 4CAYB 3H0RC 1F66C 5B0ZC 4ZUXB 5DNNA 3AFAD 3KUYA 1P34B 4R8PC 3WAAC 3VH5W 5BS7A 3UTBC 5AV8C 1KX4C 1F1EA 3AV2C 3WKJC 5B0ZB 2CV5C 2Y2HA 4R8PB 1AOID 3WAAB 4J8XA 3X1TD 3UTBB 3WKJB 3AV2B 3B6FC 2HIOC 5B33D 4H9QB 3AYWD 1M18D 4H9RA 3W99C 3C1BD 4DRAA 5F99B 3LZ0D 3B6FB 2ZY3A 4WNNB 1P3LA 1EQZA 3EPHA 3VH5A 4J8UB 3MVDD 2Y2NA 4XZQD 3NQJB 4KGCC 2JE5A 4J8WD 4YS3B 1Q9CA 4Z66A 1P3GD 4QLCA 4KGCB 1TZYC 4AWLC 3AZJD 1P3FC 3REHA 2XD1A 3W98A 3KXBD 3WA9C 1TZYB 4AWLB 3AZFA 5CPKA 1P3KA 1P3FB 1M19C 1F66D 1ZLAB 1KX4D 5B2IC 5AV8D 3AV2D 3WA9B 1P3IA 5CHLB 3KUYC 2CV5D 1M19B 2NZDD 5B2IB 5G49B 4YM6B 3B6FD 2HIOD 2LY8A 1TAFB 5CPIC 3AFAA 1H3OB 2G5IC 3AZEA 1HTAA 3W99D 5DNNB 4H9NA 3KUYB 2Y2LA 1WWIA 5JA4A 3MGSC 1KX3D 3KFUG 3REKC 3KWQA 5GXQC 1M1AC 1P3MC 3AZHD 3MGSB 5B33A 4H9OA 4LD9C 3REKB 5CP6C 3C1BA 5GXQB 3LZ0A 1M1AB 5CPJD 3W97A 1P3MB 3AL0C 2DF4C 4LD9B 5CP6B 4JJNC 1EQZB 3R45B 4XUJD 3TU4C 3C1CD 4XZQA 3P5JB 1P3BA 4QLCC 2L5AA 2Y2JA 4CSRA 3TU4B 3REJC 4CAYA 3AZJA 1P3AC 4QLCB 4ZUXA 5BNXB 3AZKC 3AZFC 1P34A 3AZNC 1P3KC 1KX5A 3LELD 3REHB 1ZLAA 3REJB 1F66A 5B0ZA 1P3AB 5AVBC 1KX4A 3AZFB 5CPID 4R8PA 1P3KB 3WAAA 4WU9C 3WKJA 5AV8A 2Y2OA 3AV2A 3MGSD 3B0DB 2CV5A 5AV5C 2NZDA 5BNVB 5AVBB 3LZ1D 4WU9B 1M1AD 5B0YD 3B6FA 2HIOA 3H0MC 4WNNA 3W99A 1AOIC 4WZSB 3X1TC 2BG1A 1P3PD 3AYWC 4H9SC 1M18C 1AOIB 4JJND 3LZ0C 3NQJA 4DRBA 3AZGD 3X1TB 3VH6T 3AYWB 5B31G 1M18B 3W96D 2PYOD 5B1MD 5AV9C 3LZ0B 3AZIC 4KGCA 4DQYB 3MVDC 4UPKA 5AV9B 3REJD 4J8WC 1TZYA 3MVDB 2RIQA 1P3GC 3AZKD 3AZND 5DNMC 4J8WB 3WA9A 5B32C 2ZM5A 1M19A 3AN2D 1P3GB 2F8NB 5B2IA 3O62D 5G49A 4WU9D 3KXBC 2JSSA 2W8SA 1TAFA 5B32B 3AZJB 1H3OA 5AV5D 2HUEB 5AY8C 3KXBB 2FJ7D 3WTPE 2ZY5A 4HGAC 5CPIA 1F66B 2NZDC 1KX4B 2F2AC 5AY8B 5FUGB 3MGSA 5AV8B 3EPKA 3REKA 5GT0C 2CV5B 2NZDB 5GXQA 1M1AA 1P3MA 1KU5A 1KX3C 2G5HC 2Y2IA 4LD9A 2HIOB 5CP6A 5GT0B 3W99B 3AZHC 3R45A 3MGRD 1KX3B 1A7WA 5AV9D 3AZID 2FFFB 4WJ3C 4JJNA 5CPJC 3AZHB 1ULYA 5JRGD 1W2EA 1BH9A 3TU4A 2F8ND 5AV6C 5CPJB 4XUJC 3MGQC 3AZMC 5DNMD 5BNXA 3C1CC 5B1LD 5B32D 5B2JC 3MNND 1B67A 3REJA 5AV6B 4XUJB 3AZMB 1P3AA 3RELD 3C1CB 3AZKA 3AZNA 3V9RA 1HQ3C 5B2JB 3AV1D 5AY8D 4NE6A 5BNVA 5AVBA 3X1SD 3LELC 4WU9A 1HQ3B 5BO0A 3X1UD 4WU8C 3B6GC 1B6WA 5AV5A 2ZY2A 5GT0D 3LELB 4UUZB 2XD5A 3MGPC 5CPIB 3LZ1C 1AOIA 3X1TA 5B0YC 3AYWA 4H9SA 3MGPB 1M18A 3UT9D 3LZ1B 4Z5TC 1P3PC 5B0YB 3AZGC 1P3PB 5AV9A 3LJAC 3AZIA 5AV6D 1S32C 3W96C 3MGQD 3AZMD 3MVDA 5AVCC 1U35D 2PYOC 5KDMB 5B1MC 3A6ND 4JJNB 5B2JD 3AZGB 3LJAB 4J8WA 3W96B 5AVCB 1BH9B 1P3GA 2F8NA 5B1MB 2PYOB 1HQ3D 5DNMA 5B40D 2Y2QA 5B32A 4EO5C 3WTPD 3REIC 5B31D 1ID3C 3KXBA 2ZY4A 4KUDD 3B0CT 5GT3C 3AN2C 3AZKB 3AV1A 4WU8D 3O62C 3AZNB 3B6GD 5AY8A 5FUGA 3V9RB 3REIB 3UTAD 1ID3B 5E5AD 2BYKB 3MGPD 5GT3B 3AN2B 3O62B 2AROD 2FJ7C 5BO0B 5GT0A 5AV5B 3X1VD 4Z5TD 1KX3A 1P3OC 2CWEA 2FJ7B 4J8VC 3AZHA 1PZRA 2YFVB 3LJAD 1S32D 5AVCD 5GSUC 3VH6W 4J8VB 5CPJA 3MGRC 4J8XD 2BYMA 4X23C 5AV6A 3NQUB 4XUJA 4NE3A 5JRGC 3MGQA 3MGRB 3AZIB 3AZMA 3C1CA 4X23B 3F6TA 5B2JA 3REID 5JRGB 1ID3D 5B1LC 3MNNC 5GT3D 1HQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G92 C;  5DNM B;  3REL C;  5B24 C;  5B1L B;  5BT1 D;  3LEL A;  4UUZ A;  3MNN B;  3AV1 C;  4Z66 D;  5C3I C;  3AZL C;  4WU8 A;  3REL B;  3X1S C;  3B6G A;  3AV1 B;  3UTA A;  3X1U C;  3MGP A;  1P3O D;  3X1S B;  4HGA B;  3LZ1 A;  4NFT A;  5CPK D;  4J8V D;  2YFW A;  5B0Y A;  3X1U B;  4KHA B;  1WWS A;  1P3I D;  4Z5T A;  5GSU D;  1P3P A;  3VH5 T;  5KDM A;  4X23 D;  3UT9 C;  3AZG A;  3AZE D;  3LJA A;  1S32 A;  3W96 A;  1JFI B;  5AVC A;  2F8N H;  2PYO A;  5B1M A;  3UT9 B;  3KWQ D;  5F99 C;  4Z2M H;  1U35 C;  2BYM B;  3A6N C;  3MGQ B;  4J8U C;  3W97 D;  1U35 B;  5B24 D;  3A6N B;  3REI A;  5B40 C;  1ID3 A;  4NE5 A;  4YS3 C;  2BYK A;  3AZL D;  5GT3 A;  3AN2 A;  3WTP C;  3O62 A;  5B31 C;  5B40 B;  4KUD C;  1P3B D;  3WTP B;  5B31 B;  3UTA C;  4KUD B;  2FJ7 A;  4E44 A;  3B0B A;  5E5A C;  4WU8 B;  3B6G B;  4ZUX D;  2ARO C;  1P34 D;  1KX5 D;  1ZLA D;  2YFV A;  3UTA B;  1P3O A;  2NQB C;  5E5A B;  4G91 C;  4J8V A;  5B0Z D;  3X1V C;  2ARO B;  1KX5 B;  2YFW B;  4R8P D;  3WAA D;  4YM6 C;  3UTB D;  3WKJ D;  3KSY A;  2NQB B;  4G91 B;  5GSU A;  5DNN C;  3NQU A;  3MGR A;  4Z5T B;  5BS7 C;  3X1V B;  4H9P A;  5F99 D;  4X23 A;  2RVQ C;  5JRG A;  4J8X C;  1S32 B;  2F8N G;  1N1J A;  4J8U D;  4M6B A;  4Z2M G;  5B32 G;  4J8X B;  5B1L A;  4ZBJ C;  4YS3 D;  3MNN A;  4H9R B;  1P3L C;  1EQZ C;  3REL A;  5B24 A;  4KGC D;  4EO5 B;  4ZBJ B;  3B0C W;  1P3L B;  3AZL A;  3X1S A;  5BT1 C;  1TZY D;  4Z66 C;  1P3F D;  3X1U A;  4KHA A;  2NQB D;  3WA9 D;  3REH C;  4Z66 B;  1M19 D;  3W98 C;  1BH8 A;  5B2I D;  4YM6 D;  5CPK C;  5DNN D;  3KUY D;  3W98 B;  1JFI A;  1P3O B;  3B0D C;  3UT9 A;  1P3I C;  5CPK B;  3UTB A;  2RVQ D;  4H9Q A;  3REK D;  3AFA C;  1P3I B;  1BFM A;  5GSU B;  3AZE C;  5GXQ D;  5F99 A;  1P3M D;  1U35 A;  4H9P B;  4LD9 D;  3A6N A;  5CP6 D;  3AFA B;  3KWQ C;  3AZE B;  1P3L D;  1EQZ D;  4H9N B;  5JA4 B;  4J8U A;  4WV4 B;  5B33 C;  1N1J B;  3C1B C;  3KWQ B;  5B40 A;  3VH6 A;  3W97 C;  4YS3 A;  5B33 B;  4H9O B;  3WTP A;  3TU4 D;  3C1B B;  5B31 A;  4KUD A;  1R4V A;  4G92 B;  3W97 B;  2IO5 C;  4QLC D;  5B24 B;  4XZQ C;  3REH D;  5C3I B;  1P3B C;  2F8N K;  3W98 D;  5E5A A;  3AZL B;  2IO5 B;  1P3A D;  1P3F A;  2ARO A;  3AZF D;  1P3K D;  4XZQ B;  1P3B B;  2NQB A;  3AZJ C;  4ZUX C;  1P34 C;  4CSR B;  3X1V A;  5AVB D;  2HUE C;  4E45 A;  1KX5 C;  1ZLA C;  4YM6 A;  1BH8 B;  4CAY B;  1F66 C;  5B0Z C;  4ZUX B;  5DNN A;  3AFA D;  3KUY A;  1P34 B;  4R8P C;  3WAA C;  3VH5 W;  5BS7 A;  3UTB C;  5AV8 C;  1KX4 C;  1F1E A;  3AV2 C;  3WKJ C;  5B0Z B;  2CV5 C;  4R8P B;  1AOI D;  3WAA B;  4J8X A;  3X1T D;  3UTB B;  3WKJ B;  3AV2 B;  3B6F C;  2HIO C;  5B33 D;  4H9Q B;  3AYW D;  1M18 D;  4H9R A;  3W99 C;  3C1B D;  4DRA A;  5F99 B;  3LZ0 D;  3B6F B;  4WNN B;  1P3L A;  1EQZ A;  3VH5 A;  4J8U B;  3MVD D;  4XZQ D;  3NQJ B;  4KGC C;  4J8W D;  4YS3 B;  1Q9C A;  4Z66 A;  1P3G D;  4QLC A;  4KGC B;  1TZY C;  4AWL C;  3AZJ D;  1P3F C;  3REH A;  3W98 A;  3KXB D;  3WA9 C;  1TZY B;  4AWL B;  3AZF A;  5CPK A;  1P3K A;  1P3F B;  1M19 C;  1F66 D;  1ZLA B;  1KX4 D;  5B2I C;  5AV8 D;  3AV2 D;  3WA9 B;  1P3I A;  5CHL B;  3KUY C;  2CV5 D;  1M19 B;  2NZD D;  5B2I B;  5G49 B;  4YM6 B;  3B6F D;  2HIO D;  2LY8 A;  1TAF B;  5CPI C;  3AFA A;  1H3O B;  3AZE A;  1HTA A;  3W99 D;  5DNN B;  4H9N A;  3KUY B;  5JA4 A;  1WWI A;  3MGS C;  1KX3 D;  3REK C;  3KWQ A;  5GXQ C;  1M1A C;  1P3M C;  3AZH D;  3MGS B;  5B33 A;  4H9O A;  4LD9 C;  3REK B;  5CP6 C;  3C1B A;  5GXQ B;  3LZ0 A;  1M1A B;  5CPJ D;  3W97 A;  1P3M B;  4LD9 B;  5CP6 B;  4JJN C;  1EQZ B;  3R45 B;  4XUJ D;  3TU4 C;  3C1C D;  4XZQ A;  1P3B A;  4QLC C;  2L5A A;  4CSR A;  3TU4 B;  3REJ C;  4CAY A;  3AZJ A;  1P3A C;  4QLC B;  4ZUX A;  5BNX B;  3AZK C;  3AZF C;  1P34 A;  3AZN C;  1P3K C;  1KX5 A;  3LEL D;  3REH B;  1ZLA A;  3REJ B;  1F66 A;  5B0Z A;  1P3A B;  5AVB C;  1KX4 A;  3AZF B;  5CPI D;  4R8P A;  1P3K B;  3WAA A;  4WU9 C;  3WKJ A;  5AV8 A;  3AV2 A;  3MGS D;  3B0D B;  2CV5 A;  5AV5 C;  2NZD A;  5BNV B;  5AVB B;  3LZ1 D;  4WU9 B;  1M1A D;  5B0Y D;  3B6F A;  2HIO A;  4WNN A;  3W99 A;  1AOI C;  4WZS B;  3X1T C;  1P3P D;  3AYW C;  4H9S C;  1M18 C;  1AOI B;  4JJN D;  3LZ0 C;  3NQJ A;  4DRB A;  3AZG D;  3X1T B;  3VH6 T;  3AYW B;  5B31 G;  1M18 B;  3W96 D;  2PYO D;  5B1M D;  5AV9 C;  3LZ0 B;  3AZI C;  4KGC A;  3MVD C;  5AV9 B;  3REJ D;  4J8W C;  1TZY A;  3MVD B;  1P3G C;  3AZK D;  3AZN D;  5DNM C;  4J8W B;  3WA9 A;  5B32 C;  1M19 A;  2F8N B;  3AN2 D;  1P3G B;  5B2I A;  3O62 D;  5G49 A;  4WU9 D;  3KXB C;  2JSS A;  1TAF A;  5B32 B;  3AZJ B;  1H3O A;  5AV5 D;  2HUE B;  5AY8 C;  3KXB B;  2FJ7 D;  3WTP E;  5CPI A;  4HGA C;  1F66 B;  2NZD C;  1KX4 B;  5AY8 B;  5FUG B;  3MGS A;  5AV8 B;  3REK A;  5GT0 C;  2CV5 B;  2NZD B;  5GXQ A;  1M1A A;  1P3M A;  1KU5 A;  1KX3 C;  4LD9 A;  2HIO B;  5CP6 A;  5GT0 B;  3W99 B;  3AZH C;  3R45 A;  3MGR D;  1KX3 B;  1A7W A;  5AV9 D;  3AZI D;  4JJN A;  5CPJ C;  3AZH B;  1ULY A;  5JRG D;  1BH9 A;  3TU4 A;  2F8N D;  5AV6 C;  5CPJ B;  4XUJ C;  3MGQ C;  3AZM C;  5DNM D;  5BNX A;  3C1C C;  5B1L D;  5B32 D;  5B2J C;  3MNN D;  1B67 A;  3REJ A;  5AV6 B;  4XUJ B;  3AZM B;  1P3A A;  3REL D;  3C1C B;  3AZK A;  3AZN A;  3V9R A;  1HQ3 C;  5B2J B;  3AV1 D;  5AY8 D;  4NE6 A;  5BNV A;  5AVB A;  3X1S D;  3LEL C;  4WU9 A;  1HQ3 B;  5BO0 A;  3X1U D;  4WU8 C;  3B6G C;  1B6W A;  5AV5 A;  5GT0 D;  3LEL B;  4UUZ B;  3MGP C;  5CPI B;  3LZ1 C;  1AOI A;  3X1T A;  5B0Y C;  3AYW A;  4H9S A;  3MGP B;  1M18 A;  3UT9 D;  3LZ1 B;  4Z5T C;  1P3P C;  5B0Y B;  3AZG C;  1P3P B;  5AV9 A;  3LJA C;  3AZI A;  5AV6 D;  1S32 C;  3W96 C;  3MGQ D;  3AZM D;  3MVD A;  5AVC C;  1U35 D;  2PYO C;  5KDM B;  5B1M C;  3A6N D;  4JJN B;  5B2J D;  3AZG B;  3LJA B;  4J8W A;  3W96 B;  5AVC B;  1BH9 B;  1P3G A;  2F8N A;  5B1M B;  2PYO B;  1HQ3 D;  5B40 D;  5DNM A;  5B32 A;  4EO5 C;  3WTP D;  3REI C;  5B31 D;  1ID3 C;  3KXB A;  4KUD D;  3B0C T;  5GT3 C;  3AN2 C;  3AZK B;  3AV1 A;  4WU8 D;  3O62 C;  3AZN B;  3B6G D;  5AY8 A;  5FUG A;  3V9R B;  3REI B;  3UTA D;  1ID3 B;  5E5A D;  2BYK B;  3MGP D;  5GT3 B;  3AN2 B;  3O62 B;  2ARO D;  2FJ7 C;  5BO0 B;  5GT0 A;  5AV5 B;  3X1V D;  4Z5T D;  1KX3 A;  1P3O C;  2CWE A;  2FJ7 B;  4J8V C;  3AZH A;  2YFV B;  3LJA D;  1S32 D;  5AVC D;  5GSU C;  3VH6 W;  4J8V B;  5CPJ A;  3MGR C;  4J8X D;  2BYM A;  4X23 C;  5AV6 A;  3NQU B;  4XUJ A;  4NE3 A;  5JRG C;  3MGQ A;  3MGR B;  3AZI B;  3AZM A;  3C1C A;  4X23 B;  5B2J A;  3REI D;  5JRG B;  1ID3 D;  5B1L C;  3MNN C;  5GT3 D;  1HQ3 A; 
#chains in the Genus database with same CATH topology
 4G92 C;  5DNM B;  3REL C;  5B24 C;  5B1L B;  5BT1 D;  3LEL A;  4UUZ A;  3MNN B;  3AV1 C;  1T3U A;  4Z66 D;  5C3I C;  3AZL C;  4WU8 A;  3REL B;  3X1S C;  3B6G A;  3AV1 B;  3UTA A;  3X1U C;  3MGP A;  1P3O D;  3EG5 B;  3X1S B;  4HGA B;  3LZ1 A;  4NFT A;  5CPK D;  4J8V D;  2YFW A;  5B0Y A;  3X1U B;  4KHA B;  1WWS A;  1P3I D;  4Z5T A;  5GSU D;  1P3P A;  2Y2P A;  3VH5 T;  5KDM A;  4X23 D;  2Y2M A;  3UT9 C;  3AZG A;  3AZE D;  3LJA A;  1S32 A;  3W96 A;  1JFI B;  5AVC A;  2F8N H;  2PYO A;  5B1M A;  3UT9 B;  3KWQ D;  5F99 C;  4Z2M H;  1U35 C;  2BYM B;  3A6N C;  3MGQ B;  2UWX A;  4J8U C;  3W97 D;  1U35 B;  5B24 D;  3A6N B;  3REI A;  5B40 C;  1ID3 A;  4NE5 A;  4YS3 C;  2BYK A;  3AZL D;  5GT3 A;  3AN2 A;  3WTP C;  3O62 A;  3IP4 C;  5B31 C;  5B40 B;  4KUD C;  1P3B D;  3EPJ A;  3WTP B;  5B31 B;  3UTA C;  4KUD B;  2FJ7 A;  4E44 A;  3B0B A;  3FDD A;  5E5A C;  4WU8 B;  3B6G B;  4ZUX D;  2ARO C;  1P34 D;  1KX5 D;  1ZLA D;  2YFV A;  3UTA B;  1P3O A;  2NQB C;  5E5A B;  4G91 C;  4J8V A;  5B0Z D;  3X1V C;  2ARO B;  1KX5 B;  2YFW B;  4R8P D;  3WAA D;  4YM6 C;  3UTB D;  3WKJ D;  3KSY A;  2NQB B;  4G91 B;  5GSU A;  5DNN C;  3NQU A;  3MGR A;  4Z5T B;  5BS7 C;  3X1V B;  4H9P A;  5F99 D;  2DQN C;  4X23 A;  3A1I A;  3A1K A;  2Y2G A;  2RVQ C;  5JRG A;  4J8X C;  1S32 B;  2F8N G;  1N1J A;  4J8U D;  4M6B A;  4Z2M G;  5B32 G;  4J8X B;  5B1L A;  4ZBJ C;  4YS3 D;  3MNN A;  4H9R B;  1P3L C;  1EQZ C;  3REL A;  5B24 A;  4KGC D;  4EO5 B;  4ZBJ B;  3B0C W;  1P3L B;  3AZL A;  3X1S A;  5BT1 C;  1TZY D;  4Z66 C;  1P3F D;  3X1U A;  1Z2C B;  4KHA A;  2NQB D;  3H0L C;  3WA9 D;  2JCH A;  4Z66 B;  3REH C;  1M19 D;  3W98 C;  1BH8 A;  5B2I D;  4YM6 D;  5CPK C;  5DNN D;  3KUY D;  3W98 B;  1JFI A;  1P3O B;  3B0D C;  3UT9 A;  1P3I C;  2Y2K A;  5CPK B;  3EPL A;  3UTB A;  2RVQ D;  4H9Q A;  3REK D;  3AFA C;  1P3I B;  1BFM A;  5GSU B;  3AZE C;  5GXQ D;  5F99 A;  1P3M D;  1U35 A;  4H9P B;  4LD9 D;  3A6N A;  5CP6 D;  3AFA B;  3KWQ C;  3AZE B;  1P3L D;  1EQZ D;  4H9N B;  5JA4 B;  4J8U A;  4WV4 B;  5B33 C;  1N1J B;  3C1B C;  3KWQ B;  5B40 A;  2VQR A;  3VH6 A;  3W97 C;  4YS3 A;  5B33 B;  4H9O B;  3WTP A;  3TU4 D;  3C1B B;  5B31 A;  4KUD A;  1R4V A;  4G92 B;  3W97 B;  2IO5 C;  4QLC D;  5B24 B;  4XZQ C;  3REH D;  5C3I B;  1P3B C;  2F8N K;  3W98 D;  5E5A A;  3AZL B;  2IO5 B;  1P3A D;  1P3F A;  2ARO A;  3AZF D;  1P3K D;  4XZQ B;  2J8P A;  1P3B B;  2NQB A;  3AZJ C;  4ZUX C;  1P34 C;  4CSR B;  3X1V A;  5AVB D;  2HUE C;  4E45 A;  1KX5 C;  1ZLA C;  4YM6 A;  1BH8 B;  4CAY B;  3H0R C;  1F66 C;  5B0Z C;  4ZUX B;  5DNN A;  3AFA D;  3KUY A;  1P34 B;  4R8P C;  3WAA C;  3VH5 W;  5BS7 A;  3UTB C;  5AV8 C;  1KX4 C;  1F1E A;  3AV2 C;  3WKJ C;  5B0Z B;  2CV5 C;  2Y2H A;  4R8P B;  1AOI D;  3WAA B;  4J8X A;  3X1T D;  3UTB B;  3WKJ B;  3AV2 B;  3B6F C;  2HIO C;  5B33 D;  4H9Q B;  3AYW D;  1M18 D;  4H9R A;  3W99 C;  3C1B D;  4DRA A;  5F99 B;  3LZ0 D;  3B6F B;  2ZY3 A;  4WNN B;  1P3L A;  1EQZ A;  3EPH A;  3VH5 A;  4J8U B;  3MVD D;  2Y2N A;  4XZQ D;  3NQJ B;  4KGC C;  2JE5 A;  4J8W D;  4YS3 B;  1Q9C A;  4Z66 A;  1P3G D;  4QLC A;  4KGC B;  1TZY C;  4AWL C;  3AZJ D;  1P3F C;  3REH A;  2XD1 A;  3W98 A;  3KXB D;  3WA9 C;  1TZY B;  4AWL B;  3AZF A;  5CPK A;  1P3K A;  1P3F B;  1M19 C;  1F66 D;  1ZLA B;  1KX4 D;  5B2I C;  5AV8 D;  3AV2 D;  3WA9 B;  1P3I A;  5CHL B;  3KUY C;  2CV5 D;  1M19 B;  2NZD D;  5B2I B;  5G49 B;  4YM6 B;  3B6F D;  2HIO D;  2LY8 A;  1TAF B;  5CPI C;  3AFA A;  1H3O B;  2G5I C;  3AZE A;  1HTA A;  3W99 D;  5DNN B;  4H9N A;  3KUY B;  2Y2L A;  1WWI A;  5JA4 A;  3MGS C;  1KX3 D;  3KFU G;  3REK C;  3KWQ A;  5GXQ C;  1M1A C;  1P3M C;  3AZH D;  3MGS B;  5B33 A;  4H9O A;  4LD9 C;  3REK B;  5CP6 C;  3C1B A;  5GXQ B;  3LZ0 A;  1M1A B;  5CPJ D;  3W97 A;  1P3M B;  3AL0 C;  2DF4 C;  4LD9 B;  5CP6 B;  4JJN C;  1EQZ B;  3R45 B;  4XUJ D;  3TU4 C;  3C1C D;  4XZQ A;  3P5J B;  1P3B A;  4QLC C;  2L5A A;  2Y2J A;  4CSR A;  3TU4 B;  3REJ C;  4CAY A;  3AZJ A;  1P3A C;  4QLC B;  4ZUX A;  5BNX B;  3AZK C;  3AZF C;  1P34 A;  3AZN C;  1P3K C;  1KX5 A;  3LEL D;  3REH B;  1ZLA A;  3REJ B;  1F66 A;  5B0Z A;  1P3A B;  5AVB C;  1KX4 A;  3AZF B;  5CPI D;  4R8P A;  1P3K B;  3WAA A;  4WU9 C;  3WKJ A;  5AV8 A;  2Y2O A;  3AV2 A;  3MGS D;  3B0D B;  2CV5 A;  5AV5 C;  2NZD A;  5BNV B;  5AVB B;  3LZ1 D;  4WU9 B;  1M1A D;  5B0Y D;  3B6F A;  2HIO A;  3H0M C;  4WNN A;  3W99 A;  1AOI C;  4WZS B;  3X1T C;  2BG1 A;  1P3P D;  3AYW C;  4H9S C;  1M18 C;  1AOI B;  4JJN D;  3LZ0 C;  3NQJ A;  4DRB A;  3AZG D;  3X1T B;  3VH6 T;  3AYW B;  5B31 G;  1M18 B;  3W96 D;  2PYO D;  5B1M D;  5AV9 C;  3LZ0 B;  3AZI C;  4KGC A;  4DQY B;  3MVD C;  4UPK A;  5AV9 B;  3REJ D;  4J8W C;  1TZY A;  3MVD B;  2RIQ A;  1P3G C;  3AZK D;  3AZN D;  5DNM C;  4J8W B;  3WA9 A;  5B32 C;  2ZM5 A;  1M19 A;  3AN2 D;  1P3G B;  2F8N B;  5B2I A;  3O62 D;  5G49 A;  4WU9 D;  3KXB C;  2JSS A;  2W8S A;  1TAF A;  5B32 B;  3AZJ B;  1H3O A;  5AV5 D;  2HUE B;  5AY8 C;  3KXB B;  2FJ7 D;  3WTP E;  2ZY5 A;  4HGA C;  5CPI A;  1F66 B;  2NZD C;  1KX4 B;  2F2A C;  5AY8 B;  5FUG B;  3MGS A;  5AV8 B;  3EPK A;  3REK A;  5GT0 C;  2CV5 B;  2NZD B;  5GXQ A;  1M1A A;  1P3M A;  1KU5 A;  1KX3 C;  2G5H C;  2Y2I A;  4LD9 A;  2HIO B;  5CP6 A;  5GT0 B;  3W99 B;  3AZH C;  3R45 A;  3MGR D;  1KX3 B;  1A7W A;  5AV9 D;  3AZI D;  2FFF B;  4WJ3 C;  4JJN A;  5CPJ C;  3AZH B;  1ULY A;  5JRG D;  1W2E A;  1BH9 A;  3TU4 A;  2F8N D;  5AV6 C;  5CPJ B;  4XUJ C;  3MGQ C;  3AZM C;  5DNM D;  5BNX A;  3C1C C;  5B1L D;  5B32 D;  5B2J C;  3MNN D;  1B67 A;  3REJ A;  5AV6 B;  4XUJ B;  3AZM B;  1P3A A;  3REL D;  3C1C B;  3AZK A;  3AZN A;  3V9R A;  1HQ3 C;  5B2J B;  3AV1 D;  5AY8 D;  4NE6 A;  5BNV A;  5AVB A;  3X1S D;  3LEL C;  4WU9 A;  1HQ3 B;  5BO0 A;  3X1U D;  4WU8 C;  3B6G C;  1B6W A;  5AV5 A;  2ZY2 A;  5GT0 D;  3LEL B;  4UUZ B;  2XD5 A;  3MGP C;  5CPI B;  3LZ1 C;  1AOI A;  3X1T A;  5B0Y C;  3AYW A;  4H9S A;  3MGP B;  1M18 A;  3UT9 D;  3LZ1 B;  4Z5T C;  1P3P C;  5B0Y B;  3AZG C;  1P3P B;  5AV9 A;  3LJA C;  3AZI A;  5AV6 D;  1S32 C;  3W96 C;  3MGQ D;  3AZM D;  3MVD A;  5AVC C;  1U35 D;  2PYO C;  5KDM B;  5B1M C;  3A6N D;  4JJN B;  5B2J D;  3AZG B;  3LJA B;  4J8W A;  3W96 B;  5AVC B;  1BH9 B;  1P3G A;  2F8N A;  5B1M B;  2PYO B;  1HQ3 D;  5DNM A;  5B40 D;  2Y2Q A;  5B32 A;  4EO5 C;  3WTP D;  3REI C;  5B31 D;  1ID3 C;  3KXB A;  2ZY4 A;  4KUD D;  3B0C T;  5GT3 C;  3AN2 C;  3AZK B;  3AV1 A;  4WU8 D;  3O62 C;  3AZN B;  3B6G D;  5AY8 A;  5FUG A;  3V9R B;  3REI B;  3UTA D;  1ID3 B;  5E5A D;  2BYK B;  3MGP D;  5GT3 B;  3AN2 B;  3O62 B;  2ARO D;  2FJ7 C;  5BO0 B;  5GT0 A;  5AV5 B;  3X1V D;  4Z5T D;  1KX3 A;  1P3O C;  2CWE A;  2FJ7 B;  4J8V C;  3AZH A;  1PZR A;  2YFV B;  3LJA D;  1S32 D;  5AVC D;  5GSU C;  3VH6 W;  4J8V B;  5CPJ A;  3MGR C;  4J8X D;  2BYM A;  4X23 C;  5AV6 A;  3NQU B;  4XUJ A;  4NE3 A;  5JRG C;  3MGQ A;  3MGR B;  3AZI B;  3AZM A;  3C1C A;  4X23 B;  3F6T A;  5B2J A;  3REI D;  5JRG B;  1ID3 D;  5B1L C;  3MNN C;  5GT3 D;  1HQ3 A; 
#chains in the Genus database with same CATH homology
 4G92 C;  5DNM B;  3REL C;  5B24 C;  5B1L B;  5BT1 D;  3LEL A;  4UUZ A;  3MNN B;  3AV1 C;  1T3U A;  4Z66 D;  5C3I C;  3AZL C;  4WU8 A;  3REL B;  3X1S C;  3B6G A;  3AV1 B;  3UTA A;  3X1U C;  3MGP A;  1P3O D;  3EG5 B;  3X1S B;  4HGA B;  3LZ1 A;  4NFT A;  5CPK D;  4J8V D;  2YFW A;  5B0Y A;  3X1U B;  4KHA B;  1WWS A;  1P3I D;  4Z5T A;  5GSU D;  1P3P A;  2Y2P A;  3VH5 T;  5KDM A;  4X23 D;  2Y2M A;  3UT9 C;  3AZG A;  3AZE D;  3LJA A;  1S32 A;  3W96 A;  1JFI B;  5AVC A;  2F8N H;  2PYO A;  5B1M A;  3UT9 B;  3KWQ D;  5F99 C;  4Z2M H;  1U35 C;  2BYM B;  3A6N C;  3MGQ B;  2UWX A;  4J8U C;  3W97 D;  1U35 B;  5B24 D;  3A6N B;  3REI A;  5B40 C;  1ID3 A;  4NE5 A;  4YS3 C;  2BYK A;  3AZL D;  5GT3 A;  3AN2 A;  3WTP C;  3O62 A;  3IP4 C;  5B31 C;  5B40 B;  4KUD C;  1P3B D;  3EPJ A;  3WTP B;  5B31 B;  3UTA C;  4KUD B;  2FJ7 A;  4E44 A;  3B0B A;  3FDD A;  5E5A C;  4WU8 B;  3B6G B;  4ZUX D;  2ARO C;  1P34 D;  1KX5 D;  1ZLA D;  2YFV A;  3UTA B;  1P3O A;  2NQB C;  5E5A B;  4G91 C;  4J8V A;  5B0Z D;  3X1V C;  2ARO B;  1KX5 B;  2YFW B;  4R8P D;  3WAA D;  4YM6 C;  3UTB D;  3WKJ D;  3KSY A;  2NQB B;  4G91 B;  5GSU A;  5DNN C;  3NQU A;  3MGR A;  4Z5T B;  5BS7 C;  3X1V B;  4H9P A;  5F99 D;  2DQN C;  4X23 A;  3A1I A;  3A1K A;  2Y2G A;  2RVQ C;  5JRG A;  4J8X C;  1S32 B;  2F8N G;  1N1J A;  4J8U D;  4M6B A;  4Z2M G;  5B32 G;  4J8X B;  5B1L A;  4ZBJ C;  4YS3 D;  3MNN A;  4H9R B;  1P3L C;  1EQZ C;  3REL A;  5B24 A;  4KGC D;  4EO5 B;  4ZBJ B;  3B0C W;  1P3L B;  3AZL A;  3X1S A;  5BT1 C;  1TZY D;  4Z66 C;  1P3F D;  3X1U A;  1Z2C B;  4KHA A;  2NQB D;  3H0L C;  3WA9 D;  2JCH A;  4Z66 B;  3REH C;  1M19 D;  3W98 C;  1BH8 A;  5B2I D;  4YM6 D;  5CPK C;  5DNN D;  3KUY D;  3W98 B;  1JFI A;  1P3O B;  3B0D C;  3UT9 A;  1P3I C;  2Y2K A;  5CPK B;  3EPL A;  3UTB A;  2RVQ D;  4H9Q A;  3REK D;  3AFA C;  1P3I B;  1BFM A;  5GSU B;  3AZE C;  5GXQ D;  5F99 A;  1P3M D;  1U35 A;  4H9P B;  4LD9 D;  3A6N A;  5CP6 D;  3AFA B;  3KWQ C;  3AZE B;  1P3L D;  1EQZ D;  4H9N B;  5JA4 B;  4J8U A;  4WV4 B;  5B33 C;  1N1J B;  3C1B C;  3KWQ B;  5B40 A;  2VQR A;  3VH6 A;  3W97 C;  4YS3 A;  5B33 B;  4H9O B;  3WTP A;  3TU4 D;  3C1B B;  5B31 A;  4KUD A;  1R4V A;  4G92 B;  3W97 B;  2IO5 C;  4QLC D;  5B24 B;  4XZQ C;  3REH D;  5C3I B;  1P3B C;  2F8N K;  3W98 D;  5E5A A;  3AZL B;  2IO5 B;  1P3A D;  1P3F A;  2ARO A;  3AZF D;  1P3K D;  4XZQ B;  2J8P A;  1P3B B;  2NQB A;  3AZJ C;  4ZUX C;  1P34 C;  4CSR B;  3X1V A;  5AVB D;  2HUE C;  4E45 A;  1KX5 C;  1ZLA C;  4YM6 A;  1BH8 B;  4CAY B;  3H0R C;  1F66 C;  5B0Z C;  4ZUX B;  5DNN A;  3AFA D;  3KUY A;  1P34 B;  4R8P C;  3WAA C;  3VH5 W;  5BS7 A;  3UTB C;  5AV8 C;  1KX4 C;  1F1E A;  3AV2 C;  3WKJ C;  5B0Z B;  2CV5 C;  2Y2H A;  4R8P B;  1AOI D;  3WAA B;  4J8X A;  3X1T D;  3UTB B;  3WKJ B;  3AV2 B;  3B6F C;  2HIO C;  5B33 D;  4H9Q B;  3AYW D;  1M18 D;  4H9R A;  3W99 C;  3C1B D;  4DRA A;  5F99 B;  3LZ0 D;  3B6F B;  2ZY3 A;  4WNN B;  1P3L A;  1EQZ A;  3EPH A;  3VH5 A;  4J8U B;  3MVD D;  2Y2N A;  4XZQ D;  3NQJ B;  4KGC C;  2JE5 A;  4J8W D;  4YS3 B;  1Q9C A;  4Z66 A;  1P3G D;  4QLC A;  4KGC B;  1TZY C;  4AWL C;  3AZJ D;  1P3F C;  3REH A;  2XD1 A;  3W98 A;  3KXB D;  3WA9 C;  1TZY B;  4AWL B;  3AZF A;  5CPK A;  1P3K A;  1P3F B;  1M19 C;  1F66 D;  1ZLA B;  1KX4 D;  5B2I C;  5AV8 D;  3AV2 D;  3WA9 B;  1P3I A;  5CHL B;  3KUY C;  2CV5 D;  1M19 B;  2NZD D;  5B2I B;  5G49 B;  4YM6 B;  3B6F D;  2HIO D;  2LY8 A;  1TAF B;  5CPI C;  3AFA A;  1H3O B;  2G5I C;  3AZE A;  1HTA A;  3W99 D;  5DNN B;  4H9N A;  3KUY B;  2Y2L A;  1WWI A;  5JA4 A;  3MGS C;  1KX3 D;  3KFU G;  3REK C;  3KWQ A;  5GXQ C;  1M1A C;  1P3M C;  3AZH D;  3MGS B;  5B33 A;  4H9O A;  4LD9 C;  3REK B;  5CP6 C;  3C1B A;  5GXQ B;  3LZ0 A;  1M1A B;  5CPJ D;  3W97 A;  1P3M B;  3AL0 C;  2DF4 C;  4LD9 B;  5CP6 B;  4JJN C;  1EQZ B;  3R45 B;  4XUJ D;  3TU4 C;  3C1C D;  4XZQ A;  3P5J B;  1P3B A;  4QLC C;  2L5A A;  2Y2J A;  4CSR A;  3TU4 B;  3REJ C;  4CAY A;  3AZJ A;  1P3A C;  4QLC B;  4ZUX A;  5BNX B;  3AZK C;  3AZF C;  1P34 A;  3AZN C;  1P3K C;  1KX5 A;  3LEL D;  3REH B;  1ZLA A;  3REJ B;  1F66 A;  5B0Z A;  1P3A B;  5AVB C;  1KX4 A;  3AZF B;  5CPI D;  4R8P A;  1P3K B;  3WAA A;  4WU9 C;  3WKJ A;  5AV8 A;  2Y2O A;  3AV2 A;  3MGS D;  3B0D B;  2CV5 A;  5AV5 C;  2NZD A;  5BNV B;  5AVB B;  3LZ1 D;  4WU9 B;  1M1A D;  5B0Y D;  3B6F A;  2HIO A;  3H0M C;  4WNN A;  3W99 A;  1AOI C;  4WZS B;  3X1T C;  2BG1 A;  1P3P D;  3AYW C;  4H9S C;  1M18 C;  1AOI B;  4JJN D;  3LZ0 C;  3NQJ A;  4DRB A;  3AZG D;  3X1T B;  3VH6 T;  3AYW B;  5B31 G;  1M18 B;  3W96 D;  2PYO D;  5B1M D;  5AV9 C;  3LZ0 B;  3AZI C;  4KGC A;  4DQY B;  3MVD C;  4UPK A;  5AV9 B;  3REJ D;  4J8W C;  1TZY A;  3MVD B;  2RIQ A;  1P3G C;  3AZK D;  3AZN D;  5DNM C;  4J8W B;  3WA9 A;  5B32 C;  2ZM5 A;  1M19 A;  3AN2 D;  1P3G B;  2F8N B;  5B2I A;  3O62 D;  5G49 A;  4WU9 D;  3KXB C;  2JSS A;  2W8S A;  1TAF A;  5B32 B;  3AZJ B;  1H3O A;  5AV5 D;  2HUE B;  5AY8 C;  3KXB B;  2FJ7 D;  3WTP E;  2ZY5 A;  4HGA C;  5CPI A;  1F66 B;  2NZD C;  1KX4 B;  2F2A C;  5AY8 B;  5FUG B;  3MGS A;  5AV8 B;  3EPK A;  3REK A;  5GT0 C;  2CV5 B;  2NZD B;  5GXQ A;  1M1A A;  1P3M A;  1KU5 A;  1KX3 C;  2G5H C;  2Y2I A;  4LD9 A;  2HIO B;  5CP6 A;  5GT0 B;  3W99 B;  3AZH C;  3R45 A;  3MGR D;  1KX3 B;  1A7W A;  5AV9 D;  3AZI D;  2FFF B;  4WJ3 C;  4JJN A;  5CPJ C;  3AZH B;  1ULY A;  5JRG D;  1W2E A;  1BH9 A;  3TU4 A;  2F8N D;  5AV6 C;  5CPJ B;  4XUJ C;  3MGQ C;  3AZM C;  5DNM D;  5BNX A;  3C1C C;  5B1L D;  5B32 D;  5B2J C;  3MNN D;  1B67 A;  3REJ A;  5AV6 B;  4XUJ B;  3AZM B;  1P3A A;  3REL D;  3C1C B;  3AZK A;  3AZN A;  3V9R A;  1HQ3 C;  5B2J B;  3AV1 D;  5AY8 D;  4NE6 A;  5BNV A;  5AVB A;  3X1S D;  3LEL C;  4WU9 A;  1HQ3 B;  5BO0 A;  3X1U D;  4WU8 C;  3B6G C;  1B6W A;  5AV5 A;  2ZY2 A;  5GT0 D;  3LEL B;  4UUZ B;  2XD5 A;  3MGP C;  5CPI B;  3LZ1 C;  1AOI A;  3X1T A;  5B0Y C;  3AYW A;  4H9S A;  3MGP B;  1M18 A;  3UT9 D;  3LZ1 B;  4Z5T C;  1P3P C;  5B0Y B;  3AZG C;  1P3P B;  5AV9 A;  3LJA C;  3AZI A;  5AV6 D;  1S32 C;  3W96 C;  3MGQ D;  3AZM D;  3MVD A;  5AVC C;  1U35 D;  2PYO C;  5KDM B;  5B1M C;  3A6N D;  4JJN B;  5B2J D;  3AZG B;  3LJA B;  4J8W A;  3W96 B;  5AVC B;  1BH9 B;  1P3G A;  2F8N A;  5B1M B;  2PYO B;  1HQ3 D;  5DNM A;  5B40 D;  2Y2Q A;  5B32 A;  4EO5 C;  3WTP D;  3REI C;  5B31 D;  1ID3 C;  3KXB A;  2ZY4 A;  4KUD D;  3B0C T;  5GT3 C;  3AN2 C;  3AZK B;  3AV1 A;  4WU8 D;  3O62 C;  3AZN B;  3B6G D;  5AY8 A;  5FUG A;  3V9R B;  3REI B;  3UTA D;  1ID3 B;  5E5A D;  2BYK B;  3MGP D;  5GT3 B;  3AN2 B;  3O62 B;  2ARO D;  2FJ7 C;  5BO0 B;  5GT0 A;  5AV5 B;  3X1V D;  4Z5T D;  1KX3 A;  1P3O C;  2CWE A;  2FJ7 B;  4J8V C;  3AZH A;  1PZR A;  2YFV B;  3LJA D;  1S32 D;  5AVC D;  5GSU C;  3VH6 W;  4J8V B;  5CPJ A;  3MGR C;  4J8X D;  2BYM A;  4X23 C;  5AV6 A;  3NQU B;  4XUJ A;  4NE3 A;  5JRG C;  3MGQ A;  3MGR B;  3AZI B;  3AZM A;  3C1C A;  4X23 B;  3F6T A;  5B2J A;  3REI D;  5JRG B;  1ID3 D;  5B1L C;  3MNN C;  5GT3 D;  1HQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...