5DNMB

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmB00
5AV9C 3V9RA 5CP6B 4YM6D 1EQZA 5B40C 4G92C 1F66D 4DRBA 3B0BA 3NQUA 1HTAA 3MNNC 3MGSA 5CPIB 2NQBC 5AY8D 3A6ND 1TZYC 4AWLB 3RELA 4J8XB 5DNND 3X1VB 3MGPB 3AZLA 3X1SA 3AZHB 4WU9C 3WAAA 5CPJA 1KX3D 4G91C 1ZLAC 5AV8C 1N1JB 4WU8B 2NZDA 5B2IA 5B1MB 3WTPA 5B31A 3REHC 4KGCB 1S32D 4H9RB 3AV2A 3MVDA 1M19A 1P3LA 5DNMB 2FJ7C 1KX5C 3LZ1A 4ZUXA 3B6GD 3R45B 1U35D 5C3IB 3AZMC 5GT0A 5JRGD 4G92B 3C1CC 4UUZB 4LD9D 4J8UD 5CPKD 1KX4D 1TZYB 3LZ0A 3LJAA 4J8VD 4LD9B 4J8UB 1KX4B 3B6FC 1BH8A 2CV5B 1P3OB 4WU9B 1P3KC 3KXBA 3REHB 5BS7C 4R8PA 1P3MB 5F99C 5B0ZD 3KUYA 5BNXB 4XUJA 2FJ7B 4X23D 2RVQD 1ID3C 5B24C 3X1UC 1F1EA 2PYOD 1P3AD 5AVCC 3AZMB 5JA4A 3C1CB 4Z2MG 3AZGC 4CSRB 5B33D 2AROA 3AZNB 4NFTA 1M1AC 3WKJD 3AZKA 1P3PD 4WNNB 3W97A 3MGQA 3AZID 1P3KB 3WA9D 3W96B 4Z5TA 2HIOB 4JJNB 1HQ3A 3TU4D 3AN2C 3UT9A 3AZJC 5AV9A 5GSUA 5CHLB 3KWQC 3TU4B 3AV1D 1BFMA 5B40A 5B1LD 2YFWB 3REJD 3AV1B 3MGRB 5AVBD 3MNNA 1P3FC 2NQBA 3C1BA 4KHAA 2YFVA 3LELC 4QLCD 3AFAA 1P3GC 1JFIB 1EQZD 2F8NG 1P3IC 4QLCB 5KDMA 3B0DB 5CP6C 1M1AB 1ZLAA 5AV8A 1M18B 3RELD 3W99A 4YM6C 3AZLD 3X1SD 3NQJA 3WAAD 5CPJD 4AWLC 1AOID 5E5AA 2NZDD 3AYWB 5B2ID 4J8XC 5AY8C 3A6NC 3WTPD 1TAFA 5B31D 3AN2B 4YS3B 3MGPC 1AOIB 3AZJB 5DNNC 3AV2D 4EO5B 3MVDD 5BO0A 1P3BB 1M19D 1P3LD 4WU8C 3LZ1D 3REID 4ZUXD 1P34A 1P3FB 2BYKA 3REIB 3LELB 1P3GB 5GT0D 5AV5A 4XZQB 5B32A 3B6FA 4H9OB 4J8WA 3REKD 3LZ0D 3LJAD 5C3IC 3B6GC 3REKB 1U35C 4YM6B 5BS7A 3LJAB 5JRGC 5F99A 3WTPE 3UTBA 1F66B 4H9QB 4NE6A 4LD9C 4J8UC 5AY8B 2LY8A 3A6NB 5CPKC 1KX4C 1ID3A 5B24A 3X1UA 4R8PD 5DNNB 2BYMB 2CV5C 1P3OC 5B31G 5AVCA 3KUYD 3X1TD 4XUJD 5FUGA 1KX3B 3X1TB 3AZGA 1P3MC 5AV6A 5G49B 5B0ZC 1S32B 5GT3D 3KSYA 4X23C 2AROD 5GT3B 3B6GB 4KUDA 1U35B 3UTAA 5JRGB 3AZKD 4Z66A 5B2JD 3W97D 5CPKB 5BT1C 3AZNC 5B2JB 3KWQA 5B33C 4Z5TD 4J8VB 1HQ3D 1H3OB 3UT9D 3WKJC 4H9NA 5AV9D 1P3PC 5GSUD 3W98A 3W96C 1B6WA 3AZIC 2HIOC 3AZFA 1BH9A 4WV4B 4JJNC 3AZEA 1P3IA 3MNND 2NQBD 5B0ZB 3C1BD 5CP6A 3TU4C 3AFAD 1ULYA 4WZSB 4X23B 3AV1C 3AFAB 1R4VA 3MGRC 5CPIA 5B1LC 3REJC 2PYOB 3W99D 1P3AB 2F8ND 4J8XA 3X1VA 2F8NB 3MGPA 4QLCC 1EQZC 3B0DC 3AZHA 5B33B 5E5AD 1N1JA 2IO5C 4WU8A 1M18C 5B1MA 4CAYB 5B0YD 3RELC 5B0YB 3WKJB 1P3PB 4KGCA 4H9RA 4H9PB 3AZIB 3AZLC 5DNMA 3AYWC 5GXQD 3WA9B 3WAAC 4YS3C 1AOIC 1Q9CA 1P34D 2NZDC 5B2IC 5GXQB 3R45A 5B31C 4EO5C 1P3BC 5B32D 5AV5D 2F8NK 3B6FD 4UUZA 3AV2C 3O62D 3MVDC 1M19C 5B1LB 4J8WD 3LZ1C 3O62B 1TZYA 3REIC 3REJB 5AVBB 4ZUXC 4LD9A 4J8UA 4XZQC 1KX4A 3V9RB 1EQZB 5GT0C 3MGSD 2CV5A 1WWSA 5F99D 3UTBD 1P3OA 4M6BA 4WU9A 3NQUB 2IO5B 3MGSB 4NE5A 3REKC 3LZ0C 5B24D 3LJAC 3REHA 3RELB 1P3MA 1F66C 5AVCD 5BNXA 3AZLB 3X1SB 2FJ7A 1KX5A 3WAAB 5CPJB 2NZDB 5B2IB 3AZGD 3WTPB 5AV6D 5B31B 3VH6A 3AZMA 4R8PC 4H9SC 3C1CA 3VH6T 3AV2B 3MVDB 1KX3C 5BNVA 3X1TC 1M19B 1P3LB 5B32G 3LZ1B 4CSRA 4ZUXB 4KUDD 3AZNA 1S32C 3UTAD 5GT0B 4KUDB 4Z66D 4WNNA 5GT3C 1P3KA 3W96A 3LZ0B 2HIOA 4JJNA 1BH8B 3AZKC 3W98D 5B2JC 3TU4A 3KXBD 4J8VC 3AZFD 2YFWA 3AZED 1P3ID 3KXBB 3AV1A 3MGRA 4R8PB 1KU5A 5CP6D 3KUYB 4XUJB 3UT9C 1JFIA 4HGAB 5GSUC 4QLCA 5CPID 1M1AA 1M18A 4J8XD 5JA4B 3X1VD 3C1BC 3MGPD 1B67A 2RVQC 3AFAC 3AZHD 2AROB 2L5AA 2PYOC 1P3AC 4WU8D 3AYWA 5B1MD 3AN2A 3W99C 4YS3A 1AOIA 3MGQD 3AZJA 4KGCD 3AZKB 4Z2MH 3W97B 1P3BA 3MGQB 5DNMD 4NE3A 4ZBJC 4Z5TB 5E5AC 1P3FA 5B0YC 1HQ3B 3REIA 3LELA 1P3GA 3UT9B 5B40D 4XZQA 5AV9B 5GSUB 3WA9C 4H9OA 5B40B 5GXQC 1TZYD 4DRAA 3MNNB 1P34C 2NQBB 3C1BB 4KHAB 3REKA 2YFVB 3VH5W 4YM6A 2CV5D 5B32C 5AV5C 1P3OD 4E45A 4WU9D 1F66A 3O62C 1ZLAD 4H9QA 5AVBC 5KDMB 5AV8D 5AY8A 3A6NA 4J8WC 4G91B 1ZLAB 2CWEA 5AV8B 3REHD 3W99B 5DNNA 2BYMA 1P3MD 3MGSC 4H9SA 3UTBC 2FJ7D 3NQJB 1KX5D 2F8NH 4ZBJB 2HUEC 3X1TA 5E5AB 1KX3A 1KX5B 1TAFB 3AZMD 5G49A 3X1SC 3C1CD 1S32A 5CPJC 5BO0B 3VH6W 3WTPC 5BNVB 5GT3A 1P34B 2BYKB 5BT1D 3B6GA 3AZND 5AV6C 1U35A 3B0CW 5B32B 5AV5B 3VH5A 5JRGA 1P3LC 3B6FB 3VH5T 1P3KD 4J8WB 5CPKA 3W96D 5B2JA 4J8VA 2HIOD 4JJND 4KUDC 1H3OA 3UTAC 3UTBB 5F99B 4Z66C 2HUEB 1ID3D 3X1UD 3MGRD 1ID3B 5B24B 3X1UB 5B0ZA 5AVCB 4X23A 5FUGB 3W98C 3KXBC 3AZFC 3AZGB 5AV6B 3AZEC 1M1AD 2PYOA 1P3AA 3KUYC 1M18D 4XUJC 4HGAC 2F8NA 3B0CT 2JSSA 5B33A 5CPIC 3AYWD 4CAYA 4YS3D 3AN2D 3UTAB 3AZJD 5B0YA 3X1VC 1P3PA 3WKJA 4Z66B 3KWQD 4E44A 4H9PA 2AROC 1P3BD 3AZIA 3AZHC 3WA9A 3KWQB 1WWIA 1P3FD 1A7WA 5B1MC 5GXQA 3LELD 1P3GD 3W97C 3MGQC 4H9NB 4XZQD 4KGCC 3W98B 4Z5TC 3AZFB 1BH9B 5DNMC 5B1LA 3AZEB 1HQ3C 3O62A 3REJA 1P3IB 5AVBA
chains in the Genus database with same CATH superfamily
5AV9C 3V9RA 5CP6B 4YM6D 1EQZA 5B40C 4G92C 1F66D 4DRBA 3B0BA 3NQUA 1HTAA 3MNNC 3MGSA 5CPIB 2NQBC 5AY8D 3A6ND 1TZYC 4AWLB 3RELA 4J8XB 5DNND 3X1VB 2Y2QA 3MGPB 3AZLA 3X1SA 3AZHB 4WU9C 3WAAA 5CPJA 1KX3D 4G91C 1ZLAC 5AV8C 1N1JB 4WU8B 2NZDA 5B2IA 5B1MB 3WTPA 5B31A 3REHC 4KGCB 1S32D 4H9RB 2DF4C 3AV2A 3MVDA 1M19A 1P3LA 5DNMB 2FJ7C 1KX5C 3LZ1A 4ZUXA 3B6GD 3R45B 1U35D 5C3IB 3AZMC 5GT0A 5JRGD 4G92B 3C1CC 4UUZB 4LD9D 4J8UD 5CPKD 1KX4D 1TZYB 4UPKA 3LZ0A 3LJAA 4J8VD 4LD9B 4J8UB 1KX4B 3B6FC 1BH8A 2CV5B 1P3OB 4WU9B 1P3KC 3KXBA 3REHB 5BS7C 4R8PA 1P3MB 5F99C 5B0ZD 3KUYA 2XD5A 4XUJA 5BNXB 2FJ7B 4X23D 2RVQD 1ID3C 5B24C 3X1UC 4WJ3C 1F1EA 2PYOD 1P3AD 5AVCC 3AZMB 5JA4A 3C1CB 2ZY5A 4Z2MG 3AZGC 4CSRB 5B33D 2AROA 3AZNB 4NFTA 1M1AC 3WKJD 3AZKA 1P3PD 4WNNB 3P5JB 3W97A 3MGQA 3AZID 1P3KB 3WA9D 3W96B 4Z5TA 2RIQA 2HIOB 4JJNB 1HQ3A 3TU4D 3AN2C 3UT9A 3AZJC 5AV9A 5GSUA 5CHLB 3KWQC 3TU4B 3AV1D 3EG5B 1BFMA 5B40A 5B1LD 2YFWB 3REJD 3AV1B 3MGRB 5AVBD 3MNNA 1P3FC 2NQBA 3C1BA 4KHAA 2YFVA 3LELC 4QLCD 3AFAA 1P3GC 1JFIB 1EQZD 2F8NG 1P3IC 4QLCB 5KDMA 3B0DB 5CP6C 1M1AB 1ZLAA 5AV8A 1M18B 3RELD 3W99A 4YM6C 3AZLD 3X1SD 3NQJA 3WAAD 5CPJD 4AWLC 1AOID 5E5AA 2NZDD 3AYWB 5B2ID 4J8XC 5AY8C 3A6NC 3WTPD 1TAFA 5B31D 3AN2B 4YS3B 3MGPC 1AOIB 3AZJB 3A1KA 5DNNC 3EPLA 3AV2D 4EO5B 3MVDD 5BO0A 1P3BB 1M19D 1P3LD 4WU8C 3LZ1D 3REID 4ZUXD 1P34A 1P3FB 2BYKA 3REIB 3LELB 1P3GB 5GT0D 5AV5A 4XZQB 5B32A 3B6FA 4H9OB 4J8WA 3REKD 2Y2PA 3LZ0D 3LJAD 5C3IC 3B6GC 3REKB 1U35C 2G5IC 4YM6B 5BS7A 3LJAB 5JRGC 5F99A 3WTPE 3UTBA 1F66B 1T3UA 4H9QB 4NE6A 4LD9C 4J8UC 5AY8B 2LY8A 3A6NB 5CPKC 1KX4C 1ID3A 5B24A 3X1UA 4R8PD 5DNNB 2BYMB 2CV5C 1P3OC 5B31G 5AVCA 3KUYD 3X1TD 4XUJD 2Y2GA 5FUGA 1KX3B 3X1TB 2F2AC 3AZGA 1P3MC 5AV6A 5G49B 5B0ZC 1S32B 5GT3D 3KSYA 4X23C 2Y2MA 2AROD 3EPKA 5GT3B 2JCHA 3B6GB 4KUDA 1U35B 3UTAA 5JRGB 3AZKD 4Z66A 5B2JD 3W97D 5CPKB 2G5HC 5BT1C 3AZNC 5B2JB 3KWQA 5B33C 4Z5TD 4J8VB 1HQ3D 1H3OB 3UT9D 3WKJC 4H9NA 5AV9D 2Y2OA 5GSUD 1P3PC 3W96C 3W98A 1B6WA 3AZIC 2HIOC 3AZFA 1BH9A 4WV4B 4JJNC 3AZEA 1P3IA 3MNND 2NQBD 5B0ZB 3C1BD 5CP6A 3TU4C 3AFAD 1ULYA 4WZSB 4X23B 3AV1C 3AFAB 1R4VA 3MGRC 5CPIA 5B1LC 3REJC 2PYOB 3W99D 1P3AB 2F8ND 4J8XA 3X1VA 2F8NB 3MGPA 4QLCC 1EQZC 3B0DC 2BG1A 3AZHA 5B33B 5E5AD 1N1JA 2IO5C 4WU8A 1M18C 5B1MA 4CAYB 5B0YD 2ZY4A 3RELC 5B0YB 3WKJB 1P3PB 4KGCA 2FFFB 2ZY2A 4H9RA 4H9PB 3A1IA 3AZIB 3AZLC 5DNMA 3AYWC 3FDDA 5GXQD 3WA9B 3WAAC 4YS3C 1AOIC 1Q9CA 1P34D 2NZDC 5B2IC 5GXQB 2Y2KA 3R45A 5B31C 4EO5C 1P3BC 5B32D 5AV5D 2F8NK 3B6FD 4UUZA 3AV2C 3O62D 3MVDC 1M19C 5B1LB 4J8WD 3LZ1C 3O62B 1TZYA 3REIC 3REJB 5AVBB 4ZUXC 4LD9A 4J8UA 4XZQC 1KX4A 3V9RB 1EQZB 5GT0C 3MGSD 2CV5A 1WWSA 5F99D 3UTBD 1P3OA 4M6BA 4WU9A 2J8PA 3NQUB 2IO5B 3MGSB 4NE5A 2ZY3A 3REKC 2Y2NA 3LZ0C 5B24D 3LJAC 3REHA 3RELB 1P3MA 2Y2HA 1F66C 5AVCD 3H0LC 5BNXA 3AZLB 3X1SB 2FJ7A 1KX5A 3WAAB 5CPJB 2NZDB 5B2IB 3AZGD 3WTPB 5AV6D 2Y2JA 5B31B 3VH6A 3AZMA 4R8PC 4H9SC 3C1CA 3VH6T 3AV2B 3MVDB 1KX3C 5BNVA 3X1TC 1M19B 1P3LB 5B32G 3LZ1B 4CSRA 4ZUXB 4KUDD 3AZNA 1S32C 3UTAD 5GT0B 4KUDB 4Z66D 4WNNA 3IP4C 5GT3C 1P3KA 2XD1A 3W96A 1Z2CB 3LZ0B 2DQNC 2HIOA 4JJNA 1BH8B 2Y2IA 3AZKC 3W98D 3EPHA 5B2JC 3TU4A 3KXBD 4J8VC 3AZFD 2YFWA 3AZED 1P3ID 3KXBB 3AV1A 3MGRA 4R8PB 1KU5A 5CP6D 3KUYB 4XUJB 3UT9C 1JFIA 4HGAB 5GSUC 1PZRA 4QLCA 5CPID 1M1AA 1M18A 4J8XD 5JA4B 3X1VD 3C1BC 1W2EA 3MGPD 1B67A 2RVQC 3AFAC 3AZHD 3H0MC 2AROB 2L5AA 2PYOC 1P3AC 4WU8D 3AYWA 5B1MD 3AN2A 3W99C 4YS3A 1AOIA 3MGQD 3AZJA 4KGCD 3AZKB 4Z2MH 3W97B 1P3BA 3MGQB 5DNMD 4NE3A 4ZBJC 4Z5TB 5E5AC 1P3FA 5B0YC 1HQ3B 3REIA 3LELA 1P3GA 3UT9B 5B40D 4XZQA 5AV9B 5GSUB 3WA9C 3EPJA 4H9OA 5B40B 5GXQC 2UWXA 1TZYD 4DRAA 3MNNB 1P34C 2NQBB 3C1BB 4KHAB 3REKA 2YFVB 3VH5W 4YM6A 4DQYB 2CV5D 5B32C 5AV5C 1P3OD 4E45A 4WU9D 1F66A 3O62C 1ZLAD 4H9QA 5AVBC 5KDMB 5AV8D 5AY8A 3A6NA 4J8WC 4G91B 1ZLAB 2CWEA 5AV8B 3REHD 3W99B 5DNNA 2BYMA 1P3MD 3MGSC 4H9SA 2ZM5A 3UTBC 2FJ7D 3NQJB 1KX5D 2F8NH 4ZBJB 2HUEC 3X1TA 5E5AB 1KX3A 3KFUG 1KX5B 1TAFB 3AZMD 5G49A 3X1SC 3C1CD 1S32A 5CPJC 5BO0B 3VH6W 3WTPC 5BNVB 5GT3A 1P34B 2BYKB 5BT1D 3B6GA 3AZND 5AV6C 1U35A 3B0CW 5B32B 5AV5B 3VH5A 5JRGA 1P3LC 3B6FB 3VH5T 1P3KD 4J8WB 2JE5A 5CPKA 3W96D 5B2JA 4J8VA 2HIOD 4JJND 4KUDC 1H3OA 3UTAC 3UTBB 5F99B 4Z66C 2HUEB 1ID3D 3X1UD 3H0RC 3MGRD 2VQRA 1ID3B 5B24B 3X1UB 5B0ZA 3F6TA 5AVCB 4X23A 5FUGB 3W98C 3KXBC 3AZFC 3AZGB 5AV6B 3AZEC 1M1AD 2PYOA 1P3AA 3KUYC 1M18D 4XUJC 4HGAC 2F8NA 3B0CT 2JSSA 5B33A 2Y2LA 5CPIC 3AYWD 4CAYA 2W8SA 4YS3D 3AN2D 3UTAB 3AZJD 5B0YA 3X1VC 1P3PA 3WKJA 4Z66B 3KWQD 4E44A 4H9PA 2AROC 1P3BD 3AZIA 3AZHC 3WA9A 3KWQB 1WWIA 1P3FD 1A7WA 5B1MC 5GXQA 3LELD 1P3GD 3W97C 3MGQC 4H9NB 4XZQD 4KGCC 3W98B 4Z5TC 3AZFB 1BH9B 5DNMC 5B1LA 3AZEB 1HQ3C 3O62A 3REJA 1P3IB 5AVBA 3AL0C
chains in the Genus database with same CATH topology
5AV9C 3V9RA 5CP6B 4YM6D 1EQZA 5B40C 4G92C 1F66D 4DRBA 3B0BA 3NQUA 1HTAA 3MNNC 3MGSA 5CPIB 2NQBC 5AY8D 3A6ND 1TZYC 4AWLB 3RELA 4J8XB 5DNND 3X1VB 2Y2QA 3MGPB 3AZLA 3X1SA 3AZHB 4WU9C 3WAAA 5CPJA 1KX3D 4G91C 1ZLAC 5AV8C 1N1JB 4WU8B 2NZDA 5B2IA 5B1MB 3WTPA 5B31A 3REHC 4KGCB 1S32D 4H9RB 2DF4C 3AV2A 3MVDA 1M19A 1P3LA 5DNMB 2FJ7C 1KX5C 3LZ1A 4ZUXA 3B6GD 3R45B 1U35D 5C3IB 3AZMC 5GT0A 5JRGD 4G92B 3C1CC 4UUZB 4LD9D 4J8UD 5CPKD 1KX4D 1TZYB 4UPKA 3LZ0A 3LJAA 4J8VD 4LD9B 4J8UB 1KX4B 3B6FC 1BH8A 2CV5B 1P3OB 4WU9B 1P3KC 3KXBA 3REHB 5BS7C 4R8PA 1P3MB 5F99C 5B0ZD 3KUYA 2XD5A 4XUJA 5BNXB 2FJ7B 4X23D 2RVQD 1ID3C 5B24C 3X1UC 4WJ3C 1F1EA 2PYOD 1P3AD 5AVCC 3AZMB 5JA4A 3C1CB 2ZY5A 4Z2MG 3AZGC 4CSRB 5B33D 2AROA 3AZNB 4NFTA 1M1AC 3WKJD 3AZKA 1P3PD 4WNNB 3P5JB 3W97A 3MGQA 3AZID 1P3KB 3WA9D 3W96B 4Z5TA 2RIQA 2HIOB 4JJNB 1HQ3A 3TU4D 3AN2C 3UT9A 3AZJC 5AV9A 5GSUA 5CHLB 3KWQC 3TU4B 3AV1D 3EG5B 1BFMA 5B40A 5B1LD 2YFWB 3REJD 3AV1B 3MGRB 5AVBD 3MNNA 1P3FC 2NQBA 3C1BA 4KHAA 2YFVA 3LELC 4QLCD 3AFAA 1P3GC 1JFIB 1EQZD 2F8NG 1P3IC 4QLCB 5KDMA 3B0DB 5CP6C 1M1AB 1ZLAA 5AV8A 1M18B 3RELD 3W99A 4YM6C 3AZLD 3X1SD 3NQJA 3WAAD 5CPJD 4AWLC 1AOID 5E5AA 2NZDD 3AYWB 5B2ID 4J8XC 5AY8C 3A6NC 3WTPD 1TAFA 5B31D 3AN2B 4YS3B 3MGPC 1AOIB 3AZJB 3A1KA 5DNNC 3EPLA 3AV2D 4EO5B 3MVDD 5BO0A 1P3BB 1M19D 1P3LD 4WU8C 3LZ1D 3REID 4ZUXD 1P34A 1P3FB 2BYKA 3REIB 3LELB 1P3GB 5GT0D 5AV5A 4XZQB 5B32A 3B6FA 4H9OB 4J8WA 3REKD 2Y2PA 3LZ0D 3LJAD 5C3IC 3B6GC 3REKB 1U35C 2G5IC 4YM6B 5BS7A 3LJAB 5JRGC 5F99A 3WTPE 3UTBA 1F66B 1T3UA 4H9QB 4NE6A 4LD9C 4J8UC 5AY8B 2LY8A 3A6NB 5CPKC 1KX4C 1ID3A 5B24A 3X1UA 4R8PD 5DNNB 2BYMB 2CV5C 1P3OC 5B31G 5AVCA 3KUYD 3X1TD 4XUJD 2Y2GA 5FUGA 1KX3B 3X1TB 2F2AC 3AZGA 1P3MC 5AV6A 5G49B 5B0ZC 1S32B 5GT3D 3KSYA 4X23C 2Y2MA 2AROD 3EPKA 5GT3B 2JCHA 3B6GB 4KUDA 1U35B 3UTAA 5JRGB 3AZKD 4Z66A 5B2JD 3W97D 5CPKB 2G5HC 5BT1C 3AZNC 5B2JB 3KWQA 5B33C 4Z5TD 4J8VB 1HQ3D 1H3OB 3UT9D 3WKJC 4H9NA 5AV9D 2Y2OA 5GSUD 1P3PC 3W96C 3W98A 1B6WA 3AZIC 2HIOC 3AZFA 1BH9A 4WV4B 4JJNC 3AZEA 1P3IA 3MNND 2NQBD 5B0ZB 3C1BD 5CP6A 3TU4C 3AFAD 1ULYA 4WZSB 4X23B 3AV1C 3AFAB 1R4VA 3MGRC 5CPIA 5B1LC 3REJC 2PYOB 3W99D 1P3AB 2F8ND 4J8XA 3X1VA 2F8NB 3MGPA 4QLCC 1EQZC 3B0DC 2BG1A 3AZHA 5B33B 5E5AD 1N1JA 2IO5C 4WU8A 1M18C 5B1MA 4CAYB 5B0YD 2ZY4A 3RELC 5B0YB 3WKJB 1P3PB 4KGCA 2FFFB 2ZY2A 4H9RA 4H9PB 3A1IA 3AZIB 3AZLC 5DNMA 3AYWC 3FDDA 5GXQD 3WA9B 3WAAC 4YS3C 1AOIC 1Q9CA 1P34D 2NZDC 5B2IC 5GXQB 2Y2KA 3R45A 5B31C 4EO5C 1P3BC 5B32D 5AV5D 2F8NK 3B6FD 4UUZA 3AV2C 3O62D 3MVDC 1M19C 5B1LB 4J8WD 3LZ1C 3O62B 1TZYA 3REIC 3REJB 5AVBB 4ZUXC 4LD9A 4J8UA 4XZQC 1KX4A 3V9RB 1EQZB 5GT0C 3MGSD 2CV5A 1WWSA 5F99D 3UTBD 1P3OA 4M6BA 4WU9A 2J8PA 3NQUB 2IO5B 3MGSB 4NE5A 2ZY3A 3REKC 2Y2NA 3LZ0C 5B24D 3LJAC 3REHA 3RELB 1P3MA 2Y2HA 1F66C 5AVCD 3H0LC 5BNXA 3AZLB 3X1SB 2FJ7A 1KX5A 3WAAB 5CPJB 2NZDB 5B2IB 3AZGD 3WTPB 5AV6D 2Y2JA 5B31B 3VH6A 3AZMA 4R8PC 4H9SC 3C1CA 3VH6T 3AV2B 3MVDB 1KX3C 5BNVA 3X1TC 1M19B 1P3LB 5B32G 3LZ1B 4CSRA 4ZUXB 4KUDD 3AZNA 1S32C 3UTAD 5GT0B 4KUDB 4Z66D 4WNNA 3IP4C 5GT3C 1P3KA 2XD1A 3W96A 1Z2CB 3LZ0B 2DQNC 2HIOA 4JJNA 1BH8B 2Y2IA 3AZKC 3W98D 3EPHA 5B2JC 3TU4A 3KXBD 4J8VC 3AZFD 2YFWA 3AZED 1P3ID 3KXBB 3AV1A 3MGRA 4R8PB 1KU5A 5CP6D 3KUYB 4XUJB 3UT9C 1JFIA 4HGAB 5GSUC 1PZRA 4QLCA 5CPID 1M1AA 1M18A 4J8XD 5JA4B 3X1VD 3C1BC 1W2EA 3MGPD 1B67A 2RVQC 3AFAC 3AZHD 3H0MC 2AROB 2L5AA 2PYOC 1P3AC 4WU8D 3AYWA 5B1MD 3AN2A 3W99C 4YS3A 1AOIA 3MGQD 3AZJA 4KGCD 3AZKB 4Z2MH 3W97B 1P3BA 3MGQB 5DNMD 4NE3A 4ZBJC 4Z5TB 5E5AC 1P3FA 5B0YC 1HQ3B 3REIA 3LELA 1P3GA 3UT9B 5B40D 4XZQA 5AV9B 5GSUB 3WA9C 3EPJA 4H9OA 5B40B 5GXQC 2UWXA 1TZYD 4DRAA 3MNNB 1P34C 2NQBB 3C1BB 4KHAB 3REKA 2YFVB 3VH5W 4YM6A 4DQYB 2CV5D 5B32C 5AV5C 1P3OD 4E45A 4WU9D 1F66A 3O62C 1ZLAD 4H9QA 5AVBC 5KDMB 5AV8D 5AY8A 3A6NA 4J8WC 4G91B 1ZLAB 2CWEA 5AV8B 3REHD 3W99B 5DNNA 2BYMA 1P3MD 3MGSC 4H9SA 2ZM5A 3UTBC 2FJ7D 3NQJB 1KX5D 2F8NH 4ZBJB 2HUEC 3X1TA 5E5AB 1KX3A 3KFUG 1KX5B 1TAFB 3AZMD 5G49A 3X1SC 3C1CD 1S32A 5CPJC 5BO0B 3VH6W 3WTPC 5BNVB 5GT3A 1P34B 2BYKB 5BT1D 3B6GA 3AZND 5AV6C 1U35A 3B0CW 5B32B 5AV5B 3VH5A 5JRGA 1P3LC 3B6FB 3VH5T 1P3KD 4J8WB 2JE5A 5CPKA 3W96D 5B2JA 4J8VA 2HIOD 4JJND 4KUDC 1H3OA 3UTAC 3UTBB 5F99B 4Z66C 2HUEB 1ID3D 3X1UD 3H0RC 3MGRD 2VQRA 1ID3B 5B24B 3X1UB 5B0ZA 3F6TA 5AVCB 4X23A 5FUGB 3W98C 3KXBC 3AZFC 3AZGB 5AV6B 3AZEC 1M1AD 2PYOA 1P3AA 3KUYC 1M18D 4XUJC 4HGAC 2F8NA 3B0CT 2JSSA 5B33A 2Y2LA 5CPIC 3AYWD 4CAYA 2W8SA 4YS3D 3AN2D 3UTAB 3AZJD 5B0YA 3X1VC 1P3PA 3WKJA 4Z66B 3KWQD 4E44A 4H9PA 2AROC 1P3BD 3AZIA 3AZHC 3WA9A 3KWQB 1WWIA 1P3FD 1A7WA 5B1MC 5GXQA 3LELD 1P3GD 3W97C 3MGQC 4H9NB 4XZQD 4KGCC 3W98B 4Z5TC 3AZFB 1BH9B 5DNMC 5B1LA 3AZEB 1HQ3C 3O62A 3REJA 1P3IB 5AVBA 3AL0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 C;  3V9R A;  5CP6 B;  4YM6 D;  1EQZ A;  5B40 C;  4G92 C;  1F66 D;  4DRB A;  3B0B A;  3NQU A;  1HTA A;  3MNN C;  3MGS A;  5CPI B;  2NQB C;  5AY8 D;  3A6N D;  1TZY C;  4AWL B;  3REL A;  4J8X B;  5DNN D;  3X1V B;  3MGP B;  3AZL A;  3X1S A;  3AZH B;  4WU9 C;  3WAA A;  5CPJ A;  1KX3 D;  4G91 C;  1ZLA C;  5AV8 C;  1N1J B;  4WU8 B;  2NZD A;  5B2I A;  5B1M B;  3WTP A;  5B31 A;  3REH C;  4KGC B;  1S32 D;  4H9R B;  3AV2 A;  3MVD A;  1M19 A;  1P3L A;  5DNM B;  2FJ7 C;  1KX5 C;  3LZ1 A;  4ZUX A;  3B6G D;  3R45 B;  1U35 D;  5C3I B;  3AZM C;  5GT0 A;  5JRG D;  4G92 B;  3C1C C;  4UUZ B;  4LD9 D;  4J8U D;  5CPK D;  1KX4 D;  1TZY B;  3LZ0 A;  3LJA A;  4J8V D;  4LD9 B;  4J8U B;  1KX4 B;  3B6F C;  1BH8 A;  2CV5 B;  1P3O B;  4WU9 B;  1P3K C;  3KXB A;  3REH B;  5BS7 C;  4R8P A;  1P3M B;  5F99 C;  5B0Z D;  3KUY A;  5BNX B;  4XUJ A;  2FJ7 B;  4X23 D;  2RVQ D;  1ID3 C;  5B24 C;  3X1U C;  1F1E A;  2PYO D;  1P3A D;  5AVC C;  3AZM B;  5JA4 A;  3C1C B;  4Z2M G;  3AZG C;  4CSR B;  5B33 D;  2ARO A;  3AZN B;  4NFT A;  1M1A C;  3WKJ D;  3AZK A;  1P3P D;  4WNN B;  3W97 A;  3MGQ A;  3AZI D;  1P3K B;  3WA9 D;  3W96 B;  4Z5T A;  2HIO B;  4JJN B;  1HQ3 A;  3TU4 D;  3AN2 C;  3UT9 A;  3AZJ C;  5AV9 A;  5GSU A;  5CHL B;  3KWQ C;  3TU4 B;  3AV1 D;  1BFM A;  5B40 A;  5B1L D;  2YFW B;  3REJ D;  3AV1 B;  3MGR B;  5AVB D;  3MNN A;  1P3F C;  2NQB A;  3C1B A;  4KHA A;  2YFV A;  3LEL C;  4QLC D;  3AFA A;  1P3G C;  1JFI B;  1EQZ D;  2F8N G;  1P3I C;  4QLC B;  5KDM A;  3B0D B;  5CP6 C;  1M1A B;  1ZLA A;  5AV8 A;  1M18 B;  3REL D;  3W99 A;  4YM6 C;  3AZL D;  3X1S D;  3NQJ A;  3WAA D;  5CPJ D;  4AWL C;  1AOI D;  5E5A A;  2NZD D;  3AYW B;  5B2I D;  4J8X C;  5AY8 C;  3A6N C;  3WTP D;  1TAF A;  5B31 D;  3AN2 B;  4YS3 B;  3MGP C;  1AOI B;  3AZJ B;  5DNN C;  3AV2 D;  4EO5 B;  3MVD D;  5BO0 A;  1P3B B;  1M19 D;  1P3L D;  4WU8 C;  3LZ1 D;  3REI D;  4ZUX D;  1P34 A;  1P3F B;  2BYK A;  3REI B;  3LEL B;  1P3G B;  5GT0 D;  5AV5 A;  4XZQ B;  5B32 A;  3B6F A;  4H9O B;  4J8W A;  3REK D;  3LZ0 D;  3LJA D;  5C3I C;  3B6G C;  3REK B;  1U35 C;  4YM6 B;  5BS7 A;  3LJA B;  5JRG C;  5F99 A;  3WTP E;  3UTB A;  1F66 B;  4H9Q B;  4NE6 A;  4LD9 C;  4J8U C;  5AY8 B;  2LY8 A;  3A6N B;  5CPK C;  1KX4 C;  1ID3 A;  5B24 A;  3X1U A;  4R8P D;  5DNN B;  2BYM B;  2CV5 C;  1P3O C;  5B31 G;  5AVC A;  3KUY D;  3X1T D;  4XUJ D;  5FUG A;  1KX3 B;  3X1T B;  3AZG A;  1P3M C;  5AV6 A;  5G49 B;  5B0Z C;  1S32 B;  5GT3 D;  3KSY A;  4X23 C;  2ARO D;  5GT3 B;  3B6G B;  4KUD A;  1U35 B;  3UTA A;  5JRG B;  3AZK D;  4Z66 A;  5B2J D;  3W97 D;  5CPK B;  5BT1 C;  3AZN C;  5B2J B;  3KWQ A;  5B33 C;  4Z5T D;  4J8V B;  1HQ3 D;  1H3O B;  3UT9 D;  3WKJ C;  4H9N A;  5AV9 D;  1P3P C;  5GSU D;  3W98 A;  3W96 C;  1B6W A;  3AZI C;  2HIO C;  3AZF A;  1BH9 A;  4WV4 B;  4JJN C;  3AZE A;  1P3I A;  3MNN D;  2NQB D;  5B0Z B;  3C1B D;  5CP6 A;  3TU4 C;  3AFA D;  1ULY A;  4WZS B;  4X23 B;  3AV1 C;  3AFA B;  1R4V A;  3MGR C;  5CPI A;  5B1L C;  3REJ C;  2PYO B;  3W99 D;  1P3A B;  2F8N D;  4J8X A;  3X1V A;  2F8N B;  3MGP A;  4QLC C;  1EQZ C;  3B0D C;  3AZH A;  5B33 B;  5E5A D;  1N1J A;  2IO5 C;  4WU8 A;  1M18 C;  5B1M A;  4CAY B;  5B0Y D;  3REL C;  5B0Y B;  3WKJ B;  1P3P B;  4KGC A;  4H9R A;  4H9P B;  3AZI B;  3AZL C;  5DNM A;  3AYW C;  5GXQ D;  3WA9 B;  3WAA C;  4YS3 C;  1AOI C;  1Q9C A;  1P34 D;  2NZD C;  5B2I C;  5GXQ B;  3R45 A;  5B31 C;  4EO5 C;  1P3B C;  5B32 D;  5AV5 D;  2F8N K;  3B6F D;  4UUZ A;  3AV2 C;  3O62 D;  3MVD C;  1M19 C;  5B1L B;  4J8W D;  3LZ1 C;  3O62 B;  1TZY A;  3REI C;  3REJ B;  5AVB B;  4ZUX C;  4LD9 A;  4J8U A;  4XZQ C;  1KX4 A;  3V9R B;  1EQZ B;  5GT0 C;  3MGS D;  2CV5 A;  1WWS A;  5F99 D;  3UTB D;  1P3O A;  4M6B A;  4WU9 A;  3NQU B;  2IO5 B;  3MGS B;  4NE5 A;  3REK C;  3LZ0 C;  5B24 D;  3LJA C;  3REH A;  3REL B;  1P3M A;  1F66 C;  5AVC D;  5BNX A;  3AZL B;  3X1S B;  2FJ7 A;  1KX5 A;  3WAA B;  5CPJ B;  2NZD B;  5B2I B;  3AZG D;  3WTP B;  5AV6 D;  5B31 B;  3VH6 A;  3AZM A;  4R8P C;  4H9S C;  3C1C A;  3VH6 T;  3AV2 B;  3MVD B;  1KX3 C;  5BNV A;  3X1T C;  1M19 B;  1P3L B;  5B32 G;  3LZ1 B;  4CSR A;  4ZUX B;  4KUD D;  3AZN A;  1S32 C;  3UTA D;  5GT0 B;  4KUD B;  4Z66 D;  4WNN A;  5GT3 C;  1P3K A;  3W96 A;  3LZ0 B;  2HIO A;  4JJN A;  1BH8 B;  3AZK C;  3W98 D;  5B2J C;  3TU4 A;  3KXB D;  4J8V C;  3AZF D;  2YFW A;  3AZE D;  1P3I D;  3KXB B;  3AV1 A;  3MGR A;  4R8P B;  1KU5 A;  5CP6 D;  3KUY B;  4XUJ B;  3UT9 C;  1JFI A;  4HGA B;  5GSU C;  4QLC A;  5CPI D;  1M1A A;  1M18 A;  4J8X D;  5JA4 B;  3X1V D;  3C1B C;  3MGP D;  1B67 A;  2RVQ C;  3AFA C;  3AZH D;  2ARO B;  2L5A A;  2PYO C;  1P3A C;  4WU8 D;  3AYW A;  5B1M D;  3AN2 A;  3W99 C;  4YS3 A;  1AOI A;  3MGQ D;  3AZJ A;  4KGC D;  3AZK B;  4Z2M H;  3W97 B;  1P3B A;  3MGQ B;  5DNM D;  4NE3 A;  4ZBJ C;  4Z5T B;  5E5A C;  1P3F A;  5B0Y C;  1HQ3 B;  3REI A;  3LEL A;  1P3G A;  3UT9 B;  5B40 D;  4XZQ A;  5AV9 B;  5GSU B;  3WA9 C;  4H9O A;  5B40 B;  5GXQ C;  1TZY D;  4DRA A;  3MNN B;  1P34 C;  2NQB B;  3C1B B;  4KHA B;  3REK A;  2YFV B;  3VH5 W;  4YM6 A;  2CV5 D;  5B32 C;  5AV5 C;  1P3O D;  4E45 A;  4WU9 D;  1F66 A;  3O62 C;  1ZLA D;  4H9Q A;  5AVB C;  5KDM B;  5AV8 D;  5AY8 A;  3A6N A;  4J8W C;  4G91 B;  1ZLA B;  2CWE A;  5AV8 B;  3REH D;  3W99 B;  5DNN A;  2BYM A;  1P3M D;  3MGS C;  4H9S A;  3UTB C;  2FJ7 D;  3NQJ B;  1KX5 D;  2F8N H;  4ZBJ B;  2HUE C;  3X1T A;  5E5A B;  1KX3 A;  1KX5 B;  1TAF B;  3AZM D;  5G49 A;  3X1S C;  3C1C D;  1S32 A;  5CPJ C;  5BO0 B;  3VH6 W;  3WTP C;  5BNV B;  5GT3 A;  1P34 B;  2BYK B;  5BT1 D;  3B6G A;  3AZN D;  5AV6 C;  1U35 A;  3B0C W;  5B32 B;  5AV5 B;  3VH5 A;  5JRG A;  1P3L C;  3B6F B;  3VH5 T;  1P3K D;  4J8W B;  5CPK A;  3W96 D;  5B2J A;  4J8V A;  2HIO D;  4JJN D;  4KUD C;  1H3O A;  3UTA C;  3UTB B;  5F99 B;  4Z66 C;  2HUE B;  1ID3 D;  3X1U D;  3MGR D;  1ID3 B;  5B24 B;  3X1U B;  5B0Z A;  5AVC B;  4X23 A;  5FUG B;  3W98 C;  3KXB C;  3AZF C;  3AZG B;  5AV6 B;  3AZE C;  1M1A D;  2PYO A;  1P3A A;  3KUY C;  1M18 D;  4XUJ C;  4HGA C;  2F8N A;  3B0C T;  2JSS A;  5B33 A;  5CPI C;  3AYW D;  4CAY A;  4YS3 D;  3AN2 D;  3UTA B;  3AZJ D;  5B0Y A;  3X1V C;  1P3P A;  3WKJ A;  4Z66 B;  3KWQ D;  4E44 A;  4H9P A;  2ARO C;  1P3B D;  3AZI A;  3AZH C;  3WA9 A;  3KWQ B;  1WWI A;  1P3F D;  1A7W A;  5B1M C;  5GXQ A;  3LEL D;  1P3G D;  3W97 C;  3MGQ C;  4H9N B;  4XZQ D;  4KGC C;  3W98 B;  4Z5T C;  3AZF B;  1BH9 B;  5DNM C;  5B1L A;  3AZE B;  1HQ3 C;  3O62 A;  3REJ A;  1P3I B;  5AVB A; 
#chains in the Genus database with same CATH topology
 5AV9 C;  3V9R A;  5CP6 B;  4YM6 D;  1EQZ A;  5B40 C;  4G92 C;  1F66 D;  4DRB A;  3B0B A;  3NQU A;  1HTA A;  3MNN C;  3MGS A;  5CPI B;  2NQB C;  5AY8 D;  3A6N D;  1TZY C;  4AWL B;  3REL A;  4J8X B;  5DNN D;  3X1V B;  2Y2Q A;  3MGP B;  3AZL A;  3X1S A;  3AZH B;  4WU9 C;  3WAA A;  5CPJ A;  1KX3 D;  4G91 C;  1ZLA C;  5AV8 C;  1N1J B;  4WU8 B;  2NZD A;  5B2I A;  5B1M B;  3WTP A;  5B31 A;  3REH C;  4KGC B;  1S32 D;  4H9R B;  2DF4 C;  3AV2 A;  3MVD A;  1M19 A;  1P3L A;  5DNM B;  2FJ7 C;  1KX5 C;  3LZ1 A;  4ZUX A;  3B6G D;  3R45 B;  1U35 D;  5C3I B;  3AZM C;  5GT0 A;  5JRG D;  4G92 B;  3C1C C;  4UUZ B;  4LD9 D;  4J8U D;  5CPK D;  1KX4 D;  1TZY B;  4UPK A;  3LZ0 A;  3LJA A;  4J8V D;  4LD9 B;  4J8U B;  1KX4 B;  3B6F C;  1BH8 A;  2CV5 B;  1P3O B;  4WU9 B;  1P3K C;  3KXB A;  3REH B;  5BS7 C;  4R8P A;  1P3M B;  5F99 C;  5B0Z D;  3KUY A;  2XD5 A;  4XUJ A;  5BNX B;  2FJ7 B;  4X23 D;  2RVQ D;  1ID3 C;  5B24 C;  3X1U C;  4WJ3 C;  1F1E A;  2PYO D;  1P3A D;  5AVC C;  3AZM B;  5JA4 A;  3C1C B;  2ZY5 A;  4Z2M G;  3AZG C;  4CSR B;  5B33 D;  2ARO A;  3AZN B;  4NFT A;  1M1A C;  3WKJ D;  3AZK A;  1P3P D;  4WNN B;  3P5J B;  3W97 A;  3MGQ A;  3AZI D;  1P3K B;  3WA9 D;  3W96 B;  4Z5T A;  2RIQ A;  2HIO B;  4JJN B;  1HQ3 A;  3TU4 D;  3AN2 C;  3UT9 A;  3AZJ C;  5AV9 A;  5GSU A;  5CHL B;  3KWQ C;  3TU4 B;  3AV1 D;  3EG5 B;  1BFM A;  5B40 A;  5B1L D;  2YFW B;  3REJ D;  3AV1 B;  3MGR B;  5AVB D;  3MNN A;  1P3F C;  2NQB A;  3C1B A;  4KHA A;  2YFV A;  3LEL C;  4QLC D;  3AFA A;  1P3G C;  1JFI B;  1EQZ D;  2F8N G;  1P3I C;  4QLC B;  5KDM A;  3B0D B;  5CP6 C;  1M1A B;  1ZLA A;  5AV8 A;  1M18 B;  3REL D;  3W99 A;  4YM6 C;  3AZL D;  3X1S D;  3NQJ A;  3WAA D;  5CPJ D;  4AWL C;  1AOI D;  5E5A A;  2NZD D;  3AYW B;  5B2I D;  4J8X C;  5AY8 C;  3A6N C;  3WTP D;  1TAF A;  5B31 D;  3AN2 B;  4YS3 B;  3MGP C;  1AOI B;  3AZJ B;  3A1K A;  5DNN C;  3EPL A;  3AV2 D;  4EO5 B;  3MVD D;  5BO0 A;  1P3B B;  1M19 D;  1P3L D;  4WU8 C;  3LZ1 D;  3REI D;  4ZUX D;  1P34 A;  1P3F B;  2BYK A;  3REI B;  3LEL B;  1P3G B;  5GT0 D;  5AV5 A;  4XZQ B;  5B32 A;  3B6F A;  4H9O B;  4J8W A;  3REK D;  2Y2P A;  3LZ0 D;  3LJA D;  5C3I C;  3B6G C;  3REK B;  1U35 C;  2G5I C;  4YM6 B;  5BS7 A;  3LJA B;  5JRG C;  5F99 A;  3WTP E;  3UTB A;  1F66 B;  1T3U A;  4H9Q B;  4NE6 A;  4LD9 C;  4J8U C;  5AY8 B;  2LY8 A;  3A6N B;  5CPK C;  1KX4 C;  1ID3 A;  5B24 A;  3X1U A;  4R8P D;  5DNN B;  2BYM B;  2CV5 C;  1P3O C;  5B31 G;  5AVC A;  3KUY D;  3X1T D;  4XUJ D;  2Y2G A;  5FUG A;  1KX3 B;  3X1T B;  2F2A C;  3AZG A;  1P3M C;  5AV6 A;  5G49 B;  5B0Z C;  1S32 B;  5GT3 D;  3KSY A;  4X23 C;  2Y2M A;  2ARO D;  3EPK A;  5GT3 B;  2JCH A;  3B6G B;  4KUD A;  1U35 B;  3UTA A;  5JRG B;  3AZK D;  4Z66 A;  5B2J D;  3W97 D;  5CPK B;  2G5H C;  5BT1 C;  3AZN C;  5B2J B;  3KWQ A;  5B33 C;  4Z5T D;  4J8V B;  1HQ3 D;  1H3O B;  3UT9 D;  3WKJ C;  4H9N A;  5AV9 D;  2Y2O A;  5GSU D;  1P3P C;  3W96 C;  3W98 A;  1B6W A;  3AZI C;  2HIO C;  3AZF A;  1BH9 A;  4WV4 B;  4JJN C;  3AZE A;  1P3I A;  3MNN D;  2NQB D;  5B0Z B;  3C1B D;  5CP6 A;  3TU4 C;  3AFA D;  1ULY A;  4WZS B;  4X23 B;  3AV1 C;  3AFA B;  1R4V A;  3MGR C;  5CPI A;  5B1L C;  3REJ C;  2PYO B;  3W99 D;  1P3A B;  2F8N D;  4J8X A;  3X1V A;  2F8N B;  3MGP A;  4QLC C;  1EQZ C;  3B0D C;  2BG1 A;  3AZH A;  5B33 B;  5E5A D;  1N1J A;  2IO5 C;  4WU8 A;  1M18 C;  5B1M A;  4CAY B;  5B0Y D;  2ZY4 A;  3REL C;  5B0Y B;  3WKJ B;  1P3P B;  4KGC A;  2FFF B;  2ZY2 A;  4H9R A;  4H9P B;  3A1I A;  3AZI B;  3AZL C;  5DNM A;  3AYW C;  3FDD A;  5GXQ D;  3WA9 B;  3WAA C;  4YS3 C;  1AOI C;  1Q9C A;  1P34 D;  2NZD C;  5B2I C;  5GXQ B;  2Y2K A;  3R45 A;  5B31 C;  4EO5 C;  1P3B C;  5B32 D;  5AV5 D;  2F8N K;  3B6F D;  4UUZ A;  3AV2 C;  3O62 D;  3MVD C;  1M19 C;  5B1L B;  4J8W D;  3LZ1 C;  3O62 B;  1TZY A;  3REI C;  3REJ B;  5AVB B;  4ZUX C;  4LD9 A;  4J8U A;  4XZQ C;  1KX4 A;  3V9R B;  1EQZ B;  5GT0 C;  3MGS D;  2CV5 A;  1WWS A;  5F99 D;  3UTB D;  1P3O A;  4M6B A;  4WU9 A;  2J8P A;  3NQU B;  2IO5 B;  3MGS B;  4NE5 A;  2ZY3 A;  3REK C;  2Y2N A;  3LZ0 C;  5B24 D;  3LJA C;  3REH A;  3REL B;  1P3M A;  2Y2H A;  1F66 C;  5AVC D;  3H0L C;  5BNX A;  3AZL B;  3X1S B;  2FJ7 A;  1KX5 A;  3WAA B;  5CPJ B;  2NZD B;  5B2I B;  3AZG D;  3WTP B;  5AV6 D;  2Y2J A;  5B31 B;  3VH6 A;  3AZM A;  4R8P C;  4H9S C;  3C1C A;  3VH6 T;  3AV2 B;  3MVD B;  1KX3 C;  5BNV A;  3X1T C;  1M19 B;  1P3L B;  5B32 G;  3LZ1 B;  4CSR A;  4ZUX B;  4KUD D;  3AZN A;  1S32 C;  3UTA D;  5GT0 B;  4KUD B;  4Z66 D;  4WNN A;  3IP4 C;  5GT3 C;  1P3K A;  2XD1 A;  3W96 A;  1Z2C B;  3LZ0 B;  2DQN C;  2HIO A;  4JJN A;  1BH8 B;  2Y2I A;  3AZK C;  3W98 D;  3EPH A;  5B2J C;  3TU4 A;  3KXB D;  4J8V C;  3AZF D;  2YFW A;  3AZE D;  1P3I D;  3KXB B;  3AV1 A;  3MGR A;  4R8P B;  1KU5 A;  5CP6 D;  3KUY B;  4XUJ B;  3UT9 C;  1JFI A;  4HGA B;  5GSU C;  1PZR A;  4QLC A;  5CPI D;  1M1A A;  1M18 A;  4J8X D;  5JA4 B;  3X1V D;  3C1B C;  1W2E A;  3MGP D;  1B67 A;  2RVQ C;  3AFA C;  3AZH D;  3H0M C;  2ARO B;  2L5A A;  2PYO C;  1P3A C;  4WU8 D;  3AYW A;  5B1M D;  3AN2 A;  3W99 C;  4YS3 A;  1AOI A;  3MGQ D;  3AZJ A;  4KGC D;  3AZK B;  4Z2M H;  3W97 B;  1P3B A;  3MGQ B;  5DNM D;  4NE3 A;  4ZBJ C;  4Z5T B;  5E5A C;  1P3F A;  5B0Y C;  1HQ3 B;  3REI A;  3LEL A;  1P3G A;  3UT9 B;  5B40 D;  4XZQ A;  5AV9 B;  5GSU B;  3WA9 C;  3EPJ A;  4H9O A;  5B40 B;  5GXQ C;  2UWX A;  1TZY D;  4DRA A;  3MNN B;  1P34 C;  2NQB B;  3C1B B;  4KHA B;  3REK A;  2YFV B;  3VH5 W;  4YM6 A;  4DQY B;  2CV5 D;  5B32 C;  5AV5 C;  1P3O D;  4E45 A;  4WU9 D;  1F66 A;  3O62 C;  1ZLA D;  4H9Q A;  5AVB C;  5KDM B;  5AV8 D;  5AY8 A;  3A6N A;  4J8W C;  4G91 B;  1ZLA B;  2CWE A;  5AV8 B;  3REH D;  3W99 B;  5DNN A;  2BYM A;  1P3M D;  3MGS C;  4H9S A;  2ZM5 A;  3UTB C;  2FJ7 D;  3NQJ B;  1KX5 D;  2F8N H;  4ZBJ B;  2HUE C;  3X1T A;  5E5A B;  1KX3 A;  3KFU G;  1KX5 B;  1TAF B;  3AZM D;  5G49 A;  3X1S C;  3C1C D;  1S32 A;  5CPJ C;  5BO0 B;  3VH6 W;  3WTP C;  5BNV B;  5GT3 A;  1P34 B;  2BYK B;  5BT1 D;  3B6G A;  3AZN D;  5AV6 C;  1U35 A;  3B0C W;  5B32 B;  5AV5 B;  3VH5 A;  5JRG A;  1P3L C;  3B6F B;  3VH5 T;  1P3K D;  4J8W B;  2JE5 A;  5CPK A;  3W96 D;  5B2J A;  4J8V A;  2HIO D;  4JJN D;  4KUD C;  1H3O A;  3UTA C;  3UTB B;  5F99 B;  4Z66 C;  2HUE B;  1ID3 D;  3X1U D;  3H0R C;  3MGR D;  2VQR A;  1ID3 B;  5B24 B;  3X1U B;  5B0Z A;  3F6T A;  5AVC B;  4X23 A;  5FUG B;  3W98 C;  3KXB C;  3AZF C;  3AZG B;  5AV6 B;  3AZE C;  1M1A D;  2PYO A;  1P3A A;  3KUY C;  1M18 D;  4XUJ C;  4HGA C;  2F8N A;  3B0C T;  2JSS A;  5B33 A;  2Y2L A;  5CPI C;  3AYW D;  4CAY A;  2W8S A;  4YS3 D;  3AN2 D;  3UTA B;  3AZJ D;  5B0Y A;  3X1V C;  1P3P A;  3WKJ A;  4Z66 B;  3KWQ D;  4E44 A;  4H9P A;  2ARO C;  1P3B D;  3AZI A;  3AZH C;  3WA9 A;  3KWQ B;  1WWI A;  1P3F D;  1A7W A;  5B1M C;  5GXQ A;  3LEL D;  1P3G D;  3W97 C;  3MGQ C;  4H9N B;  4XZQ D;  4KGC C;  3W98 B;  4Z5T C;  3AZF B;  1BH9 B;  5DNM C;  5B1L A;  3AZE B;  1HQ3 C;  3O62 A;  3REJ A;  1P3I B;  5AVB A;  3AL0 C; 
#chains in the Genus database with same CATH homology
 5AV9 C;  3V9R A;  5CP6 B;  4YM6 D;  1EQZ A;  5B40 C;  4G92 C;  1F66 D;  4DRB A;  3B0B A;  3NQU A;  1HTA A;  3MNN C;  3MGS A;  5CPI B;  2NQB C;  5AY8 D;  3A6N D;  1TZY C;  4AWL B;  3REL A;  4J8X B;  5DNN D;  3X1V B;  2Y2Q A;  3MGP B;  3AZL A;  3X1S A;  3AZH B;  4WU9 C;  3WAA A;  5CPJ A;  1KX3 D;  4G91 C;  1ZLA C;  5AV8 C;  1N1J B;  4WU8 B;  2NZD A;  5B2I A;  5B1M B;  3WTP A;  5B31 A;  3REH C;  4KGC B;  1S32 D;  4H9R B;  2DF4 C;  3AV2 A;  3MVD A;  1M19 A;  1P3L A;  5DNM B;  2FJ7 C;  1KX5 C;  3LZ1 A;  4ZUX A;  3B6G D;  3R45 B;  1U35 D;  5C3I B;  3AZM C;  5GT0 A;  5JRG D;  4G92 B;  3C1C C;  4UUZ B;  4LD9 D;  4J8U D;  5CPK D;  1KX4 D;  1TZY B;  4UPK A;  3LZ0 A;  3LJA A;  4J8V D;  4LD9 B;  4J8U B;  1KX4 B;  3B6F C;  1BH8 A;  2CV5 B;  1P3O B;  4WU9 B;  1P3K C;  3KXB A;  3REH B;  5BS7 C;  4R8P A;  1P3M B;  5F99 C;  5B0Z D;  3KUY A;  2XD5 A;  4XUJ A;  5BNX B;  2FJ7 B;  4X23 D;  2RVQ D;  1ID3 C;  5B24 C;  3X1U C;  4WJ3 C;  1F1E A;  2PYO D;  1P3A D;  5AVC C;  3AZM B;  5JA4 A;  3C1C B;  2ZY5 A;  4Z2M G;  3AZG C;  4CSR B;  5B33 D;  2ARO A;  3AZN B;  4NFT A;  1M1A C;  3WKJ D;  3AZK A;  1P3P D;  4WNN B;  3P5J B;  3W97 A;  3MGQ A;  3AZI D;  1P3K B;  3WA9 D;  3W96 B;  4Z5T A;  2RIQ A;  2HIO B;  4JJN B;  1HQ3 A;  3TU4 D;  3AN2 C;  3UT9 A;  3AZJ C;  5AV9 A;  5GSU A;  5CHL B;  3KWQ C;  3TU4 B;  3AV1 D;  3EG5 B;  1BFM A;  5B40 A;  5B1L D;  2YFW B;  3REJ D;  3AV1 B;  3MGR B;  5AVB D;  3MNN A;  1P3F C;  2NQB A;  3C1B A;  4KHA A;  2YFV A;  3LEL C;  4QLC D;  3AFA A;  1P3G C;  1JFI B;  1EQZ D;  2F8N G;  1P3I C;  4QLC B;  5KDM A;  3B0D B;  5CP6 C;  1M1A B;  1ZLA A;  5AV8 A;  1M18 B;  3REL D;  3W99 A;  4YM6 C;  3AZL D;  3X1S D;  3NQJ A;  3WAA D;  5CPJ D;  4AWL C;  1AOI D;  5E5A A;  2NZD D;  3AYW B;  5B2I D;  4J8X C;  5AY8 C;  3A6N C;  3WTP D;  1TAF A;  5B31 D;  3AN2 B;  4YS3 B;  3MGP C;  1AOI B;  3AZJ B;  3A1K A;  5DNN C;  3EPL A;  3AV2 D;  4EO5 B;  3MVD D;  5BO0 A;  1P3B B;  1M19 D;  1P3L D;  4WU8 C;  3LZ1 D;  3REI D;  4ZUX D;  1P34 A;  1P3F B;  2BYK A;  3REI B;  3LEL B;  1P3G B;  5GT0 D;  5AV5 A;  4XZQ B;  5B32 A;  3B6F A;  4H9O B;  4J8W A;  3REK D;  2Y2P A;  3LZ0 D;  3LJA D;  5C3I C;  3B6G C;  3REK B;  1U35 C;  2G5I C;  4YM6 B;  5BS7 A;  3LJA B;  5JRG C;  5F99 A;  3WTP E;  3UTB A;  1F66 B;  1T3U A;  4H9Q B;  4NE6 A;  4LD9 C;  4J8U C;  5AY8 B;  2LY8 A;  3A6N B;  5CPK C;  1KX4 C;  1ID3 A;  5B24 A;  3X1U A;  4R8P D;  5DNN B;  2BYM B;  2CV5 C;  1P3O C;  5B31 G;  5AVC A;  3KUY D;  3X1T D;  4XUJ D;  2Y2G A;  5FUG A;  1KX3 B;  3X1T B;  2F2A C;  3AZG A;  1P3M C;  5AV6 A;  5G49 B;  5B0Z C;  1S32 B;  5GT3 D;  3KSY A;  4X23 C;  2Y2M A;  2ARO D;  3EPK A;  5GT3 B;  2JCH A;  3B6G B;  4KUD A;  1U35 B;  3UTA A;  5JRG B;  3AZK D;  4Z66 A;  5B2J D;  3W97 D;  5CPK B;  2G5H C;  5BT1 C;  3AZN C;  5B2J B;  3KWQ A;  5B33 C;  4Z5T D;  4J8V B;  1HQ3 D;  1H3O B;  3UT9 D;  3WKJ C;  4H9N A;  5AV9 D;  2Y2O A;  5GSU D;  1P3P C;  3W96 C;  3W98 A;  1B6W A;  3AZI C;  2HIO C;  3AZF A;  1BH9 A;  4WV4 B;  4JJN C;  3AZE A;  1P3I A;  3MNN D;  2NQB D;  5B0Z B;  3C1B D;  5CP6 A;  3TU4 C;  3AFA D;  1ULY A;  4WZS B;  4X23 B;  3AV1 C;  3AFA B;  1R4V A;  3MGR C;  5CPI A;  5B1L C;  3REJ C;  2PYO B;  3W99 D;  1P3A B;  2F8N D;  4J8X A;  3X1V A;  2F8N B;  3MGP A;  4QLC C;  1EQZ C;  3B0D C;  2BG1 A;  3AZH A;  5B33 B;  5E5A D;  1N1J A;  2IO5 C;  4WU8 A;  1M18 C;  5B1M A;  4CAY B;  5B0Y D;  2ZY4 A;  3REL C;  5B0Y B;  3WKJ B;  1P3P B;  4KGC A;  2FFF B;  2ZY2 A;  4H9R A;  4H9P B;  3A1I A;  3AZI B;  3AZL C;  5DNM A;  3AYW C;  3FDD A;  5GXQ D;  3WA9 B;  3WAA C;  4YS3 C;  1AOI C;  1Q9C A;  1P34 D;  2NZD C;  5B2I C;  5GXQ B;  2Y2K A;  3R45 A;  5B31 C;  4EO5 C;  1P3B C;  5B32 D;  5AV5 D;  2F8N K;  3B6F D;  4UUZ A;  3AV2 C;  3O62 D;  3MVD C;  1M19 C;  5B1L B;  4J8W D;  3LZ1 C;  3O62 B;  1TZY A;  3REI C;  3REJ B;  5AVB B;  4ZUX C;  4LD9 A;  4J8U A;  4XZQ C;  1KX4 A;  3V9R B;  1EQZ B;  5GT0 C;  3MGS D;  2CV5 A;  1WWS A;  5F99 D;  3UTB D;  1P3O A;  4M6B A;  4WU9 A;  2J8P A;  3NQU B;  2IO5 B;  3MGS B;  4NE5 A;  2ZY3 A;  3REK C;  2Y2N A;  3LZ0 C;  5B24 D;  3LJA C;  3REH A;  3REL B;  1P3M A;  2Y2H A;  1F66 C;  5AVC D;  3H0L C;  5BNX A;  3AZL B;  3X1S B;  2FJ7 A;  1KX5 A;  3WAA B;  5CPJ B;  2NZD B;  5B2I B;  3AZG D;  3WTP B;  5AV6 D;  2Y2J A;  5B31 B;  3VH6 A;  3AZM A;  4R8P C;  4H9S C;  3C1C A;  3VH6 T;  3AV2 B;  3MVD B;  1KX3 C;  5BNV A;  3X1T C;  1M19 B;  1P3L B;  5B32 G;  3LZ1 B;  4CSR A;  4ZUX B;  4KUD D;  3AZN A;  1S32 C;  3UTA D;  5GT0 B;  4KUD B;  4Z66 D;  4WNN A;  3IP4 C;  5GT3 C;  1P3K A;  2XD1 A;  3W96 A;  1Z2C B;  3LZ0 B;  2DQN C;  2HIO A;  4JJN A;  1BH8 B;  2Y2I A;  3AZK C;  3W98 D;  3EPH A;  5B2J C;  3TU4 A;  3KXB D;  4J8V C;  3AZF D;  2YFW A;  3AZE D;  1P3I D;  3KXB B;  3AV1 A;  3MGR A;  4R8P B;  1KU5 A;  5CP6 D;  3KUY B;  4XUJ B;  3UT9 C;  1JFI A;  4HGA B;  5GSU C;  1PZR A;  4QLC A;  5CPI D;  1M1A A;  1M18 A;  4J8X D;  5JA4 B;  3X1V D;  3C1B C;  1W2E A;  3MGP D;  1B67 A;  2RVQ C;  3AFA C;  3AZH D;  3H0M C;  2ARO B;  2L5A A;  2PYO C;  1P3A C;  4WU8 D;  3AYW A;  5B1M D;  3AN2 A;  3W99 C;  4YS3 A;  1AOI A;  3MGQ D;  3AZJ A;  4KGC D;  3AZK B;  4Z2M H;  3W97 B;  1P3B A;  3MGQ B;  5DNM D;  4NE3 A;  4ZBJ C;  4Z5T B;  5E5A C;  1P3F A;  5B0Y C;  1HQ3 B;  3REI A;  3LEL A;  1P3G A;  3UT9 B;  5B40 D;  4XZQ A;  5AV9 B;  5GSU B;  3WA9 C;  3EPJ A;  4H9O A;  5B40 B;  5GXQ C;  2UWX A;  1TZY D;  4DRA A;  3MNN B;  1P34 C;  2NQB B;  3C1B B;  4KHA B;  3REK A;  2YFV B;  3VH5 W;  4YM6 A;  4DQY B;  2CV5 D;  5B32 C;  5AV5 C;  1P3O D;  4E45 A;  4WU9 D;  1F66 A;  3O62 C;  1ZLA D;  4H9Q A;  5AVB C;  5KDM B;  5AV8 D;  5AY8 A;  3A6N A;  4J8W C;  4G91 B;  1ZLA B;  2CWE A;  5AV8 B;  3REH D;  3W99 B;  5DNN A;  2BYM A;  1P3M D;  3MGS C;  4H9S A;  2ZM5 A;  3UTB C;  2FJ7 D;  3NQJ B;  1KX5 D;  2F8N H;  4ZBJ B;  2HUE C;  3X1T A;  5E5A B;  1KX3 A;  3KFU G;  1KX5 B;  1TAF B;  3AZM D;  5G49 A;  3X1S C;  3C1C D;  1S32 A;  5CPJ C;  5BO0 B;  3VH6 W;  3WTP C;  5BNV B;  5GT3 A;  1P34 B;  2BYK B;  5BT1 D;  3B6G A;  3AZN D;  5AV6 C;  1U35 A;  3B0C W;  5B32 B;  5AV5 B;  3VH5 A;  5JRG A;  1P3L C;  3B6F B;  3VH5 T;  1P3K D;  4J8W B;  2JE5 A;  5CPK A;  3W96 D;  5B2J A;  4J8V A;  2HIO D;  4JJN D;  4KUD C;  1H3O A;  3UTA C;  3UTB B;  5F99 B;  4Z66 C;  2HUE B;  1ID3 D;  3X1U D;  3H0R C;  3MGR D;  2VQR A;  1ID3 B;  5B24 B;  3X1U B;  5B0Z A;  3F6T A;  5AVC B;  4X23 A;  5FUG B;  3W98 C;  3KXB C;  3AZF C;  3AZG B;  5AV6 B;  3AZE C;  1M1A D;  2PYO A;  1P3A A;  3KUY C;  1M18 D;  4XUJ C;  4HGA C;  2F8N A;  3B0C T;  2JSS A;  5B33 A;  2Y2L A;  5CPI C;  3AYW D;  4CAY A;  2W8S A;  4YS3 D;  3AN2 D;  3UTA B;  3AZJ D;  5B0Y A;  3X1V C;  1P3P A;  3WKJ A;  4Z66 B;  3KWQ D;  4E44 A;  4H9P A;  2ARO C;  1P3B D;  3AZI A;  3AZH C;  3WA9 A;  3KWQ B;  1WWI A;  1P3F D;  1A7W A;  5B1M C;  5GXQ A;  3LEL D;  1P3G D;  3W97 C;  3MGQ C;  4H9N B;  4XZQ D;  4KGC C;  3W98 B;  4Z5T C;  3AZF B;  1BH9 B;  5DNM C;  5B1L A;  3AZE B;  1HQ3 C;  3O62 A;  3REJ A;  1P3I B;  5AVB A;  3AL0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...