5B2IB

Human nucleosome containing cpg unmethylated dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Histone H3.1
publication title Crystal structure of human nucleosome core particle containing enzymatically introduced CpG methylation
doi rcsb
source organism Homo sapiens
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b2iB00
2HUEC 4J8VD 5B40B 3KWQB 3AZKB 3KSYA 5BS7A 5F99D 1H3OA 3W96C 5CPID 1N1JA 3WA9A 5AV6B 4Z66D 2NZDB 3B6FC 3MNND 5KDMB 3LJAB 3UTBB 3X1VA 2F8NB 5B1LC 5AVBA 4EO5C 1P3PB 3RELB 4KUDB 4E44A 3AZID 5B32G 3TU4B 4G91C 1TZYC 1ID3C 5CP6A 3WTPE 1P34A 5GSUC 3X1TC 1P3FA 3AFAD 5AV9C 5B40A 4UUZB 1M18C 5AVCB 2HIOB 4WU9D 1P3OC 3B0DC 3LELC 4J8WD 3UT9D 2BYMA 4H9OA 3W96A 5BO0B 4AWLC 1AOID 1M19B 4YS3C 2JSSA 5CPJD 2F8NK 4J8XC 4G92C 1KX3D 3B6FA 3VH6W 4KUDA 5F99B 5CPIB 5AY8C 5B1LA 5B2JC 4XUJC 4WNNB 3LZ0C 1P3LD 4ZBJB 3AZFD 2PYOD 1HQ3D 4Z66B 5BNXB 3AZMD 1TZYA 3MNNB 1ZLAC 4NE6A 5B31D 5GSUA 3LZ1C 3B0BA 4H9RA 3X1TA 2AROC 1P3MC 3AZIB 5AV5C 1M18A 5BO0A 3MGQD 3AFAB 1F1EA 3B0CT 1S32D 4YS3A 3AZLD 3VH5T 4WU9B 5BNVA 4J8WB 3UT9B 1P3KC 1AOIB 5E5AC 3O62C 3W98D 5AY8A 5B2JA 4H9NB 3KUYC 5CPJB 3LZ0A 3REHC 1KX3B 1JFIB 4KHAB 3C1CC 1ZLAA 3AV1C 3WA9D 5B1MA 5DNMB 1P3GB 2AROA 3AZFB 1HQ3B 2PYOB 4NE3A 3X1VD 3NQUB 3WAAB 5AV5A 5B32C 3AZMB 5AVBD 3AZEC 3AYWC 5B31B 1U35D 5B33C 1EQZC 5CP6D 1P34D 2F8NG 3MGQB 4ZUXC 3MGSB 1P3FD 5B40D 1P3KA 4Z5TA 1S32B 5E5AA 3O62A 4QLCB 3KUYA 3AZLB 1P3GA 3C1CA 3WAAA 3B0CW 3C1BC 3KXBC 3B6FD 4JJNC 4KUDD 3NQJA 1H3OB 4KGCC 3WKJC 5JRGC 5B32A 5B1LD 4J8UC 1M1AC 5FUGA 3AZEA 1P3IC 5GT0C 3WA9B 3AYWA 3MGSA 3A6NC 1EQZA 1TZYD 3X1VB 4QLCA 4ZUXA 5GSUD 5AVBB 1P3AA 3X1TD 4DRBA 1B67A 4Z2MG 5C3IB 2CWEA 3AZHC 5CP6B 1P34B 3WTPA 1P3FB 4YS3D 3X1UC 3C1BA 2HUEB 3KXBA 3MGPC 4JJNA 5B2IC 2BYMB 4H9OB 4WU8A 3W96B 3WKJA 5AY8D 5B2JD 4J8UA 1M1AA 3LZ0D 5B0ZC 3UTAC 3B6FB 3REIC 3KWQC 3AZKC 1ZLAD 5B1LB 5B1MD 3X1SC 4EO5B 2AROD 3AN2C 2FJ7C 5AV5D 3AZHA 1TZYB 4G91B 4NFTA 5B24C 3MGRA 1ID3B 3UTBC 5GSUB 4H9RB 3X1TB 5AV9B 3REKC 1M18B 3B6GC 3X1UA 1TAFA 3B0DB 3MGPA 1P3KD 4R8PC 4Z5TD 5B31G 5B2IA 4AWLB 3AZNC 1KX5C 5E5AD 3O62D 5CPKC 1Q9CA 5GT3C 4X23C 4YS3B 3KUYD 3UTAA 5B0ZA 4G92B 5BNVB 5DNMD 1P3GD 5BT1C 5AV8C 3W97C 3REIA 3C1CD 3AZJC 3WAAD 5AY8B 5B2JB 3X1SA 4XUJB 4NE5A 1ID3A 3VH6A 3LZ0B 3AN2A 2FJ7A 5AV9A 4YM6C 4J8VC 5B32D 1ZLAB 5B24A 3AZED 5F99C 3AYWD 5B1MB 3MGSD 1BH9A 1P3OA 1EQZD 3LELA 3W99C 2AROB 1P3MB 2F8NH 4ZBJC 5AV5B 2IO5C 4QLCD 4ZUXD 1P3AD 4J8XA 4R8PA 3AZNA 1KX5A 5CPKA 5GT3A 4X23A 3AZIC 1HTAA 3WTPD 4XUJA 2BYKA 5AV8A 3W97A 1P3KB 4Z5TB 5E5AB 3O62B 3C1BD 5G49A 1KX4C 3KUYB 4WU9C 4JJND 4HGAC 3LZ1A 4WU8D 4YM6A 3WKJD 1P3MA 3UT9C 3C1CB 4J8UD 1M1AD 3W99A 3NQJB 5B32B 4Z2MH 5FUGB 3AZEB 4CSRA 3AYWB 5B33B 1EQZB 3AZGC 1BFMA 3AZHD 1P3LC 3MGRD 3MVDC 4XZQC 2NQBC 1P3AB 4ZUXB 3AV2C 4CAYA 3REHA 5B31C 3REJC 3W96D 3X1UD 1KX4A 3AV1A 3WTPB 3MGPD 3MGQC 3VH5W 5B2ID 2YFWA 3C1BB 3UTAD 5B0ZD 1S32C 3KXBB 5DNNC 3REID 4JJNB 5B33A 4WU8B 4KGCB 3WKJB 5JRGB 3X1SD 4J8UB 1M1AB 1ID3D 1P3IB 1BH8A 5GT0B 3W98C 3AN2D 2FJ7D 5B0YC 5AV9D 3AZGA 2YFVB 1M18D 5B24D 3MVDA 4XZQA 2NQBA 2CV5C 1P3OD 1KU5A 3AV2A 3LELD 3REJA 3AZHB 3MGRB 5GXQC 4J8XD 1B6WA 1F66C 4R8PD 5AVBC 3AZND 1KX5D 1U35C 5CPKD 1P3BC 5GT3D 4KGCA 3X1UB 5JRGA 1TAFB 4XUJD 4LD9C 1P3IA 5GT0A 3MGPB 5BT1D 5DNNA 5AV8D 3W97D 5B2IB 3A6NA 3VH6T 5B40C 2YFVA 3UTAB 5B0ZB 3LZ1D 5B0YA 4YM6D 3REIB 1P3MD 5AV6C 4H9SC 2NZDC 3X1SB 2CV5A 3LJAC 3W99D 3AN2B 2FJ7B 1P3PC 3RELC 5B24B 4KUDC 5GXQA 3TU4C 1BH9B 1P3OB 1F66A 3LELB 3REKB 3R45B 1U35A 1P3BA 3B6GB 1ULYA 4LD9A 5AVCC 4J8XB 2HIOC 3REHD 2RVQC 4R8PB 3AZNB 4E45A 4H9PB 1KX5B 3KWQA 3AZKA 5CPKB 5GT3B 4X23B 1KX4D 3AV1D 5CHLB 1M19C 2BYKB 5AV8B 3W97B 5AV6A 3AZJB 4H9SA 4M6BA 2NZDA 5G49B 3LJAA 5KDMA 3UTBA 2F8NA 5CPIC 5B33D 3LZ1B 4YM6B 3V9RB 4J8VB 3REKA 1P3PA 3R45A 4DRAA 3RELA 4Z66C 3B6GA 3TU4A 3MNNC 3AZGD 3W99B 3MVDD 4XZQD 2NQBD 4H9PA 2IO5B 4UUZA 4CSRB 3AV2D 5AVCA 2HIOA 5B1MC 3REJD 3AFAC 3AZJA 1R4VA 3KXBD 1M19A 4CAYB 3REHB 4H9QB 4KGCD 3V9RA 4J8VA 5JRGD 4J8WC 1P3ID 5F99A 5GT0D 3AV1B 1KX4B 1AOIC 5DNND 5CPIA 4HGAB 3A6ND 4WNNA 5JA4B 5CPJC 2YFWB 1KX3C 4Z5TC 4Z66A 5BNXA 5B0YD 3MNNA 1A7WA 5DNMC 1P3GC 3AZFC 2CV5D 1HQ3C 2PYOC 1BH8B 3WAAC 3AZIA 3AZMC 3AZGB 1P3LB 3MVDB 4H9QA 4WZSB 4XZQB 5GXQD 3AFAA 2NQBB 1F66D 3AV2B 4WU9A 3MGSC 3REJB 1P3BD 5JA4A 4J8WA 3UT9A 4LD9D 1WWIA 1AOIA 4QLCC 1P3AC 4H9NA 3AZLC 5CPJA 3KWQD 3AZKD 1KX3A 1JFIA 3VH5A 4KHAA 5DNNB 3WTPC 3A6NB 5AV6D 2NZDD 5DNMA 1P3LA 3AZFA 2PYOA 1HQ3A 5BS7C 3LJAD 3NQUA 3UTBD 2F8ND 2L5AA 3W98B 3AZMA 5B0YB 3WA9C 3REKD 1P3PD 5B31A 3RELD 4WV4B 3B6GD 4WU8C 2CV5B 3TU4D 3X1VC 1N1JB 3MGQA 2LY8A 5C3IC 4X23D 5GXQB 5AVCD 2HIOD 1S32A 2RVQD 1F66B 5CP6C 1P34C 3AZLA 1WWSA 1U35B 1P3BB 1P3FC 3AZJD 1M19D 4LD9B 3MGRC 3W98A
chains in the Genus database with same CATH superfamily
3FDDA 2HUEC 4J8VD 5B40B 3KWQB 3AZKB 3KSYA 5BS7A 5F99D 1H3OA 3W96C 5CPID 1N1JA 3WA9A 3KFUG 5AV6B 4Z66D 2NZDB 3B6FC 3MNND 5KDMB 3LJAB 3UTBB 3X1VA 2F8NB 5B1LC 5AVBA 4EO5C 1P3PB 3RELB 4KUDB 4E44A 3AZID 5B32G 3AL0C 3TU4B 1TZYC 4G91C 1ID3C 5CP6A 3WTPE 1P34A 5GSUC 3X1TC 1P3FA 3AFAD 5AV9C 5B40A 4UUZB 1M18C 5AVCB 2HIOB 4WU9D 1P3OC 3B0DC 3LELC 4J8WD 3UT9D 2G5HC 2BYMA 4H9OA 3W96A 5BO0B 4AWLC 1AOID 1M19B 4YS3C 2JSSA 5CPJD 2F8NK 4J8XC 4G92C 1KX3D 2Y2QA 3B6FA 3VH6W 2FFFB 4KUDA 5F99B 5CPIB 5AY8C 5B1LA 5B2JC 4XUJC 4WNNB 3LZ0C 1P3LD 4ZBJB 3AZFD 2PYOD 1HQ3D 4Z66B 5BNXB 2ZY3A 3AZMD 1TZYA 3MNNB 1ZLAC 4NE6A 5B31D 5GSUA 3LZ1C 3B0BA 2DF4C 4H9RA 3X1TA 2AROC 1P3MC 3AZIB 5AV5C 1M18A 5BO0A 3MGQD 3AFAB 1F1EA 3B0CT 1S32D 4YS3A 3AZLD 3VH5T 4WU9B 3EPJA 5BNVA 4J8WB 3UT9B 1P3KC 1AOIB 5E5AC 3O62C 3W98D 5AY8A 5B2JA 4H9NB 3KUYC 5CPJB 3LZ0A 3REHC 1KX3B 1JFIB 4KHAB 3C1CC 1ZLAA 3AV1C 3WA9D 5B1MA 5DNMB 1P3GB 2AROA 3AZFB 1HQ3B 2PYOB 4NE3A 3X1VD 3NQUB 3WAAB 5AV5A 5B32C 3AZMB 5AVBD 3AZEC 1PZRA 3AYWC 5B31B 1U35D 5B33C 1EQZC 5CP6D 1P34D 2F8NG 2Y2KA 3MGQB 4ZUXC 3MGSB 1P3FD 5B40D 1P3KA 4Z5TA 1Z2CB 1S32B 5E5AA 3O62A 4QLCB 3KUYA 3AZLB 2ZY4A 1P3GA 3C1CA 3WAAA 3B0CW 3C1BC 2JCHA 3KXBC 3B6FD 4JJNC 4KUDD 3NQJA 1H3OB 4KGCC 3WKJC 5JRGC 5B32A 5B1LD 4J8UC 1M1AC 5FUGA 3AZEA 1P3IC 5GT0C 3WA9B 3AYWA 3MGSA 3A6NC 1EQZA 3P5JB 1TZYD 3X1VB 4QLCA 4ZUXA 5GSUD 5AVBB 1P3AA 3X1TD 4DRBA 1B67A 4Z2MG 5C3IB 3H0RC 2CWEA 3AZHC 5CP6B 3A1KA 1P34B 3WTPA 1P3FB 2UWXA 4YS3D 3X1UC 3C1BA 2Y2OA 2ZY5A 2HUEB 3KXBA 3MGPC 4JJNA 2Y2PA 5B2IC 2BYMB 4H9OB 4WU8A 3W96B 3WKJA 5AY8D 5B2JD 4J8UA 1M1AA 3LZ0D 5B0ZC 3UTAC 3B6FB 3REIC 3KWQC 3AZKC 1ZLAD 5B1LB 5B1MD 3X1SC 4EO5B 2AROD 3AN2C 2FJ7C 5AV5D 3AZHA 1TZYB 4G91B 4NFTA 5B24C 3MGRA 1ID3B 3UTBC 1W2EA 5GSUB 4H9RB 3X1TB 5AV9B 3REKC 2W8SA 1M18B 3B6GC 3X1UA 1TAFA 3IP4C 3B0DB 3MGPA 1P3KD 4R8PC 4Z5TD 5B31G 5B2IA 4AWLB 3AZNC 1KX5C 5E5AD 3O62D 5CPKC 1Q9CA 5GT3C 4X23C 4YS3B 3KUYD 3UTAA 5B0ZA 4G92B 5BNVB 5DNMD 1P3GD 5BT1C 5AV8C 3W97C 3REIA 4WJ3C 3C1CD 3AZJC 3WAAD 2Y2NA 2Y2LA 5AY8B 5B2JB 3X1SA 4XUJB 4NE5A 1ID3A 3VH6A 3LZ0B 3AN2A 2Y2MA 2FJ7A 3H0MC 5AV9A 4YM6C 4J8VC 5B32D 1ZLAB 5B24A 3AZED 5F99C 3AYWD 5B1MB 3MGSD 1BH9A 1P3OA 1EQZD 3LELA 3W99C 2AROB 1P3MB 2F8NH 4ZBJC 5AV5B 2XD1A 2IO5C 4QLCD 4ZUXD 1P3AD 4J8XA 2VQRA 4R8PA 3AZNA 1KX5A 5CPKA 5GT3A 4X23A 3AZIC 1HTAA 3WTPD 4XUJA 2BYKA 3F6TA 5AV8A 3W97A 1P3KB 4Z5TB 5E5AB 3O62B 3C1BD 5G49A 1KX4C 3KUYB 3A1IA 4WU9C 4JJND 4HGAC 3LZ1A 4WU8D 4YM6A 3WKJD 1P3MA 3UT9C 3C1CB 4J8UD 1M1AD 3W99A 3NQJB 5B32B 4Z2MH 5FUGB 3AZEB 4CSRA 3AYWB 5B33B 1EQZB 3AZGC 1BFMA 3AZHD 1P3LC 3MGRD 3MVDC 4XZQC 2NQBC 1P3AB 4ZUXB 3AV2C 4CAYA 3REHA 5B31C 3REJC 3W96D 2ZM5A 3X1UD 1KX4A 3AV1A 3WTPB 3MGPD 4DQYB 3MGQC 3VH5W 5B2ID 2YFWA 3C1BB 3UTAD 5B0ZD 1S32C 3KXBB 5DNNC 3REID 4JJNB 2ZY2A 5B33A 4WU8B 4KGCB 3WKJB 5JRGB 3X1SD 4J8UB 1M1AB 1ID3D 1P3IB 1BH8A 5GT0B 3W98C 3AN2D 2FJ7D 5B0YC 5AV9D 3AZGA 2YFVB 1M18D 5B24D 3MVDA 4XZQA 2NQBA 2XD5A 2CV5C 1P3OD 1KU5A 3AV2A 3LELD 2Y2GA 3REJA 3AZHB 3MGRB 5GXQC 4J8XD 2Y2IA 1B6WA 1F66C 4R8PD 5AVBC 3AZND 1KX5D 1U35C 5CPKD 1P3BC 5GT3D 4KGCA 3X1UB 5JRGA 1TAFB 4XUJD 4LD9C 1P3IA 5GT0A 3MGPB 5BT1D 5DNNA 5AV8D 3W97D 5B2IB 3A6NA 3VH6T 5B40C 2YFVA 3UTAB 5B0ZB 3LZ1D 5B0YA 4YM6D 3REIB 1P3MD 5AV6C 4H9SC 2NZDC 3X1SB 2CV5A 3LJAC 2Y2JA 3W99D 3AN2B 2FJ7B 1P3PC 3RELC 5B24B 4KUDC 5GXQA 3TU4C 1BH9B 1P3OB 1F66A 3LELB 3REKB 3R45B 1U35A 1P3BA 3B6GB 3EG5B 2F2AC 1ULYA 4LD9A 5AVCC 4J8XB 2HIOC 3REHD 2RVQC 4R8PB 3AZNB 4E45A 4H9PB 1KX5B 2RIQA 3KWQA 3AZKA 5GT3B 4X23B 5CPKB 1KX4D 3AV1D 5CHLB 1M19C 2BYKB 5AV8B 3W97B 5AV6A 3AZJB 4H9SA 4M6BA 2NZDA 5G49B 3LJAA 5KDMA 3UTBA 2F8NA 5CPIC 5B33D 3LZ1B 4YM6B 3V9RB 4J8VB 3REKA 1P3PA 2BG1A 3R45A 4DRAA 3RELA 4Z66C 3B6GA 3TU4A 3MNNC 3AZGD 3W99B 3MVDD 4XZQD 2NQBD 4H9PA 2IO5B 4UUZA 4CSRB 3AV2D 5AVCA 2HIOA 5B1MC 2Y2HA 3REJD 3AFAC 3AZJA 1R4VA 3KXBD 1M19A 2G5IC 4CAYB 3REHB 4H9QB 4KGCD 3V9RA 4J8VA 5JRGD 4J8WC 1P3ID 5F99A 5GT0D 3AV1B 1KX4B 1AOIC 5DNND 5CPIA 4HGAB 3A6ND 4WNNA 5JA4B 5CPJC 2YFWB 1KX3C 4Z5TC 4Z66A 5BNXA 3EPKA 5B0YD 3MNNA 1A7WA 3H0LC 5DNMC 1P3GC 3AZFC 2CV5D 1HQ3C 2PYOC 1BH8B 3WAAC 3AZIA 3EPLA 3AZMC 3AZGB 1P3LB 3MVDB 4H9QA 4WZSB 4XZQB 5GXQD 3AFAA 2NQBB 1F66D 3AV2B 4WU9A 3MGSC 3REJB 1P3BD 5JA4A 4UPKA 4J8WA 3UT9A 4LD9D 1WWIA 1AOIA 4QLCC 1P3AC 3EPHA 4H9NA 3AZLC 5CPJA 3KWQD 3AZKD 1KX3A 1JFIA 3VH5A 4KHAA 5DNNB 3WTPC 3A6NB 5AV6D 2NZDD 5DNMA 1P3LA 3AZFA 2PYOA 1HQ3A 5BS7C 1T3UA 3LJAD 3NQUA 3UTBD 2F8ND 2L5AA 3W98B 3AZMA 5B0YB 3WA9C 3REKD 1P3PD 5B31A 3RELD 4WV4B 3B6GD 4WU8C 2CV5B 3TU4D 3X1VC 2J8PA 1N1JB 2DQNC 3MGQA 2LY8A 2JE5A 5C3IC 4X23D 5GXQB 5AVCD 2HIOD 1S32A 2RVQD 1F66B 5CP6C 1P34C 3AZLA 1WWSA 1U35B 1P3BB 1P3FC 3AZJD 1M19D 4LD9B 3MGRC 3W98A
chains in the Genus database with same CATH topology
3FDDA 2HUEC 4J8VD 5B40B 3KWQB 3AZKB 3KSYA 5BS7A 5F99D 1H3OA 3W96C 5CPID 1N1JA 3WA9A 3KFUG 5AV6B 4Z66D 2NZDB 3B6FC 3MNND 5KDMB 3LJAB 3UTBB 3X1VA 2F8NB 5B1LC 5AVBA 4EO5C 1P3PB 3RELB 4KUDB 4E44A 3AZID 5B32G 3AL0C 3TU4B 1TZYC 4G91C 1ID3C 5CP6A 3WTPE 1P34A 5GSUC 3X1TC 1P3FA 3AFAD 5AV9C 5B40A 4UUZB 1M18C 5AVCB 2HIOB 4WU9D 1P3OC 3B0DC 3LELC 4J8WD 3UT9D 2G5HC 2BYMA 4H9OA 3W96A 5BO0B 4AWLC 1AOID 1M19B 4YS3C 2JSSA 5CPJD 2F8NK 4J8XC 4G92C 1KX3D 2Y2QA 3B6FA 3VH6W 2FFFB 4KUDA 5F99B 5CPIB 5AY8C 5B1LA 5B2JC 4XUJC 4WNNB 3LZ0C 1P3LD 4ZBJB 3AZFD 2PYOD 1HQ3D 4Z66B 5BNXB 2ZY3A 3AZMD 1TZYA 3MNNB 1ZLAC 4NE6A 5B31D 5GSUA 3LZ1C 3B0BA 2DF4C 4H9RA 3X1TA 2AROC 1P3MC 3AZIB 5AV5C 1M18A 5BO0A 3MGQD 3AFAB 1F1EA 3B0CT 1S32D 4YS3A 3AZLD 3VH5T 4WU9B 3EPJA 5BNVA 4J8WB 3UT9B 1P3KC 1AOIB 5E5AC 3O62C 3W98D 5AY8A 5B2JA 4H9NB 3KUYC 5CPJB 3LZ0A 3REHC 1KX3B 1JFIB 4KHAB 3C1CC 1ZLAA 3AV1C 3WA9D 5B1MA 5DNMB 1P3GB 2AROA 3AZFB 1HQ3B 2PYOB 4NE3A 3X1VD 3NQUB 3WAAB 5AV5A 5B32C 3AZMB 5AVBD 3AZEC 1PZRA 3AYWC 5B31B 1U35D 5B33C 1EQZC 5CP6D 1P34D 2F8NG 2Y2KA 3MGQB 4ZUXC 3MGSB 1P3FD 5B40D 1P3KA 4Z5TA 1Z2CB 1S32B 5E5AA 3O62A 4QLCB 3KUYA 3AZLB 2ZY4A 1P3GA 3C1CA 3WAAA 3B0CW 3C1BC 2JCHA 3KXBC 3B6FD 4JJNC 4KUDD 3NQJA 1H3OB 4KGCC 3WKJC 5JRGC 5B32A 5B1LD 4J8UC 1M1AC 5FUGA 3AZEA 1P3IC 5GT0C 3WA9B 3AYWA 3MGSA 3A6NC 1EQZA 3P5JB 1TZYD 3X1VB 4QLCA 4ZUXA 5GSUD 5AVBB 1P3AA 3X1TD 4DRBA 1B67A 4Z2MG 5C3IB 3H0RC 2CWEA 3AZHC 5CP6B 3A1KA 1P34B 3WTPA 1P3FB 2UWXA 4YS3D 3X1UC 3C1BA 2Y2OA 2ZY5A 2HUEB 3KXBA 3MGPC 4JJNA 2Y2PA 5B2IC 2BYMB 4H9OB 4WU8A 3W96B 3WKJA 5AY8D 5B2JD 4J8UA 1M1AA 3LZ0D 5B0ZC 3UTAC 3B6FB 3REIC 3KWQC 3AZKC 1ZLAD 5B1LB 5B1MD 3X1SC 4EO5B 2AROD 3AN2C 2FJ7C 5AV5D 3AZHA 1TZYB 4G91B 4NFTA 5B24C 3MGRA 1ID3B 3UTBC 1W2EA 5GSUB 4H9RB 3X1TB 5AV9B 3REKC 2W8SA 1M18B 3B6GC 3X1UA 1TAFA 3IP4C 3B0DB 3MGPA 1P3KD 4R8PC 4Z5TD 5B31G 5B2IA 4AWLB 3AZNC 1KX5C 5E5AD 3O62D 5CPKC 1Q9CA 5GT3C 4X23C 4YS3B 3KUYD 3UTAA 5B0ZA 4G92B 5BNVB 5DNMD 1P3GD 5BT1C 5AV8C 3W97C 3REIA 4WJ3C 3C1CD 3AZJC 3WAAD 2Y2NA 2Y2LA 5AY8B 5B2JB 3X1SA 4XUJB 4NE5A 1ID3A 3VH6A 3LZ0B 3AN2A 2Y2MA 2FJ7A 3H0MC 5AV9A 4YM6C 4J8VC 5B32D 1ZLAB 5B24A 3AZED 5F99C 3AYWD 5B1MB 3MGSD 1BH9A 1P3OA 1EQZD 3LELA 3W99C 2AROB 1P3MB 2F8NH 4ZBJC 5AV5B 2XD1A 2IO5C 4QLCD 4ZUXD 1P3AD 4J8XA 2VQRA 4R8PA 3AZNA 1KX5A 5CPKA 5GT3A 4X23A 3AZIC 1HTAA 3WTPD 4XUJA 2BYKA 3F6TA 5AV8A 3W97A 1P3KB 4Z5TB 5E5AB 3O62B 3C1BD 5G49A 1KX4C 3KUYB 3A1IA 4WU9C 4JJND 4HGAC 3LZ1A 4WU8D 4YM6A 3WKJD 1P3MA 3UT9C 3C1CB 4J8UD 1M1AD 3W99A 3NQJB 5B32B 4Z2MH 5FUGB 3AZEB 4CSRA 3AYWB 5B33B 1EQZB 3AZGC 1BFMA 3AZHD 1P3LC 3MGRD 3MVDC 4XZQC 2NQBC 1P3AB 4ZUXB 3AV2C 4CAYA 3REHA 5B31C 3REJC 3W96D 2ZM5A 3X1UD 1KX4A 3AV1A 3WTPB 3MGPD 4DQYB 3MGQC 3VH5W 5B2ID 2YFWA 3C1BB 3UTAD 5B0ZD 1S32C 3KXBB 5DNNC 3REID 4JJNB 2ZY2A 5B33A 4WU8B 4KGCB 3WKJB 5JRGB 3X1SD 4J8UB 1M1AB 1ID3D 1P3IB 1BH8A 5GT0B 3W98C 3AN2D 2FJ7D 5B0YC 5AV9D 3AZGA 2YFVB 1M18D 5B24D 3MVDA 4XZQA 2NQBA 2XD5A 2CV5C 1P3OD 1KU5A 3AV2A 3LELD 2Y2GA 3REJA 3AZHB 3MGRB 5GXQC 4J8XD 2Y2IA 1B6WA 1F66C 4R8PD 5AVBC 3AZND 1KX5D 1U35C 5CPKD 1P3BC 5GT3D 4KGCA 3X1UB 5JRGA 1TAFB 4XUJD 4LD9C 1P3IA 5GT0A 3MGPB 5BT1D 5DNNA 5AV8D 3W97D 5B2IB 3A6NA 3VH6T 5B40C 2YFVA 3UTAB 5B0ZB 3LZ1D 5B0YA 4YM6D 3REIB 1P3MD 5AV6C 4H9SC 2NZDC 3X1SB 2CV5A 3LJAC 2Y2JA 3W99D 3AN2B 2FJ7B 1P3PC 3RELC 5B24B 4KUDC 5GXQA 3TU4C 1BH9B 1P3OB 1F66A 3LELB 3REKB 3R45B 1U35A 1P3BA 3B6GB 3EG5B 2F2AC 1ULYA 4LD9A 5AVCC 4J8XB 2HIOC 3REHD 2RVQC 4R8PB 3AZNB 4E45A 4H9PB 1KX5B 2RIQA 3KWQA 3AZKA 5GT3B 4X23B 5CPKB 1KX4D 3AV1D 5CHLB 1M19C 2BYKB 5AV8B 3W97B 5AV6A 3AZJB 4H9SA 4M6BA 2NZDA 5G49B 3LJAA 5KDMA 3UTBA 2F8NA 5CPIC 5B33D 3LZ1B 4YM6B 3V9RB 4J8VB 3REKA 1P3PA 2BG1A 3R45A 4DRAA 3RELA 4Z66C 3B6GA 3TU4A 3MNNC 3AZGD 3W99B 3MVDD 4XZQD 2NQBD 4H9PA 2IO5B 4UUZA 4CSRB 3AV2D 5AVCA 2HIOA 5B1MC 2Y2HA 3REJD 3AFAC 3AZJA 1R4VA 3KXBD 1M19A 2G5IC 4CAYB 3REHB 4H9QB 4KGCD 3V9RA 4J8VA 5JRGD 4J8WC 1P3ID 5F99A 5GT0D 3AV1B 1KX4B 1AOIC 5DNND 5CPIA 4HGAB 3A6ND 4WNNA 5JA4B 5CPJC 2YFWB 1KX3C 4Z5TC 4Z66A 5BNXA 3EPKA 5B0YD 3MNNA 1A7WA 3H0LC 5DNMC 1P3GC 3AZFC 2CV5D 1HQ3C 2PYOC 1BH8B 3WAAC 3AZIA 3EPLA 3AZMC 3AZGB 1P3LB 3MVDB 4H9QA 4WZSB 4XZQB 5GXQD 3AFAA 2NQBB 1F66D 3AV2B 4WU9A 3MGSC 3REJB 1P3BD 5JA4A 4UPKA 4J8WA 3UT9A 4LD9D 1WWIA 1AOIA 4QLCC 1P3AC 3EPHA 4H9NA 3AZLC 5CPJA 3KWQD 3AZKD 1KX3A 1JFIA 3VH5A 4KHAA 5DNNB 3WTPC 3A6NB 5AV6D 2NZDD 5DNMA 1P3LA 3AZFA 2PYOA 1HQ3A 5BS7C 1T3UA 3LJAD 3NQUA 3UTBD 2F8ND 2L5AA 3W98B 3AZMA 5B0YB 3WA9C 3REKD 1P3PD 5B31A 3RELD 4WV4B 3B6GD 4WU8C 2CV5B 3TU4D 3X1VC 2J8PA 1N1JB 2DQNC 3MGQA 2LY8A 2JE5A 5C3IC 4X23D 5GXQB 5AVCD 2HIOD 1S32A 2RVQD 1F66B 5CP6C 1P34C 3AZLA 1WWSA 1U35B 1P3BB 1P3FC 3AZJD 1M19D 4LD9B 3MGRC 3W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE C;  4J8V D;  5B40 B;  3KWQ B;  3AZK B;  3KSY A;  5BS7 A;  5F99 D;  1H3O A;  3W96 C;  5CPI D;  1N1J A;  3WA9 A;  5AV6 B;  4Z66 D;  2NZD B;  3B6F C;  3MNN D;  5KDM B;  3LJA B;  3UTB B;  3X1V A;  2F8N B;  5B1L C;  5AVB A;  4EO5 C;  1P3P B;  3REL B;  4KUD B;  4E44 A;  3AZI D;  5B32 G;  3TU4 B;  4G91 C;  1TZY C;  1ID3 C;  5CP6 A;  3WTP E;  1P34 A;  5GSU C;  3X1T C;  1P3F A;  3AFA D;  5AV9 C;  5B40 A;  4UUZ B;  1M18 C;  5AVC B;  2HIO B;  4WU9 D;  1P3O C;  3B0D C;  3LEL C;  4J8W D;  3UT9 D;  2BYM A;  4H9O A;  3W96 A;  5BO0 B;  4AWL C;  1AOI D;  1M19 B;  4YS3 C;  2JSS A;  5CPJ D;  2F8N K;  4J8X C;  4G92 C;  1KX3 D;  3B6F A;  3VH6 W;  4KUD A;  5F99 B;  5CPI B;  5AY8 C;  5B1L A;  5B2J C;  4XUJ C;  4WNN B;  3LZ0 C;  1P3L D;  4ZBJ B;  3AZF D;  2PYO D;  1HQ3 D;  4Z66 B;  5BNX B;  3AZM D;  1TZY A;  3MNN B;  1ZLA C;  4NE6 A;  5B31 D;  5GSU A;  3LZ1 C;  3B0B A;  4H9R A;  3X1T A;  2ARO C;  1P3M C;  3AZI B;  5AV5 C;  1M18 A;  5BO0 A;  3MGQ D;  3AFA B;  1F1E A;  3B0C T;  1S32 D;  4YS3 A;  3AZL D;  3VH5 T;  4WU9 B;  5BNV A;  4J8W B;  3UT9 B;  1P3K C;  1AOI B;  5E5A C;  3O62 C;  3W98 D;  5AY8 A;  5B2J A;  4H9N B;  3KUY C;  5CPJ B;  3LZ0 A;  3REH C;  1KX3 B;  1JFI B;  4KHA B;  3C1C C;  1ZLA A;  3AV1 C;  3WA9 D;  5B1M A;  5DNM B;  1P3G B;  2ARO A;  3AZF B;  1HQ3 B;  2PYO B;  4NE3 A;  3X1V D;  3NQU B;  3WAA B;  5AV5 A;  5B32 C;  3AZM B;  5AVB D;  3AZE C;  3AYW C;  5B31 B;  1U35 D;  5B33 C;  1EQZ C;  5CP6 D;  1P34 D;  2F8N G;  3MGQ B;  4ZUX C;  3MGS B;  1P3F D;  5B40 D;  1P3K A;  4Z5T A;  1S32 B;  5E5A A;  3O62 A;  4QLC B;  3KUY A;  3AZL B;  1P3G A;  3C1C A;  3WAA A;  3B0C W;  3C1B C;  3KXB C;  3B6F D;  4JJN C;  4KUD D;  3NQJ A;  1H3O B;  4KGC C;  3WKJ C;  5JRG C;  5B32 A;  5B1L D;  4J8U C;  1M1A C;  5FUG A;  3AZE A;  1P3I C;  5GT0 C;  3WA9 B;  3AYW A;  3MGS A;  3A6N C;  1EQZ A;  1TZY D;  3X1V B;  4QLC A;  4ZUX A;  5GSU D;  5AVB B;  1P3A A;  3X1T D;  4DRB A;  1B67 A;  4Z2M G;  5C3I B;  2CWE A;  3AZH C;  5CP6 B;  1P34 B;  3WTP A;  1P3F B;  4YS3 D;  3X1U C;  3C1B A;  2HUE B;  3KXB A;  3MGP C;  4JJN A;  5B2I C;  2BYM B;  4H9O B;  4WU8 A;  3W96 B;  3WKJ A;  5AY8 D;  5B2J D;  4J8U A;  1M1A A;  3LZ0 D;  5B0Z C;  3UTA C;  3B6F B;  3REI C;  3KWQ C;  3AZK C;  1ZLA D;  5B1L B;  5B1M D;  3X1S C;  4EO5 B;  2ARO D;  3AN2 C;  2FJ7 C;  5AV5 D;  3AZH A;  1TZY B;  4G91 B;  4NFT A;  5B24 C;  3MGR A;  1ID3 B;  3UTB C;  5GSU B;  4H9R B;  3X1T B;  5AV9 B;  3REK C;  1M18 B;  3B6G C;  3X1U A;  1TAF A;  3B0D B;  3MGP A;  1P3K D;  4R8P C;  4Z5T D;  5B31 G;  5B2I A;  4AWL B;  3AZN C;  1KX5 C;  5E5A D;  3O62 D;  5CPK C;  1Q9C A;  5GT3 C;  4X23 C;  4YS3 B;  3KUY D;  3UTA A;  5B0Z A;  4G92 B;  5BNV B;  5DNM D;  1P3G D;  5BT1 C;  5AV8 C;  3W97 C;  3REI A;  3C1C D;  3AZJ C;  3WAA D;  5AY8 B;  5B2J B;  3X1S A;  4XUJ B;  4NE5 A;  1ID3 A;  3VH6 A;  3LZ0 B;  3AN2 A;  2FJ7 A;  5AV9 A;  4YM6 C;  4J8V C;  5B32 D;  1ZLA B;  5B24 A;  3AZE D;  5F99 C;  3AYW D;  5B1M B;  3MGS D;  1BH9 A;  1P3O A;  1EQZ D;  3LEL A;  3W99 C;  2ARO B;  1P3M B;  2F8N H;  4ZBJ C;  5AV5 B;  2IO5 C;  4QLC D;  4ZUX D;  1P3A D;  4J8X A;  4R8P A;  3AZN A;  1KX5 A;  5CPK A;  5GT3 A;  4X23 A;  3AZI C;  1HTA A;  3WTP D;  4XUJ A;  2BYK A;  5AV8 A;  3W97 A;  1P3K B;  4Z5T B;  5E5A B;  3O62 B;  3C1B D;  5G49 A;  1KX4 C;  3KUY B;  4WU9 C;  4JJN D;  4HGA C;  3LZ1 A;  4WU8 D;  4YM6 A;  3WKJ D;  1P3M A;  3UT9 C;  3C1C B;  4J8U D;  1M1A D;  3W99 A;  3NQJ B;  5B32 B;  4Z2M H;  5FUG B;  3AZE B;  4CSR A;  3AYW B;  5B33 B;  1EQZ B;  3AZG C;  1BFM A;  3AZH D;  1P3L C;  3MGR D;  3MVD C;  4XZQ C;  2NQB C;  1P3A B;  4ZUX B;  3AV2 C;  4CAY A;  3REH A;  5B31 C;  3REJ C;  3W96 D;  3X1U D;  1KX4 A;  3AV1 A;  3WTP B;  3MGP D;  3MGQ C;  3VH5 W;  5B2I D;  2YFW A;  3C1B B;  3UTA D;  5B0Z D;  1S32 C;  3KXB B;  5DNN C;  3REI D;  4JJN B;  5B33 A;  4WU8 B;  4KGC B;  3WKJ B;  5JRG B;  3X1S D;  4J8U B;  1M1A B;  1ID3 D;  1P3I B;  1BH8 A;  5GT0 B;  3W98 C;  3AN2 D;  2FJ7 D;  5B0Y C;  5AV9 D;  3AZG A;  2YFV B;  1M18 D;  5B24 D;  3MVD A;  4XZQ A;  2NQB A;  2CV5 C;  1P3O D;  1KU5 A;  3AV2 A;  3LEL D;  3REJ A;  3AZH B;  3MGR B;  5GXQ C;  4J8X D;  1B6W A;  1F66 C;  4R8P D;  5AVB C;  3AZN D;  1KX5 D;  1U35 C;  5CPK D;  1P3B C;  5GT3 D;  4KGC A;  3X1U B;  5JRG A;  1TAF B;  4XUJ D;  4LD9 C;  1P3I A;  5GT0 A;  3MGP B;  5BT1 D;  5DNN A;  5AV8 D;  3W97 D;  5B2I B;  3A6N A;  3VH6 T;  5B40 C;  2YFV A;  3UTA B;  5B0Z B;  3LZ1 D;  5B0Y A;  4YM6 D;  3REI B;  1P3M D;  5AV6 C;  4H9S C;  2NZD C;  3X1S B;  2CV5 A;  3LJA C;  3W99 D;  3AN2 B;  2FJ7 B;  1P3P C;  3REL C;  5B24 B;  4KUD C;  5GXQ A;  3TU4 C;  1BH9 B;  1P3O B;  1F66 A;  3LEL B;  3REK B;  3R45 B;  1U35 A;  1P3B A;  3B6G B;  1ULY A;  4LD9 A;  5AVC C;  4J8X B;  2HIO C;  3REH D;  2RVQ C;  4R8P B;  3AZN B;  4E45 A;  4H9P B;  1KX5 B;  3KWQ A;  3AZK A;  5CPK B;  5GT3 B;  4X23 B;  1KX4 D;  3AV1 D;  5CHL B;  1M19 C;  2BYK B;  5AV8 B;  3W97 B;  5AV6 A;  3AZJ B;  4H9S A;  4M6B A;  2NZD A;  5G49 B;  3LJA A;  5KDM A;  3UTB A;  2F8N A;  5CPI C;  5B33 D;  3LZ1 B;  4YM6 B;  3V9R B;  4J8V B;  3REK A;  1P3P A;  3R45 A;  4DRA A;  3REL A;  4Z66 C;  3B6G A;  3TU4 A;  3MNN C;  3AZG D;  3W99 B;  3MVD D;  4XZQ D;  2NQB D;  4H9P A;  2IO5 B;  4UUZ A;  4CSR B;  3AV2 D;  5AVC A;  2HIO A;  5B1M C;  3REJ D;  3AFA C;  3AZJ A;  1R4V A;  3KXB D;  1M19 A;  4CAY B;  3REH B;  4H9Q B;  4KGC D;  3V9R A;  4J8V A;  5JRG D;  4J8W C;  1P3I D;  5F99 A;  5GT0 D;  3AV1 B;  1KX4 B;  1AOI C;  5DNN D;  5CPI A;  4HGA B;  3A6N D;  4WNN A;  5JA4 B;  5CPJ C;  2YFW B;  1KX3 C;  4Z5T C;  4Z66 A;  5BNX A;  5B0Y D;  3MNN A;  1A7W A;  5DNM C;  1P3G C;  3AZF C;  2CV5 D;  1HQ3 C;  2PYO C;  1BH8 B;  3WAA C;  3AZI A;  3AZM C;  3AZG B;  1P3L B;  3MVD B;  4H9Q A;  4WZS B;  4XZQ B;  5GXQ D;  3AFA A;  2NQB B;  1F66 D;  3AV2 B;  4WU9 A;  3MGS C;  3REJ B;  1P3B D;  5JA4 A;  4J8W A;  3UT9 A;  4LD9 D;  1WWI A;  1AOI A;  4QLC C;  1P3A C;  4H9N A;  3AZL C;  5CPJ A;  3KWQ D;  3AZK D;  1KX3 A;  1JFI A;  3VH5 A;  4KHA A;  5DNN B;  3WTP C;  3A6N B;  5AV6 D;  2NZD D;  5DNM A;  1P3L A;  3AZF A;  2PYO A;  1HQ3 A;  5BS7 C;  3LJA D;  3NQU A;  3UTB D;  2F8N D;  2L5A A;  3W98 B;  3AZM A;  5B0Y B;  3WA9 C;  3REK D;  1P3P D;  5B31 A;  3REL D;  4WV4 B;  3B6G D;  4WU8 C;  2CV5 B;  3TU4 D;  3X1V C;  1N1J B;  3MGQ A;  2LY8 A;  5C3I C;  4X23 D;  5GXQ B;  5AVC D;  2HIO D;  1S32 A;  2RVQ D;  1F66 B;  5CP6 C;  1P34 C;  3AZL A;  1WWS A;  1U35 B;  1P3B B;  1P3F C;  3AZJ D;  1M19 D;  4LD9 B;  3MGR C;  3W98 A; 
#chains in the Genus database with same CATH topology
 3FDD A;  2HUE C;  4J8V D;  5B40 B;  3KWQ B;  3AZK B;  3KSY A;  5BS7 A;  5F99 D;  1H3O A;  3W96 C;  5CPI D;  1N1J A;  3WA9 A;  3KFU G;  5AV6 B;  4Z66 D;  2NZD B;  3B6F C;  3MNN D;  5KDM B;  3LJA B;  3UTB B;  3X1V A;  2F8N B;  5B1L C;  5AVB A;  4EO5 C;  1P3P B;  3REL B;  4KUD B;  4E44 A;  3AZI D;  5B32 G;  3AL0 C;  3TU4 B;  1TZY C;  4G91 C;  1ID3 C;  5CP6 A;  3WTP E;  1P34 A;  5GSU C;  3X1T C;  1P3F A;  3AFA D;  5AV9 C;  5B40 A;  4UUZ B;  1M18 C;  5AVC B;  2HIO B;  4WU9 D;  1P3O C;  3B0D C;  3LEL C;  4J8W D;  3UT9 D;  2G5H C;  2BYM A;  4H9O A;  3W96 A;  5BO0 B;  4AWL C;  1AOI D;  1M19 B;  4YS3 C;  2JSS A;  5CPJ D;  2F8N K;  4J8X C;  4G92 C;  1KX3 D;  2Y2Q A;  3B6F A;  3VH6 W;  2FFF B;  4KUD A;  5F99 B;  5CPI B;  5AY8 C;  5B1L A;  5B2J C;  4XUJ C;  4WNN B;  3LZ0 C;  1P3L D;  4ZBJ B;  3AZF D;  2PYO D;  1HQ3 D;  4Z66 B;  5BNX B;  2ZY3 A;  3AZM D;  1TZY A;  3MNN B;  1ZLA C;  4NE6 A;  5B31 D;  5GSU A;  3LZ1 C;  3B0B A;  2DF4 C;  4H9R A;  3X1T A;  2ARO C;  1P3M C;  3AZI B;  5AV5 C;  1M18 A;  5BO0 A;  3MGQ D;  3AFA B;  1F1E A;  3B0C T;  1S32 D;  4YS3 A;  3AZL D;  3VH5 T;  4WU9 B;  3EPJ A;  5BNV A;  4J8W B;  3UT9 B;  1P3K C;  1AOI B;  5E5A C;  3O62 C;  3W98 D;  5AY8 A;  5B2J A;  4H9N B;  3KUY C;  5CPJ B;  3LZ0 A;  3REH C;  1KX3 B;  1JFI B;  4KHA B;  3C1C C;  1ZLA A;  3AV1 C;  3WA9 D;  5B1M A;  5DNM B;  1P3G B;  2ARO A;  3AZF B;  1HQ3 B;  2PYO B;  4NE3 A;  3X1V D;  3NQU B;  3WAA B;  5AV5 A;  5B32 C;  3AZM B;  5AVB D;  3AZE C;  1PZR A;  3AYW C;  5B31 B;  1U35 D;  5B33 C;  1EQZ C;  5CP6 D;  1P34 D;  2F8N G;  2Y2K A;  3MGQ B;  4ZUX C;  3MGS B;  1P3F D;  5B40 D;  1P3K A;  4Z5T A;  1Z2C B;  1S32 B;  5E5A A;  3O62 A;  4QLC B;  3KUY A;  3AZL B;  2ZY4 A;  1P3G A;  3C1C A;  3WAA A;  3B0C W;  3C1B C;  2JCH A;  3KXB C;  3B6F D;  4JJN C;  4KUD D;  3NQJ A;  1H3O B;  4KGC C;  3WKJ C;  5JRG C;  5B32 A;  5B1L D;  4J8U C;  1M1A C;  5FUG A;  3AZE A;  1P3I C;  5GT0 C;  3WA9 B;  3AYW A;  3MGS A;  3A6N C;  1EQZ A;  3P5J B;  1TZY D;  3X1V B;  4QLC A;  4ZUX A;  5GSU D;  5AVB B;  1P3A A;  3X1T D;  4DRB A;  1B67 A;  4Z2M G;  5C3I B;  3H0R C;  2CWE A;  3AZH C;  5CP6 B;  3A1K A;  1P34 B;  3WTP A;  1P3F B;  2UWX A;  4YS3 D;  3X1U C;  3C1B A;  2Y2O A;  2ZY5 A;  2HUE B;  3KXB A;  3MGP C;  4JJN A;  2Y2P A;  5B2I C;  2BYM B;  4H9O B;  4WU8 A;  3W96 B;  3WKJ A;  5AY8 D;  5B2J D;  4J8U A;  1M1A A;  3LZ0 D;  5B0Z C;  3UTA C;  3B6F B;  3REI C;  3KWQ C;  3AZK C;  1ZLA D;  5B1L B;  5B1M D;  3X1S C;  4EO5 B;  2ARO D;  3AN2 C;  2FJ7 C;  5AV5 D;  3AZH A;  1TZY B;  4G91 B;  4NFT A;  5B24 C;  3MGR A;  1ID3 B;  3UTB C;  1W2E A;  5GSU B;  4H9R B;  3X1T B;  5AV9 B;  3REK C;  2W8S A;  1M18 B;  3B6G C;  3X1U A;  1TAF A;  3IP4 C;  3B0D B;  3MGP A;  1P3K D;  4R8P C;  4Z5T D;  5B31 G;  5B2I A;  4AWL B;  3AZN C;  1KX5 C;  5E5A D;  3O62 D;  5CPK C;  1Q9C A;  5GT3 C;  4X23 C;  4YS3 B;  3KUY D;  3UTA A;  5B0Z A;  4G92 B;  5BNV B;  5DNM D;  1P3G D;  5BT1 C;  5AV8 C;  3W97 C;  3REI A;  4WJ3 C;  3C1C D;  3AZJ C;  3WAA D;  2Y2N A;  2Y2L A;  5AY8 B;  5B2J B;  3X1S A;  4XUJ B;  4NE5 A;  1ID3 A;  3VH6 A;  3LZ0 B;  3AN2 A;  2Y2M A;  2FJ7 A;  3H0M C;  5AV9 A;  4YM6 C;  4J8V C;  5B32 D;  1ZLA B;  5B24 A;  3AZE D;  5F99 C;  3AYW D;  5B1M B;  3MGS D;  1BH9 A;  1P3O A;  1EQZ D;  3LEL A;  3W99 C;  2ARO B;  1P3M B;  2F8N H;  4ZBJ C;  5AV5 B;  2XD1 A;  2IO5 C;  4QLC D;  4ZUX D;  1P3A D;  4J8X A;  2VQR A;  4R8P A;  3AZN A;  1KX5 A;  5CPK A;  5GT3 A;  4X23 A;  3AZI C;  1HTA A;  3WTP D;  4XUJ A;  2BYK A;  3F6T A;  5AV8 A;  3W97 A;  1P3K B;  4Z5T B;  5E5A B;  3O62 B;  3C1B D;  5G49 A;  1KX4 C;  3KUY B;  3A1I A;  4WU9 C;  4JJN D;  4HGA C;  3LZ1 A;  4WU8 D;  4YM6 A;  3WKJ D;  1P3M A;  3UT9 C;  3C1C B;  4J8U D;  1M1A D;  3W99 A;  3NQJ B;  5B32 B;  4Z2M H;  5FUG B;  3AZE B;  4CSR A;  3AYW B;  5B33 B;  1EQZ B;  3AZG C;  1BFM A;  3AZH D;  1P3L C;  3MGR D;  3MVD C;  4XZQ C;  2NQB C;  1P3A B;  4ZUX B;  3AV2 C;  4CAY A;  3REH A;  5B31 C;  3REJ C;  3W96 D;  2ZM5 A;  3X1U D;  1KX4 A;  3AV1 A;  3WTP B;  3MGP D;  4DQY B;  3MGQ C;  3VH5 W;  5B2I D;  2YFW A;  3C1B B;  3UTA D;  5B0Z D;  1S32 C;  3KXB B;  5DNN C;  3REI D;  4JJN B;  2ZY2 A;  5B33 A;  4WU8 B;  4KGC B;  3WKJ B;  5JRG B;  3X1S D;  4J8U B;  1M1A B;  1ID3 D;  1P3I B;  1BH8 A;  5GT0 B;  3W98 C;  3AN2 D;  2FJ7 D;  5B0Y C;  5AV9 D;  3AZG A;  2YFV B;  1M18 D;  5B24 D;  3MVD A;  4XZQ A;  2NQB A;  2XD5 A;  2CV5 C;  1P3O D;  1KU5 A;  3AV2 A;  3LEL D;  2Y2G A;  3REJ A;  3AZH B;  3MGR B;  5GXQ C;  4J8X D;  2Y2I A;  1B6W A;  1F66 C;  4R8P D;  5AVB C;  3AZN D;  1KX5 D;  1U35 C;  5CPK D;  1P3B C;  5GT3 D;  4KGC A;  3X1U B;  5JRG A;  1TAF B;  4XUJ D;  4LD9 C;  1P3I A;  5GT0 A;  3MGP B;  5BT1 D;  5DNN A;  5AV8 D;  3W97 D;  5B2I B;  3A6N A;  3VH6 T;  5B40 C;  2YFV A;  3UTA B;  5B0Z B;  3LZ1 D;  5B0Y A;  4YM6 D;  3REI B;  1P3M D;  5AV6 C;  4H9S C;  2NZD C;  3X1S B;  2CV5 A;  3LJA C;  2Y2J A;  3W99 D;  3AN2 B;  2FJ7 B;  1P3P C;  3REL C;  5B24 B;  4KUD C;  5GXQ A;  3TU4 C;  1BH9 B;  1P3O B;  1F66 A;  3LEL B;  3REK B;  3R45 B;  1U35 A;  1P3B A;  3B6G B;  3EG5 B;  2F2A C;  1ULY A;  4LD9 A;  5AVC C;  4J8X B;  2HIO C;  3REH D;  2RVQ C;  4R8P B;  3AZN B;  4E45 A;  4H9P B;  1KX5 B;  2RIQ A;  3KWQ A;  3AZK A;  5GT3 B;  4X23 B;  5CPK B;  1KX4 D;  3AV1 D;  5CHL B;  1M19 C;  2BYK B;  5AV8 B;  3W97 B;  5AV6 A;  3AZJ B;  4H9S A;  4M6B A;  2NZD A;  5G49 B;  3LJA A;  5KDM A;  3UTB A;  2F8N A;  5CPI C;  5B33 D;  3LZ1 B;  4YM6 B;  3V9R B;  4J8V B;  3REK A;  1P3P A;  2BG1 A;  3R45 A;  4DRA A;  3REL A;  4Z66 C;  3B6G A;  3TU4 A;  3MNN C;  3AZG D;  3W99 B;  3MVD D;  4XZQ D;  2NQB D;  4H9P A;  2IO5 B;  4UUZ A;  4CSR B;  3AV2 D;  5AVC A;  2HIO A;  5B1M C;  2Y2H A;  3REJ D;  3AFA C;  3AZJ A;  1R4V A;  3KXB D;  1M19 A;  2G5I C;  4CAY B;  3REH B;  4H9Q B;  4KGC D;  3V9R A;  4J8V A;  5JRG D;  4J8W C;  1P3I D;  5F99 A;  5GT0 D;  3AV1 B;  1KX4 B;  1AOI C;  5DNN D;  5CPI A;  4HGA B;  3A6N D;  4WNN A;  5JA4 B;  5CPJ C;  2YFW B;  1KX3 C;  4Z5T C;  4Z66 A;  5BNX A;  3EPK A;  5B0Y D;  3MNN A;  1A7W A;  3H0L C;  5DNM C;  1P3G C;  3AZF C;  2CV5 D;  1HQ3 C;  2PYO C;  1BH8 B;  3WAA C;  3AZI A;  3EPL A;  3AZM C;  3AZG B;  1P3L B;  3MVD B;  4H9Q A;  4WZS B;  4XZQ B;  5GXQ D;  3AFA A;  2NQB B;  1F66 D;  3AV2 B;  4WU9 A;  3MGS C;  3REJ B;  1P3B D;  5JA4 A;  4UPK A;  4J8W A;  3UT9 A;  4LD9 D;  1WWI A;  1AOI A;  4QLC C;  1P3A C;  3EPH A;  4H9N A;  3AZL C;  5CPJ A;  3KWQ D;  3AZK D;  1KX3 A;  1JFI A;  3VH5 A;  4KHA A;  5DNN B;  3WTP C;  3A6N B;  5AV6 D;  2NZD D;  5DNM A;  1P3L A;  3AZF A;  2PYO A;  1HQ3 A;  5BS7 C;  1T3U A;  3LJA D;  3NQU A;  3UTB D;  2F8N D;  2L5A A;  3W98 B;  3AZM A;  5B0Y B;  3WA9 C;  3REK D;  1P3P D;  5B31 A;  3REL D;  4WV4 B;  3B6G D;  4WU8 C;  2CV5 B;  3TU4 D;  3X1V C;  2J8P A;  1N1J B;  2DQN C;  3MGQ A;  2LY8 A;  2JE5 A;  5C3I C;  4X23 D;  5GXQ B;  5AVC D;  2HIO D;  1S32 A;  2RVQ D;  1F66 B;  5CP6 C;  1P34 C;  3AZL A;  1WWS A;  1U35 B;  1P3B B;  1P3F C;  3AZJ D;  1M19 D;  4LD9 B;  3MGR C;  3W98 A; 
#chains in the Genus database with same CATH homology
 3FDD A;  2HUE C;  4J8V D;  5B40 B;  3KWQ B;  3AZK B;  3KSY A;  5BS7 A;  5F99 D;  1H3O A;  3W96 C;  5CPI D;  1N1J A;  3WA9 A;  3KFU G;  5AV6 B;  4Z66 D;  2NZD B;  3B6F C;  3MNN D;  5KDM B;  3LJA B;  3UTB B;  3X1V A;  2F8N B;  5B1L C;  5AVB A;  4EO5 C;  1P3P B;  3REL B;  4KUD B;  4E44 A;  3AZI D;  5B32 G;  3AL0 C;  3TU4 B;  1TZY C;  4G91 C;  1ID3 C;  5CP6 A;  3WTP E;  1P34 A;  5GSU C;  3X1T C;  1P3F A;  3AFA D;  5AV9 C;  5B40 A;  4UUZ B;  1M18 C;  5AVC B;  2HIO B;  4WU9 D;  1P3O C;  3B0D C;  3LEL C;  4J8W D;  3UT9 D;  2G5H C;  2BYM A;  4H9O A;  3W96 A;  5BO0 B;  4AWL C;  1AOI D;  1M19 B;  4YS3 C;  2JSS A;  5CPJ D;  2F8N K;  4J8X C;  4G92 C;  1KX3 D;  2Y2Q A;  3B6F A;  3VH6 W;  2FFF B;  4KUD A;  5F99 B;  5CPI B;  5AY8 C;  5B1L A;  5B2J C;  4XUJ C;  4WNN B;  3LZ0 C;  1P3L D;  4ZBJ B;  3AZF D;  2PYO D;  1HQ3 D;  4Z66 B;  5BNX B;  2ZY3 A;  3AZM D;  1TZY A;  3MNN B;  1ZLA C;  4NE6 A;  5B31 D;  5GSU A;  3LZ1 C;  3B0B A;  2DF4 C;  4H9R A;  3X1T A;  2ARO C;  1P3M C;  3AZI B;  5AV5 C;  1M18 A;  5BO0 A;  3MGQ D;  3AFA B;  1F1E A;  3B0C T;  1S32 D;  4YS3 A;  3AZL D;  3VH5 T;  4WU9 B;  3EPJ A;  5BNV A;  4J8W B;  3UT9 B;  1P3K C;  1AOI B;  5E5A C;  3O62 C;  3W98 D;  5AY8 A;  5B2J A;  4H9N B;  3KUY C;  5CPJ B;  3LZ0 A;  3REH C;  1KX3 B;  1JFI B;  4KHA B;  3C1C C;  1ZLA A;  3AV1 C;  3WA9 D;  5B1M A;  5DNM B;  1P3G B;  2ARO A;  3AZF B;  1HQ3 B;  2PYO B;  4NE3 A;  3X1V D;  3NQU B;  3WAA B;  5AV5 A;  5B32 C;  3AZM B;  5AVB D;  3AZE C;  1PZR A;  3AYW C;  5B31 B;  1U35 D;  5B33 C;  1EQZ C;  5CP6 D;  1P34 D;  2F8N G;  2Y2K A;  3MGQ B;  4ZUX C;  3MGS B;  1P3F D;  5B40 D;  1P3K A;  4Z5T A;  1Z2C B;  1S32 B;  5E5A A;  3O62 A;  4QLC B;  3KUY A;  3AZL B;  2ZY4 A;  1P3G A;  3C1C A;  3WAA A;  3B0C W;  3C1B C;  2JCH A;  3KXB C;  3B6F D;  4JJN C;  4KUD D;  3NQJ A;  1H3O B;  4KGC C;  3WKJ C;  5JRG C;  5B32 A;  5B1L D;  4J8U C;  1M1A C;  5FUG A;  3AZE A;  1P3I C;  5GT0 C;  3WA9 B;  3AYW A;  3MGS A;  3A6N C;  1EQZ A;  3P5J B;  1TZY D;  3X1V B;  4QLC A;  4ZUX A;  5GSU D;  5AVB B;  1P3A A;  3X1T D;  4DRB A;  1B67 A;  4Z2M G;  5C3I B;  3H0R C;  2CWE A;  3AZH C;  5CP6 B;  3A1K A;  1P34 B;  3WTP A;  1P3F B;  2UWX A;  4YS3 D;  3X1U C;  3C1B A;  2Y2O A;  2ZY5 A;  2HUE B;  3KXB A;  3MGP C;  4JJN A;  2Y2P A;  5B2I C;  2BYM B;  4H9O B;  4WU8 A;  3W96 B;  3WKJ A;  5AY8 D;  5B2J D;  4J8U A;  1M1A A;  3LZ0 D;  5B0Z C;  3UTA C;  3B6F B;  3REI C;  3KWQ C;  3AZK C;  1ZLA D;  5B1L B;  5B1M D;  3X1S C;  4EO5 B;  2ARO D;  3AN2 C;  2FJ7 C;  5AV5 D;  3AZH A;  1TZY B;  4G91 B;  4NFT A;  5B24 C;  3MGR A;  1ID3 B;  3UTB C;  1W2E A;  5GSU B;  4H9R B;  3X1T B;  5AV9 B;  3REK C;  2W8S A;  1M18 B;  3B6G C;  3X1U A;  1TAF A;  3IP4 C;  3B0D B;  3MGP A;  1P3K D;  4R8P C;  4Z5T D;  5B31 G;  5B2I A;  4AWL B;  3AZN C;  1KX5 C;  5E5A D;  3O62 D;  5CPK C;  1Q9C A;  5GT3 C;  4X23 C;  4YS3 B;  3KUY D;  3UTA A;  5B0Z A;  4G92 B;  5BNV B;  5DNM D;  1P3G D;  5BT1 C;  5AV8 C;  3W97 C;  3REI A;  4WJ3 C;  3C1C D;  3AZJ C;  3WAA D;  2Y2N A;  2Y2L A;  5AY8 B;  5B2J B;  3X1S A;  4XUJ B;  4NE5 A;  1ID3 A;  3VH6 A;  3LZ0 B;  3AN2 A;  2Y2M A;  2FJ7 A;  3H0M C;  5AV9 A;  4YM6 C;  4J8V C;  5B32 D;  1ZLA B;  5B24 A;  3AZE D;  5F99 C;  3AYW D;  5B1M B;  3MGS D;  1BH9 A;  1P3O A;  1EQZ D;  3LEL A;  3W99 C;  2ARO B;  1P3M B;  2F8N H;  4ZBJ C;  5AV5 B;  2XD1 A;  2IO5 C;  4QLC D;  4ZUX D;  1P3A D;  4J8X A;  2VQR A;  4R8P A;  3AZN A;  1KX5 A;  5CPK A;  5GT3 A;  4X23 A;  3AZI C;  1HTA A;  3WTP D;  4XUJ A;  2BYK A;  3F6T A;  5AV8 A;  3W97 A;  1P3K B;  4Z5T B;  5E5A B;  3O62 B;  3C1B D;  5G49 A;  1KX4 C;  3KUY B;  3A1I A;  4WU9 C;  4JJN D;  4HGA C;  3LZ1 A;  4WU8 D;  4YM6 A;  3WKJ D;  1P3M A;  3UT9 C;  3C1C B;  4J8U D;  1M1A D;  3W99 A;  3NQJ B;  5B32 B;  4Z2M H;  5FUG B;  3AZE B;  4CSR A;  3AYW B;  5B33 B;  1EQZ B;  3AZG C;  1BFM A;  3AZH D;  1P3L C;  3MGR D;  3MVD C;  4XZQ C;  2NQB C;  1P3A B;  4ZUX B;  3AV2 C;  4CAY A;  3REH A;  5B31 C;  3REJ C;  3W96 D;  2ZM5 A;  3X1U D;  1KX4 A;  3AV1 A;  3WTP B;  3MGP D;  4DQY B;  3MGQ C;  3VH5 W;  5B2I D;  2YFW A;  3C1B B;  3UTA D;  5B0Z D;  1S32 C;  3KXB B;  5DNN C;  3REI D;  4JJN B;  2ZY2 A;  5B33 A;  4WU8 B;  4KGC B;  3WKJ B;  5JRG B;  3X1S D;  4J8U B;  1M1A B;  1ID3 D;  1P3I B;  1BH8 A;  5GT0 B;  3W98 C;  3AN2 D;  2FJ7 D;  5B0Y C;  5AV9 D;  3AZG A;  2YFV B;  1M18 D;  5B24 D;  3MVD A;  4XZQ A;  2NQB A;  2XD5 A;  2CV5 C;  1P3O D;  1KU5 A;  3AV2 A;  3LEL D;  2Y2G A;  3REJ A;  3AZH B;  3MGR B;  5GXQ C;  4J8X D;  2Y2I A;  1B6W A;  1F66 C;  4R8P D;  5AVB C;  3AZN D;  1KX5 D;  1U35 C;  5CPK D;  1P3B C;  5GT3 D;  4KGC A;  3X1U B;  5JRG A;  1TAF B;  4XUJ D;  4LD9 C;  1P3I A;  5GT0 A;  3MGP B;  5BT1 D;  5DNN A;  5AV8 D;  3W97 D;  5B2I B;  3A6N A;  3VH6 T;  5B40 C;  2YFV A;  3UTA B;  5B0Z B;  3LZ1 D;  5B0Y A;  4YM6 D;  3REI B;  1P3M D;  5AV6 C;  4H9S C;  2NZD C;  3X1S B;  2CV5 A;  3LJA C;  2Y2J A;  3W99 D;  3AN2 B;  2FJ7 B;  1P3P C;  3REL C;  5B24 B;  4KUD C;  5GXQ A;  3TU4 C;  1BH9 B;  1P3O B;  1F66 A;  3LEL B;  3REK B;  3R45 B;  1U35 A;  1P3B A;  3B6G B;  3EG5 B;  2F2A C;  1ULY A;  4LD9 A;  5AVC C;  4J8X B;  2HIO C;  3REH D;  2RVQ C;  4R8P B;  3AZN B;  4E45 A;  4H9P B;  1KX5 B;  2RIQ A;  3KWQ A;  3AZK A;  5GT3 B;  4X23 B;  5CPK B;  1KX4 D;  3AV1 D;  5CHL B;  1M19 C;  2BYK B;  5AV8 B;  3W97 B;  5AV6 A;  3AZJ B;  4H9S A;  4M6B A;  2NZD A;  5G49 B;  3LJA A;  5KDM A;  3UTB A;  2F8N A;  5CPI C;  5B33 D;  3LZ1 B;  4YM6 B;  3V9R B;  4J8V B;  3REK A;  1P3P A;  2BG1 A;  3R45 A;  4DRA A;  3REL A;  4Z66 C;  3B6G A;  3TU4 A;  3MNN C;  3AZG D;  3W99 B;  3MVD D;  4XZQ D;  2NQB D;  4H9P A;  2IO5 B;  4UUZ A;  4CSR B;  3AV2 D;  5AVC A;  2HIO A;  5B1M C;  2Y2H A;  3REJ D;  3AFA C;  3AZJ A;  1R4V A;  3KXB D;  1M19 A;  2G5I C;  4CAY B;  3REH B;  4H9Q B;  4KGC D;  3V9R A;  4J8V A;  5JRG D;  4J8W C;  1P3I D;  5F99 A;  5GT0 D;  3AV1 B;  1KX4 B;  1AOI C;  5DNN D;  5CPI A;  4HGA B;  3A6N D;  4WNN A;  5JA4 B;  5CPJ C;  2YFW B;  1KX3 C;  4Z5T C;  4Z66 A;  5BNX A;  3EPK A;  5B0Y D;  3MNN A;  1A7W A;  3H0L C;  5DNM C;  1P3G C;  3AZF C;  2CV5 D;  1HQ3 C;  2PYO C;  1BH8 B;  3WAA C;  3AZI A;  3EPL A;  3AZM C;  3AZG B;  1P3L B;  3MVD B;  4H9Q A;  4WZS B;  4XZQ B;  5GXQ D;  3AFA A;  2NQB B;  1F66 D;  3AV2 B;  4WU9 A;  3MGS C;  3REJ B;  1P3B D;  5JA4 A;  4UPK A;  4J8W A;  3UT9 A;  4LD9 D;  1WWI A;  1AOI A;  4QLC C;  1P3A C;  3EPH A;  4H9N A;  3AZL C;  5CPJ A;  3KWQ D;  3AZK D;  1KX3 A;  1JFI A;  3VH5 A;  4KHA A;  5DNN B;  3WTP C;  3A6N B;  5AV6 D;  2NZD D;  5DNM A;  1P3L A;  3AZF A;  2PYO A;  1HQ3 A;  5BS7 C;  1T3U A;  3LJA D;  3NQU A;  3UTB D;  2F8N D;  2L5A A;  3W98 B;  3AZM A;  5B0Y B;  3WA9 C;  3REK D;  1P3P D;  5B31 A;  3REL D;  4WV4 B;  3B6G D;  4WU8 C;  2CV5 B;  3TU4 D;  3X1V C;  2J8P A;  1N1J B;  2DQN C;  3MGQ A;  2LY8 A;  2JE5 A;  5C3I C;  4X23 D;  5GXQ B;  5AVC D;  2HIO D;  1S32 A;  2RVQ D;  1F66 B;  5CP6 C;  1P34 C;  3AZL A;  1WWS A;  1U35 B;  1P3B B;  1P3F C;  3AZJ D;  1M19 D;  4LD9 B;  3MGR C;  3W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...