3C1CB

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cB00
4WV4B 5AV8C 3AV1A 1S32D 2HUEB 5AV5B 3VH6A 4KGCA 1F66B 5BS7A 3W98D 3REJD 1P3GB 3B6GD 3O62C 3UT9C 4H9NB 4YM6C 4J8WC 4M6BA 5BO0A 3AYWC 1ID3D 2NQBC 2CV5A 3AZEB 2AROC 3MGSD 5GT3A 3KUYB 5B0ZB 2HIOA 2IO5C 5B33D 4ZUXB 1U35D 2CWEA 4WNNA 5GSUC 5DNNB 3X1UC 4CAYB 1P3MD 3LZ1B 4EO5B 4YS3C 5AV8B 3A6NA 3MVDB 1F66D 1BH9A 4WU8C 3X1TD 1TAFB 3WTPB 3O62B 3UT9B 4YM6B 3AYWB 1F1EA 3AZFD 2NQBB 5CP6C 1AOIC 1ZLAA 4KUDD 3AZJA 3AN2A 1P3OC 1KX5D 5C3IC 3KUYD 5B0ZD 4H9PA 2IO5B 4ZUXD 1ULYA 4AWLC 5CHLB 2BYMA 3VH6T 5GSUB 3X1UB 5AV9C 3AZHA 4YS3B 3MVDD 3W96A 5AV5A 5B31B 5AVCA 1P3GA 3WTPD 3MGPA 5CP6B 1P3KD 3KWQC 1P3OB 3B0BA 4Z5TC 1TZYA 5B40C 3AZEA 4Z66A 4G91C 3AFAA 2YFVB 5DNNA 4CAYA 3B0CT 5JRGD 3LZ1A 5AV8A 1BFMA 5DNMB 5B31D 4NE3A 1TAFA 3O62A 5CPKD 3UT9A 4YM6A 4J8WA 3AYWA 2NQBA 4QLCB 4X23C 3KWQB 1HQ3D 3REIB 5CPIB 1P34C 5B40B 2AROA 4G91B 3B6FB 3TU4B 5BNVB 3RELC 2F8ND 5GSUA 3VH6W 3KXBD 4WU9C 3X1UA 2PYOC 1EQZD 3WKJC 2NZDC 3REHC 4YS3A 4JJNB 2BYKA 3R45B 5DNMD 3AV2B 3MGRB 2YFWB 4WU8A 3UTBA 5B0YD 4QLCD 3REID 5CP6A 4X23B 5CPID 5GT0C 1P34B 1AOIA 3W97C 1P3OA 3B6FD 1S32C 3TU4D 3WAAB 2YFVA 4WU9B 3W98C 3REJC 5GXQB 5AV9A 3B6GC 2NZDB 3B0CW 4JJND 1ID3C 3AV2D 3MGRD 3UTAD 3MGSC 5AY8B 1U35C 5B33C 1P3PD 1P3LB 3W97B 5FUGB 5GT0B 3KWQA 4KHAB 5KDMB 1P3MC 1M19D 4Z5TA 1P3AB 3NQUA 5B40A 3X1VB 5B32B 3WAAD 1F66C 5BNVA 5GXQD 3W98B 3X1TC 1KX3B 3AZFC 3WA9B 3KSYA 4KUDC 4CSRB 4R8PB 1N1JB 5JA4A 1M1AB 1KX5C 5B1LB 3MGSB 3KUYC 5B0ZC 5AY8D 3AZGD 2F8NH 4ZUXC 4LD9B 1P3IB 5B1MB 1P3LD 4X23A 3MNNB 5E5AB 1P34A 1P3AD 1P3MB 3AV1D 3X1VD 5B32D 3MVDC 3AZNB 3C1BB 3RELA 3AZMD 1KX3D 4WU9A 3X1TB 4J8VD 4H9QB 3WTPC 2PYOA 3WKJA 3WA9D 3AZFB 1KX4B 3REHA 2NZDA 5B24A 4KUDB 1P3KC 4R8PD 1M1AD 5B2IB 5B1LD 1KX5B 5B2JD 4LD9D 3MGQD 1P3ID 5B1MD 3V9RA 4XUJB 3W97A 3MNND 5E5AD 5FUGA 5GT0A 3B0DB 5KDMA 5JRGC 1P3FD 3AZND 2RVQD 1S32A 3C1BD 5B31C 4H9SA 3W98A 3REJA 1KX4D 3B6GA 1ZLAD 1P3KB 1ID3A 1HQ3C 5B2ID 4H9RA 3AZIB 3MGSA 1U35A 4XUJD 5B33A 3KXBC 5JRGB 1P3MA 1EQZC 1H3OB 5DNMC 5AVBB 1F66A 3X1TA 5CPKB 4H9NA 5B0YC 4QLCC 3REIC 5CPIC 1HQ3B 1R4VA 1KX5A 3B6FC 3AZID 3KUYA 5B0ZA 3TU4C 4ZUXA 2F8NB 1M18D 3KXBB 4J8XB 4Z2MG 1EQZB 1P3BD 4JJNC 3MVDA 5AVBD 3AV2C 3MGRC 5BT1D 3UTAC 5F99D 3LELB 3WTPA 1P3PC 4J8WD 5B0YB 1BH8B 1P3KA 3C1CD 5AV6B 4NE6A 1JFIB 3WAAC 5GXQC 4J8XD 3X1SB 5JRGA 1Q9CA 3LJAB 1H3OA 5B31A 3UTAB 3LELD 5AY8C 3AZGC 3UTBD 1P3PB 1P3LC 3REKD 1HQ3A 4XZQD 1P3AC 5AV6D 1M19B 1B67A 3X1VC 3AV1C 5B32C 3LZ0D 5CPJB 2F8NA 4J8UB 3AZKB 3AZMC 1KX3C 3KXBA 3X1SD 4J8VC 1EQZA 2FJ7D 3LJAD 3WA9C 3W99B 4R8PC 1M1AC 5DNMA 5B1LC 5B2JC 3AZGB 4LD9C 3MGQC 1P3IC 5B1MC 5B0YA 4QLCA 3MNNC 3REIA 5E5AC 5CPIA 1P3FC 3AV1B 3AZNC 3B6FA 2RVQC 3C1BC 3TU4A 5CPJD 2F8NK 4J8UD 3AZKD 3AZMB 4J8VB 3W99D 1KX4C 4DRBA 1ZLAC 4JJNA 3R45A 2CV5B 1WWIA 5B2IC 3NQJB 3AV2A 3MGRA 5GT3B 5B2JB 2YFWA 2HIOB 3MGQB 4XUJC 3AZLD 1WWSA 3B0DC 1P3FB 4KGCD 3WAAA 1BH9B 3VH5A 5GXQA 1ZLAB 5B24D 3AN2B 2CV5D 4NFTA 5GT3D 2HIOD 4H9PB 3AZIC 5AY8A 3AZGA 2BYMB 1P3LA 1M18C 4KHAA 1P3BC 4DRAA 3A6ND 1P3AA 3X1VA 5B32A 3W96B 5AVBC 4E45A 5BT1C 5AVCB 3AZMA 1KX3A 5F99C 4J8VA 5CPKC 3MGPB 3AZJD 3AN2D 3WA9A 4CSRA 4R8PA 1N1JA 3C1CC 1M1AA 1TZYB 3NQJA 5B1LA 4Z66B 3AFAB 5B2JA 4LD9A 3MGQA 1P3IA 5B1MA 1M18B 4J8XC 3AZHD 3MNNA 3VH5T 5E5AA 1P3BB 4ZBJC 1P3FA 3W96D 5AV5D 3AZNA 4G92C 3C1BA 4H9OB 5AVCD 1P3GD 5F99B 3LELC 4H9QA 3MGPD 3UTBC 4J8WB 3AZFA 1KX4A 3REKC 4KUDA 1TZYD 3C1CB 4XZQC 5B31G 5B2IA 2AROB 5AV6C 4Z66D 3AFAD 3AZED 5G49B 3LZ0C 4XUJA 5DNND 3X1SC 4ZBJB 3LZ1D 5AV8D 2FJ7C 3LJAC 2BYKB 4G92B 2F8NG 4WU8B 3O62D 3UTBB 3UT9D 4YM6D 3AYWD 2NQBD 3REKB 1AOIB 1M19C 4XZQB 2AROD 4UUZB 5C3IB 2JSSA 3AZIA 4AWLB 3LZ0B 5CPJC 5GSUD 4E44A 3X1UD 4J8UC 3AZKC 5AV9B 1M18A 4YS3D 2FJ7B 3VH5W 1P3BA 3W99C 5AVBA 4H9OA 1HTAA 2L5AA 4WU8D 5F99A 4NE5A 5CPKA 5CP6D 3AZLC 1AOID 1P3OD 4Z5TB 3NQUB 3C1CA 4KGCC 5BS7C 5G49A 3WTPE 5AV9D 4J8XA 5B24C 5BNXB 2CV5C 5JA4B 5GT3C 2HIOC 3LELA 3AZLB 3KWQD 1BH8A 3REKA 4Z5TD 2LY8A 4XZQA 4UUZA 5B40D 5AV6A 3A6NC 1JFIA 4KGCB 4HGAC 3LZ0A 4H9SC 3RELB 2PYOB 3WKJB 3X1SA 5BO0B 4WZSB 3REHB 3LJAA 5B24B 5B32G 3AZJC 3AN2C 2FJ7A 3UTAA 3V9RB 4WNNB 1P3PA 4X23D 1P34D 3AZHC 1A7WA 1M19A 3A6NB 3W96C 2HUEC 5AV5C 1S32B 4HGAB 3RELD 5CPJA 1KU5A 4WU9D 5AVCC 4J8UA 3REJB 3AZKA 1P3GC 2PYOD 3WKJD 3MGPC 3B6GB 3REHD 2NZDD 4Z2MH 3AZJB 1ID3B 3W99A 5BNXA 4H9RB 1TZYC 3AZEC 4Z66C 3AFAC 1U35B 5B33B 3W97D 5DNNC 3AZLA 5GT0D 3AZHB 1B6WA 3LZ1C 4EO5C
chains in the Genus database with same CATH superfamily
4WV4B 5AV8C 3AV1A 1S32D 2HUEB 5AV5B 3VH6A 4KGCA 1F66B 5BS7A 3W98D 3REJD 1P3GB 3B6GD 3O62C 3UT9C 4H9NB 4YM6C 4J8WC 4M6BA 5BO0A 3AYWC 1ID3D 2NQBC 2CV5A 3AZEB 2AROC 3MGSD 5GT3A 3KUYB 5B0ZB 2HIOA 2IO5C 5B33D 4ZUXB 1U35D 2CWEA 4WNNA 5GSUC 5DNNB 3X1UC 4CAYB 1P3MD 3LZ1B 2G5HC 4EO5B 5AV8B 4YS3C 3A6NA 3MVDB 1F66D 1W2EA 1BH9A 4WU8C 3X1TD 1TAFB 2Y2MA 3WTPB 3O62B 3UT9B 4YM6B 3AYWB 1F1EA 3AZFD 2NQBB 5CP6C 1AOIC 1ZLAA 4KUDD 3AZJA 3AN2A 1P3OC 1KX5D 5C3IC 3KUYD 5B0ZD 4H9PA 2IO5B 4ZUXD 1ULYA 4AWLC 5CHLB 2BYMA 3VH6T 5GSUB 3X1UB 5AV9C 3AZHA 4YS3B 3MVDD 3W96A 5AV5A 5B31B 5AVCA 1P3GA 3WTPD 3MGPA 5CP6B 1P3KD 3KWQC 1P3OB 3B0BA 4Z5TC 1TZYA 5B40C 3AZEA 4Z66A 4G91C 3H0MC 3AFAA 2YFVB 5DNNA 4CAYA 3B0CT 5JRGD 3LZ1A 5AV8A 1BFMA 5DNMB 5B31D 1Z2CB 4NE3A 1TAFA 3O62A 5CPKD 3UT9A 4YM6A 4J8WA 3AYWA 2NQBA 4QLCB 4X23C 3KWQB 1HQ3D 3REIB 5CPIB 1P34C 5B40B 2AROA 4G91B 3B6FB 3TU4B 5BNVB 3RELC 2F8ND 5GSUA 3VH6W 3KXBD 4WU9C 3X1UA 2PYOC 1EQZD 3WKJC 2NZDC 3REHC 4YS3A 4JJNB 2BYKA 3R45B 5DNMD 3AV2B 2Y2KA 3MGRB 3A1IA 2Y2NA 2YFWB 4WU8A 3UTBA 5B0YD 4QLCD 3REID 5CP6A 4X23B 5CPID 5GT0C 1P34B 1AOIA 3W97C 1P3OA 3B6FD 2VQRA 1S32C 3TU4D 3WAAB 2YFVA 4WU9B 3W98C 3REJC 5GXQB 5AV9A 3B6GC 2NZDB 3B0CW 4JJND 1ID3C 3AV2D 3MGRD 3UTAD 2RIQA 3MGSC 5AY8B 1U35C 5B33C 2Y2PA 1P3PD 1P3LB 3W97B 5FUGB 5GT0B 3KWQA 4KHAB 5KDMB 1P3MC 2ZY5A 1M19D 4Z5TA 1P3AB 3NQUA 5B40A 3X1VB 5B32B 3WAAD 1F66C 5BNVA 5GXQD 3W98B 3X1TC 1KX3B 3AZFC 3WA9B 3KSYA 4KUDC 4CSRB 4R8PB 1N1JB 5JA4A 1M1AB 1KX5C 5B1LB 3MGSB 3KUYC 5B0ZC 5AY8D 3AZGD 2F8NH 4ZUXC 4LD9B 1P3IB 5B1MB 1P3LD 4X23A 3MNNB 5E5AB 1P34A 1P3AD 1P3MB 3AV1D 3X1VD 5B32D 3MVDC 3AZNB 2Y2QA 3C1BB 3RELA 3AZMD 1KX3D 4WU9A 3X1TB 4J8VD 4H9QB 3WTPC 2PYOA 3WKJA 3WA9D 2JE5A 3AZFB 1KX4B 3REHA 2NZDA 5B24A 4KUDB 1P3KC 4R8PD 1M1AD 5B2IB 5B1LD 1KX5B 5B2JD 4LD9D 3MGQD 1P3ID 5B1MD 3V9RA 4XUJB 3W97A 3MNND 5E5AD 5FUGA 5GT0A 3B0DB 5KDMA 5JRGC 1P3FD 3AZND 2RVQD 1S32A 3C1BD 5B31C 4H9SA 3W98A 3REJA 1KX4D 3B6GA 1ZLAD 1P3KB 1ID3A 1HQ3C 5B2ID 4H9RA 3AZIB 3MGSA 4UPKA 1U35A 4XUJD 5B33A 2XD1A 3KXBC 5JRGB 1P3MA 1EQZC 3AL0C 1H3OB 5DNMC 5AVBB 1F66A 3X1TA 5CPKB 4H9NA 3IP4C 5B0YC 4QLCC 3REIC 5CPIC 1HQ3B 1R4VA 1KX5A 3B6FC 3AZID 3KUYA 5B0ZA 3TU4C 4ZUXA 2F8NB 1M18D 3KXBB 4J8XB 4Z2MG 1EQZB 1P3BD 2JCHA 4DQYB 4JJNC 3MVDA 5AVBD 3AV2C 3MGRC 5BT1D 3UTAC 5F99D 3LELB 3WTPA 1P3PC 2Y2IA 4J8WD 5B0YB 1BH8B 1P3KA 3C1CD 2UWXA 5AV6B 4NE6A 1JFIB 3WAAC 5GXQC 2ZY3A 4J8XD 3X1SB 5JRGA 1Q9CA 3LJAB 1H3OA 2ZM5A 5B31A 3UTAB 3LELD 5AY8C 3AZGC 3UTBD 1P3PB 1P3LC 3REKD 1HQ3A 4XZQD 3F6TA 5AV6D 1P3AC 1M19B 1B67A 3X1VC 3AV1C 5B32C 3LZ0D 5CPJB 2F8NA 4J8UB 3AZKB 3AZMC 1KX3C 3KXBA 3X1SD 3H0LC 4J8VC 1EQZA 2FJ7D 3LJAD 3WA9C 2Y2OA 3W99B 4R8PC 1M1AC 5DNMA 5B1LC 5B2JC 3AZGB 4LD9C 3MGQC 1P3IC 5B1MC 4WJ3C 5B0YA 4QLCA 3MNNC 3REIA 5E5AC 5CPIA 1P3FC 3AV1B 3AZNC 3B6FA 2RVQC 3C1BC 3TU4A 5CPJD 2F8NK 2F2AC 4J8UD 3AZKD 3AZMB 4J8VB 3EPKA 3W99D 1KX4C 4DRBA 1ZLAC 4JJNA 3EPJA 3R45A 2CV5B 1WWIA 5B2IC 3NQJB 3AV2A 3MGRA 5GT3B 5B2JB 2YFWA 2HIOB 3MGQB 4XUJC 3FDDA 3AZLD 1WWSA 3B0DC 1P3FB 4KGCD 3WAAA 1BH9B 3VH5A 5GXQA 2ZY2A 3H0RC 1ZLAB 5B24D 3AN2B 2CV5D 4NFTA 5GT3D 3EPLA 2HIOD 4H9PB 3AZIC 5AY8A 3AZGA 2BYMB 1P3LA 1M18C 4KHAA 3A1KA 1P3BC 4DRAA 3A6ND 2J8PA 1P3AA 3X1VA 5B32A 1PZRA 3W96B 5AVBC 2DF4C 1T3UA 4E45A 5BT1C 5AVCB 3AZMA 1KX3A 5F99C 4J8VA 5CPKC 3MGPB 3AZJD 3AN2D 3WA9A 4CSRA 4R8PA 1N1JA 3C1CC 1M1AA 1TZYB 3NQJA 5B1LA 4Z66B 3AFAB 5B2JA 3KFUG 3EG5B 3MGQA 4LD9A 1P3IA 5B1MA 2FFFB 1M18B 4J8XC 3AZHD 3MNNA 3VH5T 5E5AA 1P3BB 4ZBJC 1P3FA 3W96D 5AV5D 3AZNA 4G92C 3C1BA 4H9OB 5AVCD 1P3GD 5F99B 3LELC 4H9QA 3MGPD 3UTBC 4J8WB 3AZFA 1KX4A 3REKC 4KUDA 1TZYD 3C1CB 4XZQC 5B31G 5B2IA 2AROB 5AV6C 4Z66D 3AFAD 3AZED 5G49B 3LZ0C 4XUJA 5DNND 3X1SC 4ZBJB 3LZ1D 5AV8D 2FJ7C 2Y2JA 3LJAC 2BYKB 4G92B 2Y2GA 2F8NG 4WU8B 3O62D 3UTBB 3UT9D 4YM6D 3AYWD 2G5IC 2NQBD 3REKB 2ZY4A 1AOIB 1M19C 4XZQB 2AROD 4UUZB 5C3IB 2JSSA 3AZIA 4AWLB 3LZ0B 2BG1A 5GSUD 5CPJC 4E44A 3X1UD 4J8UC 3AZKC 5AV9B 1M18A 4YS3D 2FJ7B 3VH5W 1P3BA 3W99C 2Y2LA 5AVBA 4H9OA 1HTAA 2L5AA 4WU8D 5F99A 4NE5A 5CPKA 5CP6D 3AZLC 1AOID 1P3OD 4Z5TB 3NQUB 3C1CA 4KGCC 5BS7C 5G49A 3WTPE 5AV9D 2DQNC 4J8XA 5B24C 5BNXB 2CV5C 5JA4B 5GT3C 2HIOC 3LELA 3AZLB 3KWQD 1BH8A 3REKA 4Z5TD 2LY8A 4XZQA 4UUZA 5B40D 5AV6A 3A6NC 1JFIA 4KGCB 4HGAC 3LZ0A 4H9SC 3RELB 2PYOB 3WKJB 3X1SA 5BO0B 4WZSB 3EPHA 3REHB 3LJAA 5B24B 5B32G 3AZJC 3AN2C 2FJ7A 3P5JB 3UTAA 3V9RB 4WNNB 2XD5A 1P3PA 4X23D 1P34D 3AZHC 1A7WA 1M19A 3A6NB 3W96C 2HUEC 5AV5C 1S32B 4HGAB 3RELD 5CPJA 1KU5A 4WU9D 5AVCC 4J8UA 2Y2HA 3REJB 3AZKA 1P3GC 2PYOD 3WKJD 3MGPC 3B6GB 3REHD 2NZDD 4Z2MH 3AZJB 1ID3B 3W99A 5BNXA 4H9RB 1TZYC 3AZEC 4Z66C 3AFAC 1U35B 5B33B 3W97D 5DNNC 3AZLA 5GT0D 3AZHB 1B6WA 2W8SA 3LZ1C 4EO5C
chains in the Genus database with same CATH topology
4WV4B 5AV8C 3AV1A 1S32D 2HUEB 5AV5B 3VH6A 4KGCA 1F66B 5BS7A 3W98D 3REJD 1P3GB 3B6GD 3O62C 3UT9C 4H9NB 4YM6C 4J8WC 4M6BA 5BO0A 3AYWC 1ID3D 2NQBC 2CV5A 3AZEB 2AROC 3MGSD 5GT3A 3KUYB 5B0ZB 2HIOA 2IO5C 5B33D 4ZUXB 1U35D 2CWEA 4WNNA 5GSUC 5DNNB 3X1UC 4CAYB 1P3MD 3LZ1B 2G5HC 4EO5B 5AV8B 4YS3C 3A6NA 3MVDB 1F66D 1W2EA 1BH9A 4WU8C 3X1TD 1TAFB 2Y2MA 3WTPB 3O62B 3UT9B 4YM6B 3AYWB 1F1EA 3AZFD 2NQBB 5CP6C 1AOIC 1ZLAA 4KUDD 3AZJA 3AN2A 1P3OC 1KX5D 5C3IC 3KUYD 5B0ZD 4H9PA 2IO5B 4ZUXD 1ULYA 4AWLC 5CHLB 2BYMA 3VH6T 5GSUB 3X1UB 5AV9C 3AZHA 4YS3B 3MVDD 3W96A 5AV5A 5B31B 5AVCA 1P3GA 3WTPD 3MGPA 5CP6B 1P3KD 3KWQC 1P3OB 3B0BA 4Z5TC 1TZYA 5B40C 3AZEA 4Z66A 4G91C 3H0MC 3AFAA 2YFVB 5DNNA 4CAYA 3B0CT 5JRGD 3LZ1A 5AV8A 1BFMA 5DNMB 5B31D 1Z2CB 4NE3A 1TAFA 3O62A 5CPKD 3UT9A 4YM6A 4J8WA 3AYWA 2NQBA 4QLCB 4X23C 3KWQB 1HQ3D 3REIB 5CPIB 1P34C 5B40B 2AROA 4G91B 3B6FB 3TU4B 5BNVB 3RELC 2F8ND 5GSUA 3VH6W 3KXBD 4WU9C 3X1UA 2PYOC 1EQZD 3WKJC 2NZDC 3REHC 4YS3A 4JJNB 2BYKA 3R45B 5DNMD 3AV2B 2Y2KA 3MGRB 3A1IA 2Y2NA 2YFWB 4WU8A 3UTBA 5B0YD 4QLCD 3REID 5CP6A 4X23B 5CPID 5GT0C 1P34B 1AOIA 3W97C 1P3OA 3B6FD 2VQRA 1S32C 3TU4D 3WAAB 2YFVA 4WU9B 3W98C 3REJC 5GXQB 5AV9A 3B6GC 2NZDB 3B0CW 4JJND 1ID3C 3AV2D 3MGRD 3UTAD 2RIQA 3MGSC 5AY8B 1U35C 5B33C 2Y2PA 1P3PD 1P3LB 3W97B 5FUGB 5GT0B 3KWQA 4KHAB 5KDMB 1P3MC 2ZY5A 1M19D 4Z5TA 1P3AB 3NQUA 5B40A 3X1VB 5B32B 3WAAD 1F66C 5BNVA 5GXQD 3W98B 3X1TC 1KX3B 3AZFC 3WA9B 3KSYA 4KUDC 4CSRB 4R8PB 1N1JB 5JA4A 1M1AB 1KX5C 5B1LB 3MGSB 3KUYC 5B0ZC 5AY8D 3AZGD 2F8NH 4ZUXC 4LD9B 1P3IB 5B1MB 1P3LD 4X23A 3MNNB 5E5AB 1P34A 1P3AD 1P3MB 3AV1D 3X1VD 5B32D 3MVDC 3AZNB 2Y2QA 3C1BB 3RELA 3AZMD 1KX3D 4WU9A 3X1TB 4J8VD 4H9QB 3WTPC 2PYOA 3WKJA 3WA9D 2JE5A 3AZFB 1KX4B 3REHA 2NZDA 5B24A 4KUDB 1P3KC 4R8PD 1M1AD 5B2IB 5B1LD 1KX5B 5B2JD 4LD9D 3MGQD 1P3ID 5B1MD 3V9RA 4XUJB 3W97A 3MNND 5E5AD 5FUGA 5GT0A 3B0DB 5KDMA 5JRGC 1P3FD 3AZND 2RVQD 1S32A 3C1BD 5B31C 4H9SA 3W98A 3REJA 1KX4D 3B6GA 1ZLAD 1P3KB 1ID3A 1HQ3C 5B2ID 4H9RA 3AZIB 3MGSA 4UPKA 1U35A 4XUJD 5B33A 2XD1A 3KXBC 5JRGB 1P3MA 1EQZC 3AL0C 1H3OB 5DNMC 5AVBB 1F66A 3X1TA 5CPKB 4H9NA 3IP4C 5B0YC 4QLCC 3REIC 5CPIC 1HQ3B 1R4VA 1KX5A 3B6FC 3AZID 3KUYA 5B0ZA 3TU4C 4ZUXA 2F8NB 1M18D 3KXBB 4J8XB 4Z2MG 1EQZB 1P3BD 2JCHA 4DQYB 4JJNC 3MVDA 5AVBD 3AV2C 3MGRC 5BT1D 3UTAC 5F99D 3LELB 3WTPA 1P3PC 2Y2IA 4J8WD 5B0YB 1BH8B 1P3KA 3C1CD 2UWXA 5AV6B 4NE6A 1JFIB 3WAAC 5GXQC 2ZY3A 4J8XD 3X1SB 5JRGA 1Q9CA 3LJAB 1H3OA 2ZM5A 5B31A 3UTAB 3LELD 5AY8C 3AZGC 3UTBD 1P3PB 1P3LC 3REKD 1HQ3A 4XZQD 3F6TA 5AV6D 1P3AC 1M19B 1B67A 3X1VC 3AV1C 5B32C 3LZ0D 5CPJB 2F8NA 4J8UB 3AZKB 3AZMC 1KX3C 3KXBA 3X1SD 3H0LC 4J8VC 1EQZA 2FJ7D 3LJAD 3WA9C 2Y2OA 3W99B 4R8PC 1M1AC 5DNMA 5B1LC 5B2JC 3AZGB 4LD9C 3MGQC 1P3IC 5B1MC 4WJ3C 5B0YA 4QLCA 3MNNC 3REIA 5E5AC 5CPIA 1P3FC 3AV1B 3AZNC 3B6FA 2RVQC 3C1BC 3TU4A 5CPJD 2F8NK 2F2AC 4J8UD 3AZKD 3AZMB 4J8VB 3EPKA 3W99D 1KX4C 4DRBA 1ZLAC 4JJNA 3EPJA 3R45A 2CV5B 1WWIA 5B2IC 3NQJB 3AV2A 3MGRA 5GT3B 5B2JB 2YFWA 2HIOB 3MGQB 4XUJC 3FDDA 3AZLD 1WWSA 3B0DC 1P3FB 4KGCD 3WAAA 1BH9B 3VH5A 5GXQA 2ZY2A 3H0RC 1ZLAB 5B24D 3AN2B 2CV5D 4NFTA 5GT3D 3EPLA 2HIOD 4H9PB 3AZIC 5AY8A 3AZGA 2BYMB 1P3LA 1M18C 4KHAA 3A1KA 1P3BC 4DRAA 3A6ND 2J8PA 1P3AA 3X1VA 5B32A 1PZRA 3W96B 5AVBC 2DF4C 1T3UA 4E45A 5BT1C 5AVCB 3AZMA 1KX3A 5F99C 4J8VA 5CPKC 3MGPB 3AZJD 3AN2D 3WA9A 4CSRA 4R8PA 1N1JA 3C1CC 1M1AA 1TZYB 3NQJA 5B1LA 4Z66B 3AFAB 5B2JA 3KFUG 3EG5B 3MGQA 4LD9A 1P3IA 5B1MA 2FFFB 1M18B 4J8XC 3AZHD 3MNNA 3VH5T 5E5AA 1P3BB 4ZBJC 1P3FA 3W96D 5AV5D 3AZNA 4G92C 3C1BA 4H9OB 5AVCD 1P3GD 5F99B 3LELC 4H9QA 3MGPD 3UTBC 4J8WB 3AZFA 1KX4A 3REKC 4KUDA 1TZYD 3C1CB 4XZQC 5B31G 5B2IA 2AROB 5AV6C 4Z66D 3AFAD 3AZED 5G49B 3LZ0C 4XUJA 5DNND 3X1SC 4ZBJB 3LZ1D 5AV8D 2FJ7C 2Y2JA 3LJAC 2BYKB 4G92B 2Y2GA 2F8NG 4WU8B 3O62D 3UTBB 3UT9D 4YM6D 3AYWD 2G5IC 2NQBD 3REKB 2ZY4A 1AOIB 1M19C 4XZQB 2AROD 4UUZB 5C3IB 2JSSA 3AZIA 4AWLB 3LZ0B 2BG1A 5GSUD 5CPJC 4E44A 3X1UD 4J8UC 3AZKC 5AV9B 1M18A 4YS3D 2FJ7B 3VH5W 1P3BA 3W99C 2Y2LA 5AVBA 4H9OA 1HTAA 2L5AA 4WU8D 5F99A 4NE5A 5CPKA 5CP6D 3AZLC 1AOID 1P3OD 4Z5TB 3NQUB 3C1CA 4KGCC 5BS7C 5G49A 3WTPE 5AV9D 2DQNC 4J8XA 5B24C 5BNXB 2CV5C 5JA4B 5GT3C 2HIOC 3LELA 3AZLB 3KWQD 1BH8A 3REKA 4Z5TD 2LY8A 4XZQA 4UUZA 5B40D 5AV6A 3A6NC 1JFIA 4KGCB 4HGAC 3LZ0A 4H9SC 3RELB 2PYOB 3WKJB 3X1SA 5BO0B 4WZSB 3EPHA 3REHB 3LJAA 5B24B 5B32G 3AZJC 3AN2C 2FJ7A 3P5JB 3UTAA 3V9RB 4WNNB 2XD5A 1P3PA 4X23D 1P34D 3AZHC 1A7WA 1M19A 3A6NB 3W96C 2HUEC 5AV5C 1S32B 4HGAB 3RELD 5CPJA 1KU5A 4WU9D 5AVCC 4J8UA 2Y2HA 3REJB 3AZKA 1P3GC 2PYOD 3WKJD 3MGPC 3B6GB 3REHD 2NZDD 4Z2MH 3AZJB 1ID3B 3W99A 5BNXA 4H9RB 1TZYC 3AZEC 4Z66C 3AFAC 1U35B 5B33B 3W97D 5DNNC 3AZLA 5GT0D 3AZHB 1B6WA 2W8SA 3LZ1C 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV4 B;  5AV8 C;  3AV1 A;  1S32 D;  2HUE B;  5AV5 B;  3VH6 A;  4KGC A;  1F66 B;  5BS7 A;  3W98 D;  3REJ D;  1P3G B;  3B6G D;  3O62 C;  3UT9 C;  4H9N B;  4YM6 C;  4J8W C;  4M6B A;  5BO0 A;  3AYW C;  1ID3 D;  2NQB C;  2CV5 A;  3AZE B;  2ARO C;  3MGS D;  5GT3 A;  3KUY B;  5B0Z B;  2HIO A;  2IO5 C;  5B33 D;  4ZUX B;  1U35 D;  2CWE A;  4WNN A;  5GSU C;  5DNN B;  3X1U C;  4CAY B;  1P3M D;  3LZ1 B;  4EO5 B;  4YS3 C;  5AV8 B;  3A6N A;  3MVD B;  1F66 D;  1BH9 A;  4WU8 C;  3X1T D;  1TAF B;  3WTP B;  3O62 B;  3UT9 B;  4YM6 B;  3AYW B;  1F1E A;  3AZF D;  2NQB B;  5CP6 C;  1AOI C;  1ZLA A;  4KUD D;  3AZJ A;  3AN2 A;  1P3O C;  1KX5 D;  5C3I C;  3KUY D;  5B0Z D;  4H9P A;  2IO5 B;  4ZUX D;  1ULY A;  4AWL C;  5CHL B;  2BYM A;  3VH6 T;  5GSU B;  3X1U B;  5AV9 C;  3AZH A;  4YS3 B;  3MVD D;  3W96 A;  5AV5 A;  5B31 B;  5AVC A;  1P3G A;  3WTP D;  3MGP A;  5CP6 B;  1P3K D;  3KWQ C;  1P3O B;  3B0B A;  4Z5T C;  1TZY A;  5B40 C;  3AZE A;  4Z66 A;  4G91 C;  3AFA A;  2YFV B;  5DNN A;  4CAY A;  3B0C T;  5JRG D;  3LZ1 A;  5AV8 A;  1BFM A;  5DNM B;  5B31 D;  4NE3 A;  1TAF A;  3O62 A;  5CPK D;  3UT9 A;  4YM6 A;  4J8W A;  3AYW A;  2NQB A;  4QLC B;  4X23 C;  3KWQ B;  1HQ3 D;  3REI B;  5CPI B;  1P34 C;  5B40 B;  2ARO A;  4G91 B;  3B6F B;  3TU4 B;  5BNV B;  3REL C;  2F8N D;  5GSU A;  3VH6 W;  3KXB D;  4WU9 C;  3X1U A;  2PYO C;  1EQZ D;  3WKJ C;  2NZD C;  3REH C;  4YS3 A;  4JJN B;  2BYK A;  3R45 B;  5DNM D;  3AV2 B;  3MGR B;  2YFW B;  4WU8 A;  3UTB A;  5B0Y D;  4QLC D;  3REI D;  5CP6 A;  4X23 B;  5CPI D;  5GT0 C;  1P34 B;  1AOI A;  3W97 C;  1P3O A;  3B6F D;  1S32 C;  3TU4 D;  3WAA B;  2YFV A;  4WU9 B;  3W98 C;  3REJ C;  5GXQ B;  5AV9 A;  3B6G C;  2NZD B;  3B0C W;  4JJN D;  1ID3 C;  3AV2 D;  3MGR D;  3UTA D;  3MGS C;  5AY8 B;  1U35 C;  5B33 C;  1P3P D;  1P3L B;  3W97 B;  5FUG B;  5GT0 B;  3KWQ A;  4KHA B;  5KDM B;  1P3M C;  1M19 D;  4Z5T A;  1P3A B;  3NQU A;  5B40 A;  3X1V B;  5B32 B;  3WAA D;  1F66 C;  5BNV A;  5GXQ D;  3W98 B;  3X1T C;  1KX3 B;  3AZF C;  3WA9 B;  3KSY A;  4KUD C;  4CSR B;  4R8P B;  1N1J B;  5JA4 A;  1M1A B;  1KX5 C;  5B1L B;  3MGS B;  3KUY C;  5B0Z C;  5AY8 D;  3AZG D;  2F8N H;  4ZUX C;  4LD9 B;  1P3I B;  5B1M B;  1P3L D;  4X23 A;  3MNN B;  5E5A B;  1P34 A;  1P3A D;  1P3M B;  3AV1 D;  3X1V D;  5B32 D;  3MVD C;  3AZN B;  3C1B B;  3REL A;  3AZM D;  1KX3 D;  4WU9 A;  3X1T B;  4J8V D;  4H9Q B;  3WTP C;  2PYO A;  3WKJ A;  3WA9 D;  3AZF B;  1KX4 B;  3REH A;  2NZD A;  5B24 A;  4KUD B;  1P3K C;  4R8P D;  1M1A D;  5B2I B;  5B1L D;  1KX5 B;  5B2J D;  4LD9 D;  3MGQ D;  1P3I D;  5B1M D;  3V9R A;  4XUJ B;  3W97 A;  3MNN D;  5E5A D;  5FUG A;  5GT0 A;  3B0D B;  5KDM A;  5JRG C;  1P3F D;  3AZN D;  2RVQ D;  1S32 A;  3C1B D;  5B31 C;  4H9S A;  3W98 A;  3REJ A;  1KX4 D;  3B6G A;  1ZLA D;  1P3K B;  1ID3 A;  1HQ3 C;  5B2I D;  4H9R A;  3AZI B;  3MGS A;  1U35 A;  4XUJ D;  5B33 A;  3KXB C;  5JRG B;  1P3M A;  1EQZ C;  1H3O B;  5DNM C;  5AVB B;  1F66 A;  3X1T A;  5CPK B;  4H9N A;  5B0Y C;  4QLC C;  3REI C;  5CPI C;  1HQ3 B;  1R4V A;  1KX5 A;  3B6F C;  3AZI D;  3KUY A;  5B0Z A;  3TU4 C;  4ZUX A;  2F8N B;  1M18 D;  3KXB B;  4J8X B;  4Z2M G;  1EQZ B;  1P3B D;  4JJN C;  3MVD A;  5AVB D;  3AV2 C;  3MGR C;  5BT1 D;  3UTA C;  5F99 D;  3LEL B;  3WTP A;  1P3P C;  4J8W D;  5B0Y B;  1BH8 B;  1P3K A;  3C1C D;  5AV6 B;  4NE6 A;  1JFI B;  3WAA C;  5GXQ C;  4J8X D;  3X1S B;  5JRG A;  1Q9C A;  3LJA B;  1H3O A;  5B31 A;  3UTA B;  3LEL D;  5AY8 C;  3AZG C;  3UTB D;  1P3P B;  1P3L C;  3REK D;  1HQ3 A;  4XZQ D;  1P3A C;  5AV6 D;  1M19 B;  1B67 A;  3X1V C;  3AV1 C;  5B32 C;  3LZ0 D;  5CPJ B;  2F8N A;  4J8U B;  3AZK B;  3AZM C;  1KX3 C;  3KXB A;  3X1S D;  4J8V C;  1EQZ A;  2FJ7 D;  3LJA D;  3WA9 C;  3W99 B;  4R8P C;  1M1A C;  5DNM A;  5B1L C;  5B2J C;  3AZG B;  4LD9 C;  3MGQ C;  1P3I C;  5B1M C;  5B0Y A;  4QLC A;  3MNN C;  3REI A;  5E5A C;  5CPI A;  1P3F C;  3AV1 B;  3AZN C;  3B6F A;  2RVQ C;  3C1B C;  3TU4 A;  5CPJ D;  2F8N K;  4J8U D;  3AZK D;  3AZM B;  4J8V B;  3W99 D;  1KX4 C;  4DRB A;  1ZLA C;  4JJN A;  3R45 A;  2CV5 B;  1WWI A;  5B2I C;  3NQJ B;  3AV2 A;  3MGR A;  5GT3 B;  5B2J B;  2YFW A;  2HIO B;  3MGQ B;  4XUJ C;  3AZL D;  1WWS A;  3B0D C;  1P3F B;  4KGC D;  3WAA A;  1BH9 B;  3VH5 A;  5GXQ A;  1ZLA B;  5B24 D;  3AN2 B;  2CV5 D;  4NFT A;  5GT3 D;  2HIO D;  4H9P B;  3AZI C;  5AY8 A;  3AZG A;  2BYM B;  1P3L A;  1M18 C;  4KHA A;  1P3B C;  4DRA A;  3A6N D;  1P3A A;  3X1V A;  5B32 A;  3W96 B;  5AVB C;  4E45 A;  5BT1 C;  5AVC B;  3AZM A;  1KX3 A;  5F99 C;  4J8V A;  5CPK C;  3MGP B;  3AZJ D;  3AN2 D;  3WA9 A;  4CSR A;  4R8P A;  1N1J A;  3C1C C;  1M1A A;  1TZY B;  3NQJ A;  5B1L A;  4Z66 B;  3AFA B;  5B2J A;  4LD9 A;  3MGQ A;  1P3I A;  5B1M A;  1M18 B;  4J8X C;  3AZH D;  3MNN A;  3VH5 T;  5E5A A;  1P3B B;  4ZBJ C;  1P3F A;  3W96 D;  5AV5 D;  3AZN A;  4G92 C;  3C1B A;  4H9O B;  5AVC D;  1P3G D;  5F99 B;  3LEL C;  4H9Q A;  3MGP D;  3UTB C;  4J8W B;  3AZF A;  1KX4 A;  3REK C;  4KUD A;  1TZY D;  3C1C B;  4XZQ C;  5B31 G;  5B2I A;  2ARO B;  5AV6 C;  4Z66 D;  3AFA D;  3AZE D;  5G49 B;  3LZ0 C;  4XUJ A;  5DNN D;  3X1S C;  4ZBJ B;  3LZ1 D;  5AV8 D;  2FJ7 C;  3LJA C;  2BYK B;  4G92 B;  2F8N G;  4WU8 B;  3O62 D;  3UTB B;  3UT9 D;  4YM6 D;  3AYW D;  2NQB D;  3REK B;  1AOI B;  1M19 C;  4XZQ B;  2ARO D;  4UUZ B;  5C3I B;  2JSS A;  3AZI A;  4AWL B;  3LZ0 B;  5CPJ C;  5GSU D;  4E44 A;  3X1U D;  4J8U C;  3AZK C;  5AV9 B;  1M18 A;  4YS3 D;  2FJ7 B;  3VH5 W;  1P3B A;  3W99 C;  5AVB A;  4H9O A;  1HTA A;  2L5A A;  4WU8 D;  5F99 A;  4NE5 A;  5CPK A;  5CP6 D;  3AZL C;  1AOI D;  1P3O D;  4Z5T B;  3NQU B;  3C1C A;  4KGC C;  5BS7 C;  5G49 A;  3WTP E;  5AV9 D;  4J8X A;  5B24 C;  5BNX B;  2CV5 C;  5JA4 B;  5GT3 C;  2HIO C;  3LEL A;  3AZL B;  3KWQ D;  1BH8 A;  3REK A;  4Z5T D;  2LY8 A;  4XZQ A;  4UUZ A;  5B40 D;  5AV6 A;  3A6N C;  1JFI A;  4KGC B;  4HGA C;  3LZ0 A;  4H9S C;  3REL B;  2PYO B;  3WKJ B;  3X1S A;  5BO0 B;  4WZS B;  3REH B;  3LJA A;  5B24 B;  5B32 G;  3AZJ C;  3AN2 C;  2FJ7 A;  3UTA A;  3V9R B;  4WNN B;  1P3P A;  4X23 D;  1P34 D;  3AZH C;  1A7W A;  1M19 A;  3A6N B;  3W96 C;  2HUE C;  5AV5 C;  1S32 B;  4HGA B;  3REL D;  5CPJ A;  1KU5 A;  4WU9 D;  5AVC C;  4J8U A;  3REJ B;  3AZK A;  1P3G C;  2PYO D;  3WKJ D;  3MGP C;  3B6G B;  3REH D;  2NZD D;  4Z2M H;  3AZJ B;  1ID3 B;  3W99 A;  5BNX A;  4H9R B;  1TZY C;  3AZE C;  4Z66 C;  3AFA C;  1U35 B;  5B33 B;  3W97 D;  5DNN C;  3AZL A;  5GT0 D;  3AZH B;  1B6W A;  3LZ1 C;  4EO5 C; 
#chains in the Genus database with same CATH topology
 4WV4 B;  5AV8 C;  3AV1 A;  1S32 D;  2HUE B;  5AV5 B;  3VH6 A;  4KGC A;  1F66 B;  5BS7 A;  3W98 D;  3REJ D;  1P3G B;  3B6G D;  3O62 C;  3UT9 C;  4H9N B;  4YM6 C;  4J8W C;  4M6B A;  5BO0 A;  3AYW C;  1ID3 D;  2NQB C;  2CV5 A;  3AZE B;  2ARO C;  3MGS D;  5GT3 A;  3KUY B;  5B0Z B;  2HIO A;  2IO5 C;  5B33 D;  4ZUX B;  1U35 D;  2CWE A;  4WNN A;  5GSU C;  5DNN B;  3X1U C;  4CAY B;  1P3M D;  3LZ1 B;  2G5H C;  4EO5 B;  5AV8 B;  4YS3 C;  3A6N A;  3MVD B;  1F66 D;  1W2E A;  1BH9 A;  4WU8 C;  3X1T D;  1TAF B;  2Y2M A;  3WTP B;  3O62 B;  3UT9 B;  4YM6 B;  3AYW B;  1F1E A;  3AZF D;  2NQB B;  5CP6 C;  1AOI C;  1ZLA A;  4KUD D;  3AZJ A;  3AN2 A;  1P3O C;  1KX5 D;  5C3I C;  3KUY D;  5B0Z D;  4H9P A;  2IO5 B;  4ZUX D;  1ULY A;  4AWL C;  5CHL B;  2BYM A;  3VH6 T;  5GSU B;  3X1U B;  5AV9 C;  3AZH A;  4YS3 B;  3MVD D;  3W96 A;  5AV5 A;  5B31 B;  5AVC A;  1P3G A;  3WTP D;  3MGP A;  5CP6 B;  1P3K D;  3KWQ C;  1P3O B;  3B0B A;  4Z5T C;  1TZY A;  5B40 C;  3AZE A;  4Z66 A;  4G91 C;  3H0M C;  3AFA A;  2YFV B;  5DNN A;  4CAY A;  3B0C T;  5JRG D;  3LZ1 A;  5AV8 A;  1BFM A;  5DNM B;  5B31 D;  1Z2C B;  4NE3 A;  1TAF A;  3O62 A;  5CPK D;  3UT9 A;  4YM6 A;  4J8W A;  3AYW A;  2NQB A;  4QLC B;  4X23 C;  3KWQ B;  1HQ3 D;  3REI B;  5CPI B;  1P34 C;  5B40 B;  2ARO A;  4G91 B;  3B6F B;  3TU4 B;  5BNV B;  3REL C;  2F8N D;  5GSU A;  3VH6 W;  3KXB D;  4WU9 C;  3X1U A;  2PYO C;  1EQZ D;  3WKJ C;  2NZD C;  3REH C;  4YS3 A;  4JJN B;  2BYK A;  3R45 B;  5DNM D;  3AV2 B;  2Y2K A;  3MGR B;  3A1I A;  2Y2N A;  2YFW B;  4WU8 A;  3UTB A;  5B0Y D;  4QLC D;  3REI D;  5CP6 A;  4X23 B;  5CPI D;  5GT0 C;  1P34 B;  1AOI A;  3W97 C;  1P3O A;  3B6F D;  2VQR A;  1S32 C;  3TU4 D;  3WAA B;  2YFV A;  4WU9 B;  3W98 C;  3REJ C;  5GXQ B;  5AV9 A;  3B6G C;  2NZD B;  3B0C W;  4JJN D;  1ID3 C;  3AV2 D;  3MGR D;  3UTA D;  2RIQ A;  3MGS C;  5AY8 B;  1U35 C;  5B33 C;  2Y2P A;  1P3P D;  1P3L B;  3W97 B;  5FUG B;  5GT0 B;  3KWQ A;  4KHA B;  5KDM B;  1P3M C;  2ZY5 A;  1M19 D;  4Z5T A;  1P3A B;  3NQU A;  5B40 A;  3X1V B;  5B32 B;  3WAA D;  1F66 C;  5BNV A;  5GXQ D;  3W98 B;  3X1T C;  1KX3 B;  3AZF C;  3WA9 B;  3KSY A;  4KUD C;  4CSR B;  4R8P B;  1N1J B;  5JA4 A;  1M1A B;  1KX5 C;  5B1L B;  3MGS B;  3KUY C;  5B0Z C;  5AY8 D;  3AZG D;  2F8N H;  4ZUX C;  4LD9 B;  1P3I B;  5B1M B;  1P3L D;  4X23 A;  3MNN B;  5E5A B;  1P34 A;  1P3A D;  1P3M B;  3AV1 D;  3X1V D;  5B32 D;  3MVD C;  3AZN B;  2Y2Q A;  3C1B B;  3REL A;  3AZM D;  1KX3 D;  4WU9 A;  3X1T B;  4J8V D;  4H9Q B;  3WTP C;  2PYO A;  3WKJ A;  3WA9 D;  2JE5 A;  3AZF B;  1KX4 B;  3REH A;  2NZD A;  5B24 A;  4KUD B;  1P3K C;  4R8P D;  1M1A D;  5B2I B;  5B1L D;  1KX5 B;  5B2J D;  4LD9 D;  3MGQ D;  1P3I D;  5B1M D;  3V9R A;  4XUJ B;  3W97 A;  3MNN D;  5E5A D;  5FUG A;  5GT0 A;  3B0D B;  5KDM A;  5JRG C;  1P3F D;  3AZN D;  2RVQ D;  1S32 A;  3C1B D;  5B31 C;  4H9S A;  3W98 A;  3REJ A;  1KX4 D;  3B6G A;  1ZLA D;  1P3K B;  1ID3 A;  1HQ3 C;  5B2I D;  4H9R A;  3AZI B;  3MGS A;  4UPK A;  1U35 A;  4XUJ D;  5B33 A;  2XD1 A;  3KXB C;  5JRG B;  1P3M A;  1EQZ C;  3AL0 C;  1H3O B;  5DNM C;  5AVB B;  1F66 A;  3X1T A;  5CPK B;  4H9N A;  3IP4 C;  5B0Y C;  4QLC C;  3REI C;  5CPI C;  1HQ3 B;  1R4V A;  1KX5 A;  3B6F C;  3AZI D;  3KUY A;  5B0Z A;  3TU4 C;  4ZUX A;  2F8N B;  1M18 D;  3KXB B;  4J8X B;  4Z2M G;  1EQZ B;  1P3B D;  2JCH A;  4DQY B;  4JJN C;  3MVD A;  5AVB D;  3AV2 C;  3MGR C;  5BT1 D;  3UTA C;  5F99 D;  3LEL B;  3WTP A;  1P3P C;  2Y2I A;  4J8W D;  5B0Y B;  1BH8 B;  1P3K A;  3C1C D;  2UWX A;  5AV6 B;  4NE6 A;  1JFI B;  3WAA C;  5GXQ C;  2ZY3 A;  4J8X D;  3X1S B;  5JRG A;  1Q9C A;  3LJA B;  1H3O A;  2ZM5 A;  5B31 A;  3UTA B;  3LEL D;  5AY8 C;  3AZG C;  3UTB D;  1P3P B;  1P3L C;  3REK D;  1HQ3 A;  4XZQ D;  3F6T A;  5AV6 D;  1P3A C;  1M19 B;  1B67 A;  3X1V C;  3AV1 C;  5B32 C;  3LZ0 D;  5CPJ B;  2F8N A;  4J8U B;  3AZK B;  3AZM C;  1KX3 C;  3KXB A;  3X1S D;  3H0L C;  4J8V C;  1EQZ A;  2FJ7 D;  3LJA D;  3WA9 C;  2Y2O A;  3W99 B;  4R8P C;  1M1A C;  5DNM A;  5B1L C;  5B2J C;  3AZG B;  4LD9 C;  3MGQ C;  1P3I C;  5B1M C;  4WJ3 C;  5B0Y A;  4QLC A;  3MNN C;  3REI A;  5E5A C;  5CPI A;  1P3F C;  3AV1 B;  3AZN C;  3B6F A;  2RVQ C;  3C1B C;  3TU4 A;  5CPJ D;  2F8N K;  2F2A C;  4J8U D;  3AZK D;  3AZM B;  4J8V B;  3EPK A;  3W99 D;  1KX4 C;  4DRB A;  1ZLA C;  4JJN A;  3EPJ A;  3R45 A;  2CV5 B;  1WWI A;  5B2I C;  3NQJ B;  3AV2 A;  3MGR A;  5GT3 B;  5B2J B;  2YFW A;  2HIO B;  3MGQ B;  4XUJ C;  3FDD A;  3AZL D;  1WWS A;  3B0D C;  1P3F B;  4KGC D;  3WAA A;  1BH9 B;  3VH5 A;  5GXQ A;  2ZY2 A;  3H0R C;  1ZLA B;  5B24 D;  3AN2 B;  2CV5 D;  4NFT A;  5GT3 D;  3EPL A;  2HIO D;  4H9P B;  3AZI C;  5AY8 A;  3AZG A;  2BYM B;  1P3L A;  1M18 C;  4KHA A;  3A1K A;  1P3B C;  4DRA A;  3A6N D;  2J8P A;  1P3A A;  3X1V A;  5B32 A;  1PZR A;  3W96 B;  5AVB C;  2DF4 C;  1T3U A;  4E45 A;  5BT1 C;  5AVC B;  3AZM A;  1KX3 A;  5F99 C;  4J8V A;  5CPK C;  3MGP B;  3AZJ D;  3AN2 D;  3WA9 A;  4CSR A;  4R8P A;  1N1J A;  3C1C C;  1M1A A;  1TZY B;  3NQJ A;  5B1L A;  4Z66 B;  3AFA B;  5B2J A;  3KFU G;  3EG5 B;  3MGQ A;  4LD9 A;  1P3I A;  5B1M A;  2FFF B;  1M18 B;  4J8X C;  3AZH D;  3MNN A;  3VH5 T;  5E5A A;  1P3B B;  4ZBJ C;  1P3F A;  3W96 D;  5AV5 D;  3AZN A;  4G92 C;  3C1B A;  4H9O B;  5AVC D;  1P3G D;  5F99 B;  3LEL C;  4H9Q A;  3MGP D;  3UTB C;  4J8W B;  3AZF A;  1KX4 A;  3REK C;  4KUD A;  1TZY D;  3C1C B;  4XZQ C;  5B31 G;  5B2I A;  2ARO B;  5AV6 C;  4Z66 D;  3AFA D;  3AZE D;  5G49 B;  3LZ0 C;  4XUJ A;  5DNN D;  3X1S C;  4ZBJ B;  3LZ1 D;  5AV8 D;  2FJ7 C;  2Y2J A;  3LJA C;  2BYK B;  4G92 B;  2Y2G A;  2F8N G;  4WU8 B;  3O62 D;  3UTB B;  3UT9 D;  4YM6 D;  3AYW D;  2G5I C;  2NQB D;  3REK B;  2ZY4 A;  1AOI B;  1M19 C;  4XZQ B;  2ARO D;  4UUZ B;  5C3I B;  2JSS A;  3AZI A;  4AWL B;  3LZ0 B;  2BG1 A;  5GSU D;  5CPJ C;  4E44 A;  3X1U D;  4J8U C;  3AZK C;  5AV9 B;  1M18 A;  4YS3 D;  2FJ7 B;  3VH5 W;  1P3B A;  3W99 C;  2Y2L A;  5AVB A;  4H9O A;  1HTA A;  2L5A A;  4WU8 D;  5F99 A;  4NE5 A;  5CPK A;  5CP6 D;  3AZL C;  1AOI D;  1P3O D;  4Z5T B;  3NQU B;  3C1C A;  4KGC C;  5BS7 C;  5G49 A;  3WTP E;  5AV9 D;  2DQN C;  4J8X A;  5B24 C;  5BNX B;  2CV5 C;  5JA4 B;  5GT3 C;  2HIO C;  3LEL A;  3AZL B;  3KWQ D;  1BH8 A;  3REK A;  4Z5T D;  2LY8 A;  4XZQ A;  4UUZ A;  5B40 D;  5AV6 A;  3A6N C;  1JFI A;  4KGC B;  4HGA C;  3LZ0 A;  4H9S C;  3REL B;  2PYO B;  3WKJ B;  3X1S A;  5BO0 B;  4WZS B;  3EPH A;  3REH B;  3LJA A;  5B24 B;  5B32 G;  3AZJ C;  3AN2 C;  2FJ7 A;  3P5J B;  3UTA A;  3V9R B;  4WNN B;  2XD5 A;  1P3P A;  4X23 D;  1P34 D;  3AZH C;  1A7W A;  1M19 A;  3A6N B;  3W96 C;  2HUE C;  5AV5 C;  1S32 B;  4HGA B;  3REL D;  5CPJ A;  1KU5 A;  4WU9 D;  5AVC C;  4J8U A;  2Y2H A;  3REJ B;  3AZK A;  1P3G C;  2PYO D;  3WKJ D;  3MGP C;  3B6G B;  3REH D;  2NZD D;  4Z2M H;  3AZJ B;  1ID3 B;  3W99 A;  5BNX A;  4H9R B;  1TZY C;  3AZE C;  4Z66 C;  3AFA C;  1U35 B;  5B33 B;  3W97 D;  5DNN C;  3AZL A;  5GT0 D;  3AZH B;  1B6W A;  2W8S A;  3LZ1 C;  4EO5 C; 
#chains in the Genus database with same CATH homology
 4WV4 B;  5AV8 C;  3AV1 A;  1S32 D;  2HUE B;  5AV5 B;  3VH6 A;  4KGC A;  1F66 B;  5BS7 A;  3W98 D;  3REJ D;  1P3G B;  3B6G D;  3O62 C;  3UT9 C;  4H9N B;  4YM6 C;  4J8W C;  4M6B A;  5BO0 A;  3AYW C;  1ID3 D;  2NQB C;  2CV5 A;  3AZE B;  2ARO C;  3MGS D;  5GT3 A;  3KUY B;  5B0Z B;  2HIO A;  2IO5 C;  5B33 D;  4ZUX B;  1U35 D;  2CWE A;  4WNN A;  5GSU C;  5DNN B;  3X1U C;  4CAY B;  1P3M D;  3LZ1 B;  2G5H C;  4EO5 B;  5AV8 B;  4YS3 C;  3A6N A;  3MVD B;  1F66 D;  1W2E A;  1BH9 A;  4WU8 C;  3X1T D;  1TAF B;  2Y2M A;  3WTP B;  3O62 B;  3UT9 B;  4YM6 B;  3AYW B;  1F1E A;  3AZF D;  2NQB B;  5CP6 C;  1AOI C;  1ZLA A;  4KUD D;  3AZJ A;  3AN2 A;  1P3O C;  1KX5 D;  5C3I C;  3KUY D;  5B0Z D;  4H9P A;  2IO5 B;  4ZUX D;  1ULY A;  4AWL C;  5CHL B;  2BYM A;  3VH6 T;  5GSU B;  3X1U B;  5AV9 C;  3AZH A;  4YS3 B;  3MVD D;  3W96 A;  5AV5 A;  5B31 B;  5AVC A;  1P3G A;  3WTP D;  3MGP A;  5CP6 B;  1P3K D;  3KWQ C;  1P3O B;  3B0B A;  4Z5T C;  1TZY A;  5B40 C;  3AZE A;  4Z66 A;  4G91 C;  3H0M C;  3AFA A;  2YFV B;  5DNN A;  4CAY A;  3B0C T;  5JRG D;  3LZ1 A;  5AV8 A;  1BFM A;  5DNM B;  5B31 D;  1Z2C B;  4NE3 A;  1TAF A;  3O62 A;  5CPK D;  3UT9 A;  4YM6 A;  4J8W A;  3AYW A;  2NQB A;  4QLC B;  4X23 C;  3KWQ B;  1HQ3 D;  3REI B;  5CPI B;  1P34 C;  5B40 B;  2ARO A;  4G91 B;  3B6F B;  3TU4 B;  5BNV B;  3REL C;  2F8N D;  5GSU A;  3VH6 W;  3KXB D;  4WU9 C;  3X1U A;  2PYO C;  1EQZ D;  3WKJ C;  2NZD C;  3REH C;  4YS3 A;  4JJN B;  2BYK A;  3R45 B;  5DNM D;  3AV2 B;  2Y2K A;  3MGR B;  3A1I A;  2Y2N A;  2YFW B;  4WU8 A;  3UTB A;  5B0Y D;  4QLC D;  3REI D;  5CP6 A;  4X23 B;  5CPI D;  5GT0 C;  1P34 B;  1AOI A;  3W97 C;  1P3O A;  3B6F D;  2VQR A;  1S32 C;  3TU4 D;  3WAA B;  2YFV A;  4WU9 B;  3W98 C;  3REJ C;  5GXQ B;  5AV9 A;  3B6G C;  2NZD B;  3B0C W;  4JJN D;  1ID3 C;  3AV2 D;  3MGR D;  3UTA D;  2RIQ A;  3MGS C;  5AY8 B;  1U35 C;  5B33 C;  2Y2P A;  1P3P D;  1P3L B;  3W97 B;  5FUG B;  5GT0 B;  3KWQ A;  4KHA B;  5KDM B;  1P3M C;  2ZY5 A;  1M19 D;  4Z5T A;  1P3A B;  3NQU A;  5B40 A;  3X1V B;  5B32 B;  3WAA D;  1F66 C;  5BNV A;  5GXQ D;  3W98 B;  3X1T C;  1KX3 B;  3AZF C;  3WA9 B;  3KSY A;  4KUD C;  4CSR B;  4R8P B;  1N1J B;  5JA4 A;  1M1A B;  1KX5 C;  5B1L B;  3MGS B;  3KUY C;  5B0Z C;  5AY8 D;  3AZG D;  2F8N H;  4ZUX C;  4LD9 B;  1P3I B;  5B1M B;  1P3L D;  4X23 A;  3MNN B;  5E5A B;  1P34 A;  1P3A D;  1P3M B;  3AV1 D;  3X1V D;  5B32 D;  3MVD C;  3AZN B;  2Y2Q A;  3C1B B;  3REL A;  3AZM D;  1KX3 D;  4WU9 A;  3X1T B;  4J8V D;  4H9Q B;  3WTP C;  2PYO A;  3WKJ A;  3WA9 D;  2JE5 A;  3AZF B;  1KX4 B;  3REH A;  2NZD A;  5B24 A;  4KUD B;  1P3K C;  4R8P D;  1M1A D;  5B2I B;  5B1L D;  1KX5 B;  5B2J D;  4LD9 D;  3MGQ D;  1P3I D;  5B1M D;  3V9R A;  4XUJ B;  3W97 A;  3MNN D;  5E5A D;  5FUG A;  5GT0 A;  3B0D B;  5KDM A;  5JRG C;  1P3F D;  3AZN D;  2RVQ D;  1S32 A;  3C1B D;  5B31 C;  4H9S A;  3W98 A;  3REJ A;  1KX4 D;  3B6G A;  1ZLA D;  1P3K B;  1ID3 A;  1HQ3 C;  5B2I D;  4H9R A;  3AZI B;  3MGS A;  4UPK A;  1U35 A;  4XUJ D;  5B33 A;  2XD1 A;  3KXB C;  5JRG B;  1P3M A;  1EQZ C;  3AL0 C;  1H3O B;  5DNM C;  5AVB B;  1F66 A;  3X1T A;  5CPK B;  4H9N A;  3IP4 C;  5B0Y C;  4QLC C;  3REI C;  5CPI C;  1HQ3 B;  1R4V A;  1KX5 A;  3B6F C;  3AZI D;  3KUY A;  5B0Z A;  3TU4 C;  4ZUX A;  2F8N B;  1M18 D;  3KXB B;  4J8X B;  4Z2M G;  1EQZ B;  1P3B D;  2JCH A;  4DQY B;  4JJN C;  3MVD A;  5AVB D;  3AV2 C;  3MGR C;  5BT1 D;  3UTA C;  5F99 D;  3LEL B;  3WTP A;  1P3P C;  2Y2I A;  4J8W D;  5B0Y B;  1BH8 B;  1P3K A;  3C1C D;  2UWX A;  5AV6 B;  4NE6 A;  1JFI B;  3WAA C;  5GXQ C;  2ZY3 A;  4J8X D;  3X1S B;  5JRG A;  1Q9C A;  3LJA B;  1H3O A;  2ZM5 A;  5B31 A;  3UTA B;  3LEL D;  5AY8 C;  3AZG C;  3UTB D;  1P3P B;  1P3L C;  3REK D;  1HQ3 A;  4XZQ D;  3F6T A;  5AV6 D;  1P3A C;  1M19 B;  1B67 A;  3X1V C;  3AV1 C;  5B32 C;  3LZ0 D;  5CPJ B;  2F8N A;  4J8U B;  3AZK B;  3AZM C;  1KX3 C;  3KXB A;  3X1S D;  3H0L C;  4J8V C;  1EQZ A;  2FJ7 D;  3LJA D;  3WA9 C;  2Y2O A;  3W99 B;  4R8P C;  1M1A C;  5DNM A;  5B1L C;  5B2J C;  3AZG B;  4LD9 C;  3MGQ C;  1P3I C;  5B1M C;  4WJ3 C;  5B0Y A;  4QLC A;  3MNN C;  3REI A;  5E5A C;  5CPI A;  1P3F C;  3AV1 B;  3AZN C;  3B6F A;  2RVQ C;  3C1B C;  3TU4 A;  5CPJ D;  2F8N K;  2F2A C;  4J8U D;  3AZK D;  3AZM B;  4J8V B;  3EPK A;  3W99 D;  1KX4 C;  4DRB A;  1ZLA C;  4JJN A;  3EPJ A;  3R45 A;  2CV5 B;  1WWI A;  5B2I C;  3NQJ B;  3AV2 A;  3MGR A;  5GT3 B;  5B2J B;  2YFW A;  2HIO B;  3MGQ B;  4XUJ C;  3FDD A;  3AZL D;  1WWS A;  3B0D C;  1P3F B;  4KGC D;  3WAA A;  1BH9 B;  3VH5 A;  5GXQ A;  2ZY2 A;  3H0R C;  1ZLA B;  5B24 D;  3AN2 B;  2CV5 D;  4NFT A;  5GT3 D;  3EPL A;  2HIO D;  4H9P B;  3AZI C;  5AY8 A;  3AZG A;  2BYM B;  1P3L A;  1M18 C;  4KHA A;  3A1K A;  1P3B C;  4DRA A;  3A6N D;  2J8P A;  1P3A A;  3X1V A;  5B32 A;  1PZR A;  3W96 B;  5AVB C;  2DF4 C;  1T3U A;  4E45 A;  5BT1 C;  5AVC B;  3AZM A;  1KX3 A;  5F99 C;  4J8V A;  5CPK C;  3MGP B;  3AZJ D;  3AN2 D;  3WA9 A;  4CSR A;  4R8P A;  1N1J A;  3C1C C;  1M1A A;  1TZY B;  3NQJ A;  5B1L A;  4Z66 B;  3AFA B;  5B2J A;  3KFU G;  3EG5 B;  3MGQ A;  4LD9 A;  1P3I A;  5B1M A;  2FFF B;  1M18 B;  4J8X C;  3AZH D;  3MNN A;  3VH5 T;  5E5A A;  1P3B B;  4ZBJ C;  1P3F A;  3W96 D;  5AV5 D;  3AZN A;  4G92 C;  3C1B A;  4H9O B;  5AVC D;  1P3G D;  5F99 B;  3LEL C;  4H9Q A;  3MGP D;  3UTB C;  4J8W B;  3AZF A;  1KX4 A;  3REK C;  4KUD A;  1TZY D;  3C1C B;  4XZQ C;  5B31 G;  5B2I A;  2ARO B;  5AV6 C;  4Z66 D;  3AFA D;  3AZE D;  5G49 B;  3LZ0 C;  4XUJ A;  5DNN D;  3X1S C;  4ZBJ B;  3LZ1 D;  5AV8 D;  2FJ7 C;  2Y2J A;  3LJA C;  2BYK B;  4G92 B;  2Y2G A;  2F8N G;  4WU8 B;  3O62 D;  3UTB B;  3UT9 D;  4YM6 D;  3AYW D;  2G5I C;  2NQB D;  3REK B;  2ZY4 A;  1AOI B;  1M19 C;  4XZQ B;  2ARO D;  4UUZ B;  5C3I B;  2JSS A;  3AZI A;  4AWL B;  3LZ0 B;  2BG1 A;  5GSU D;  5CPJ C;  4E44 A;  3X1U D;  4J8U C;  3AZK C;  5AV9 B;  1M18 A;  4YS3 D;  2FJ7 B;  3VH5 W;  1P3B A;  3W99 C;  2Y2L A;  5AVB A;  4H9O A;  1HTA A;  2L5A A;  4WU8 D;  5F99 A;  4NE5 A;  5CPK A;  5CP6 D;  3AZL C;  1AOI D;  1P3O D;  4Z5T B;  3NQU B;  3C1C A;  4KGC C;  5BS7 C;  5G49 A;  3WTP E;  5AV9 D;  2DQN C;  4J8X A;  5B24 C;  5BNX B;  2CV5 C;  5JA4 B;  5GT3 C;  2HIO C;  3LEL A;  3AZL B;  3KWQ D;  1BH8 A;  3REK A;  4Z5T D;  2LY8 A;  4XZQ A;  4UUZ A;  5B40 D;  5AV6 A;  3A6N C;  1JFI A;  4KGC B;  4HGA C;  3LZ0 A;  4H9S C;  3REL B;  2PYO B;  3WKJ B;  3X1S A;  5BO0 B;  4WZS B;  3EPH A;  3REH B;  3LJA A;  5B24 B;  5B32 G;  3AZJ C;  3AN2 C;  2FJ7 A;  3P5J B;  3UTA A;  3V9R B;  4WNN B;  2XD5 A;  1P3P A;  4X23 D;  1P34 D;  3AZH C;  1A7W A;  1M19 A;  3A6N B;  3W96 C;  2HUE C;  5AV5 C;  1S32 B;  4HGA B;  3REL D;  5CPJ A;  1KU5 A;  4WU9 D;  5AVC C;  4J8U A;  2Y2H A;  3REJ B;  3AZK A;  1P3G C;  2PYO D;  3WKJ D;  3MGP C;  3B6G B;  3REH D;  2NZD D;  4Z2M H;  3AZJ B;  1ID3 B;  3W99 A;  5BNX A;  4H9R B;  1TZY C;  3AZE C;  4Z66 C;  3AFA C;  1U35 B;  5B33 B;  3W97 D;  5DNN C;  3AZL A;  5GT0 D;  3AZH B;  1B6W A;  2W8S A;  3LZ1 C;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...