3B6FA

Nucleosome core particle treated with cisplatin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fA00
5BO0B 5BNXA 1P3BB 3MGRA 3RELA 5CPKC 1M19A 3VH5T 5E5AC 4AWLC 5AY8C 4R8PB 1HQ3C 3MGSA 1KX4A 1R4VA 5B0YA 3R45A 1P3MC 3MGQD 5DNNB 3AYWC 4HGAB 3NQUA 3TU4B 3VH6A 1BH9A 2NZDD 3B0DB 3B0CT 5B1MA 1JFIB 5CPID 3B6GA 1P3FA 5B32A 4XZQB 4HGAC 1P34C 3NQJB 5FUGA 2NQBD 4YM6A 4J8XD 5CPIB 4H9RB 3MGQC 1M18A 2AROD 1P3IA 3LZ1A 5BNVA 4J8XB 2NZDC 1KX3D 4J8WB 5GSUB 3VH6W 3LJAA 1P3KA 1TAFA 5AV6B 1KX5A 2NQBC 3UTBA 3C1BD 5BO0A 1P3BA 3AZMA 5GXQB 5AVBD 4H9PA 2AROC 3UTAB 5GT3B 1S32A 4R8PA 1WWIA 3WTPE 4G92C 1KX3C 3AFAA 3MGPD 3X1VA 3REJB 5DNNA 4CSRB 1ID3B 3C1CD 4KGCB 3V9RA 3A6NB 1H3OB 3MGPB 4Z66B 3KWQB 3C1BC 1JFIA 5AVBC 5DNMA 1BH8B 4ZBJB 1M1AD 5B33D 5B40B 3W96D 4XZQA 3WTPA 1P3GA 3WAAB 1A7WA 3REHD 4CAYB 4J8VD 4YS3B 4H9RA 3AZED 3W96B 3LZ0A 3C1CC 4QLCD 5B2IB 3REIA 3WKJD 3AZHD 3W99D 5B31D 4J8WA 1EQZD 4XUJA 5GSUA 3AV2D 1M1AC 3KUYB 1B6WA 3B6FD 5B33C 2IO5B 5AV6A 3W96C 3AZHB 3AN2D 1U35A 3MVDD 4X23A 3REHC 4J8VC 3MGSD 3AZJB 4KUDB 1F66B 5GXQA 3UTAA 3AZEC 5GT3A 3MVDB 4QLCC 1P3AD 3WKJC 3AZHC 3AZIC 5JRGA 3W99C 5B31C 4Z5TD 1EQZC 3AV2C 3W98B 3B6FC 4CSRA 4WU8D 3AN2C 4KGCA 3MVDC 2HIOB 4JJND 4Z5TB 3MGSC 1TZYD 5B32D 3KWQA 5CPKB 4H9NB 5E5AB 4AWLB 5AY8B 4WU8B 3X1TA 3AYWD 1P3AC 4JJNB 5B40A 3WAAA 4LD9D 5AV9D 4Z5TC 3MNNA 1P3OD 1P3MB 5AV8D 3LELA 3X1SD 3AYWB 3AZLD 4WU8C 4ZUXD 3KSYA 5B2IA 3LJAD 1P3LD 5CP6D 4JJNC 1P34D 1P3OB 1TZYC 5B32C 1KU5A 5AVCA 5F99A 3AZLB 4WU9D 5B24A 3KUYA 1P34B 2YFVB 4Z2MG 1S32D 1P3PD 4LD9C 5AV9C 3AZJA 1P3OC 3MGQB 5AV8C 1F66A 2HUEC 3X1SC 2PYOA 4KUDA 3AZLC 5B0ZA 4ZUXC 3LJAC 1P3LC 5CP6C 2NZDB 2CV5A 3O62D 4J8UD 4UUZA 3X1UD 4WU9C 1ZLAD 3W98A 3UTBC 1F1EA 3AZMC 5DNMD 2HIOA 2NQBB 1S32C 1P3PC 2F8NA 2F8NK 5CPKA 2AROB 5E5AA 1AOIA 5AY8A 1HQ3A 3VH6T 5B2JD 3X1VC 3W97D 3O62C 4G92B 1KX3B 3LZ0D 4J8UC 3X1UC 1ZLAC 1P3MA 3REKD 2LY8A 3AV1D 3W97B 5DNMC 3UT9D 4XUJD 3KXBD 3C1BB 5AV5D 3WTPC 5AVBB 5B31G 5C3IC 3AZFD 4NE3A 4E45A 5B2JC 3TU4A 3AZND 2YFWB 3W97C 2YFVA 3LZ0C 4H9SC 3REIC 3WA9D 4EO5C 3MGQA 5BS7A 3REKC 5JRGD 3AV1C 3C1CB 3AZNB 3UT9C 4XUJC 2NZDA 5CPJD 3KXBC 5AV5C 3NQJA 1M1AB 1N1JB 5CPIA 5B33B 3AZFC 2FJ7D 5B1LD 3AZNC 3REHB 4J8VB 3AZKD 3AZID 2NQBA 4J8XA 3WA9C 5B32G 5GT0D 2AROA 3AZEB 5JRGC 3AZGD 4QLCB 3MNND 3WKJB 3AZKB 3AZIB 3MGRD 3RELD 1M19D 5CPJC 5B31B 1KX3A 3W99B 4NFTA 1EQZB 3AZGB 3AV2B 1KX4D 3B6FB 5B0YD 5CHLB 2FJ7C 1WWSA 5AVCD 3AN2B 2RVQD 4M6BA 5B1LC 5B24D 3MGSB 3AZKC 3C1BA 5GT0C 3AZGC 1Q9CA 3REJA 3MNNC 5B1MD 1P3AB 3MGRC 3LELC 3RELC 1M19C 1ID3A 2YFWA 3NQUB 1BH9B 5B0ZD 1H3OA 3A6NA 3MGPA 4Z66A 1P3FD 3B6GD 1KX4C 5B0YC 1BH8A 4DRAA 5AVCC 2RVQC 3C1CA 4YM6D 5B24C 1M18D 1P3FB 3VH5A 4H9QB 1TZYB 5B32B 1P3ID 4CAYA 4YS3A 1M1AA 5JA4B 3LZ1D 5B33A 5B1MC 3W96A 1AOID 3REHA 4J8VA 4LD9B 1P3KD 5AV9B 5B0ZC 3B6GC 3LZ1B 1P3FC 4DRBA 5AV8B 4WV4B 2HUEB 3X1SB 2CV5C 1KX5D 3AZEA 4ZUXB 4QLCA 4YM6C 3LJAB 3UTBD 1P3LB 5CP6B 3WKJA 3AZHA 1P3BD 3AZMD 1M18C 1P3IC 5B31A 3W99A 2BYMB 4R8PD 1EQZA 4WU9B 3AV2A 3LZ1C 5G49B 3B6FA 3B0BA 3UTBB 3VH5W 3AZMB 3AN2A 3AFAD 4H9PB 3MVDA 1HTAA 3X1VD 1AOIC 1S32B 1P3PB 1P3KC 5DNND 3TU4D 4H9OB 1KX5C 3AFAB 3X1VB 1P3AA 1P3BC 3O62B 4J8UB 3X1UB 4R8PC 4Z5TA 1ZLAB 3V9RB 4XZQD 3B0CW 3WTPD 1P3GD 4H9NA 4WU8A 5DNMB 3AFAC 4JJNA 1TZYA 4H9QA 5DNNC 3WTPB 1P3GB 3TU4C 5C3IB 3REID 5JA4A 5B2JB 3AYWA 3B0DC 5BS7C 4J8WD 5KDMB 5GSUD 3LZ0B 2BYKB 4LD9A 1B67A 5AV9A 3REIB 1P3OA 4EO5B 3REKB 5AV6D 5AV8A 4XZQC 1P3GC 3X1SA 3AV1B 1U35D 4X23D 3AZLA 4ZUXA 3UT9B 4XUJB 1P3LA 5CP6A 5CPIC 1P34A 3KXBB 5GXQD 5AV5B 3UTAD 5GT3D 1U35B 2BYMA 4X23B 4WU9A 5G49A 3AZFB 4KHAB 4J8XC 2F8NH 4J8WC 2CWEA 4NE5A 5GSUC 3REJD 1P3PA 4WNNB 3WA9B 5AV6C 1ID3D 5JRGB 4H9OA 1U35C 4KGCD 4X23C 3A6ND 4Z66D 3KWQD 5CPJB 3O62A 5GXQC 3UTAC 4J8UA 5GT3C 3X1UA 1ZLAA 3X1TD 5B40D 3WAAD 2FJ7B 1ULYA 5B1LB 4YS3D 4E44A 2L5AA 3REJC 3LELD 3X1TB 1ID3C 5GT0B 4KGCC 5B2ID 3A6NC 3MGPC 3MNNB 4Z66C 1BFMA 5B2JA 5BNXB 2F8NG 3MGRB 3KWQC 3LELB 3RELB 1M19B 3W97A 5F99D 5KDMA 4ZBJC 2BYKA 4H9SA 3KUYD 2JSSA 1KX4B 3X1TC 3REKA 5B40C 5AVBA 5B0YB 3WAAC 3AV1A 5AVCB 5F99B 3R45B 3UT9A 4YS3C 3AZJD 4G91B 5B24B 4KUDD 1F66D 2PYOD 3KXBA 5AV5A 5B2IC 3AZFA 2CV5D 4KHAA 5B1MB 2PYOB 3AZNA 5F99C 5BT1D 5B0ZB 4G91C 3KUYC 3B6GB 4WNNA 3W98D 3WA9A 2IO5C 2CV5B 5FUGB 2HIOD 4UUZB 1N1JA 4YM6B 2F8ND 3AZJC 1M18B 5CPKD 4KUDC 5CPJA 1F66C 2PYOC 1P3IB 5E5AD 5AY8D 1HQ3D 4Z2MH 5BNVB 2F8NB 4NE6A 2FJ7A 5B1LA 1AOIB 5BT1C 1P3KB 1HQ3B 4WZSB 3AZIA 3AZKA 1P3MD 1TAFB 3W98C 1KX5B 5GT0A 3AZGA 2HIOC
chains in the Genus database with same CATH superfamily
5BO0B 5BNXA 1P3BB 3MGRA 3RELA 5CPKC 1M19A 3VH5T 5E5AC 4AWLC 5AY8C 4R8PB 1HQ3C 3MGSA 1KX4A 1R4VA 5B0YA 3R45A 1P3MC 3MGQD 5DNNB 3AYWC 4HGAB 3NQUA 3TU4B 3VH6A 1BH9A 2NZDD 3B0DB 3B0CT 5B1MA 2ZY3A 1JFIB 5CPID 3B6GA 1P3FA 5B32A 4XZQB 4HGAC 1P34C 3NQJB 5FUGA 2NQBD 4YM6A 4J8XD 5CPIB 4H9RB 3MGQC 1M18A 2AROD 1P3IA 3LZ1A 5BNVA 4J8XB 2NZDC 2Y2LA 2Y2MA 2VQRA 1KX3D 4J8WB 5GSUB 3VH6W 3LJAA 1P3KA 1TAFA 5AV6B 1KX5A 2NQBC 3UTBA 3C1BD 5BO0A 1P3BA 3AZMA 5GXQB 5AVBD 4H9PA 2AROC 3UTAB 5GT3B 1S32A 4R8PA 1WWIA 2ZM5A 3WTPE 4G92C 1KX3C 3AFAA 3MGPD 3X1VA 3REJB 5DNNA 4CSRB 3A1IA 1ID3B 3C1CD 4KGCB 3V9RA 2RIQA 1H3OB 3A6NB 3MGPB 4Z66B 3KWQB 3C1BC 1JFIA 3P5JB 5AVBC 5DNMA 1BH8B 4ZBJB 1M1AD 5B33D 5B40B 3W96D 4XZQA 3WTPA 1P3GA 3H0LC 3WAAB 1A7WA 3REHD 4CAYB 2ZY4A 4J8VD 4YS3B 4H9RA 3AZED 3W96B 3LZ0A 3C1CC 2BG1A 4QLCD 2Y2QA 5B2IB 3REIA 3WKJD 3AZHD 2G5HC 3W99D 5B31D 4J8WA 1EQZD 4XUJA 5GSUA 1PZRA 3AV2D 3KUYB 1M1AC 1B6WA 3B6FD 5B33C 2IO5B 5AV6A 3W96C 3AZHB 3AN2D 1U35A 3MVDD 4X23A 3REHC 4J8VC 3MGSD 3AZJB 4KUDB 1F66B 5GXQA 3UTAA 3AZEC 5GT3A 3EPLA 3MVDB 4QLCC 1P3AD 3WKJC 3KFUG 3AZHC 3AZIC 5JRGA 3W99C 5B31C 4Z5TD 1EQZC 3AV2C 3W98B 3B6FC 2Y2IA 4CSRA 4WU8D 3AN2C 4KGCA 3MVDC 2HIOB 4JJND 4Z5TB 3MGSC 1TZYD 5B32D 3KWQA 5CPKB 4H9NB 5E5AB 4AWLB 5AY8B 4WU8B 3X1TA 3AYWD 1P3AC 4JJNB 5B40A 3WAAA 4DQYB 4LD9D 5AV9D 4Z5TC 3MNNA 1P3OD 1P3MB 5AV8D 3LELA 3X1SD 3EPJA 3AYWB 3AZLD 3A1KA 2XD1A 4WU8C 4ZUXD 3KSYA 5B2IA 3LJAD 1P3LD 5CP6D 4JJNC 1P34D 1P3OB 1TZYC 5B32C 1KU5A 5AVCA 5F99A 3AZLB 4WU9D 5B24A 3KUYA 1P34B 2YFVB 4Z2MG 1S32D 1P3PD 4LD9C 5AV9C 3AZJA 1P3OC 3MGQB 5AV8C 1F66A 2HUEC 3X1SC 2PYOA 4KUDA 3AZLC 5B0ZA 4ZUXC 3LJAC 1P3LC 5CP6C 2NZDB 2CV5A 3O62D 4J8UD 4UUZA 3X1UD 4WU9C 1ZLAD 2JCHA 3W98A 3UTBC 1F1EA 3AZMC 5DNMD 2HIOA 2NQBB 1S32C 1P3PC 2F8NA 2F8NK 5CPKA 2AROB 5E5AA 1AOIA 5AY8A 1HQ3A 3VH6T 5B2JD 3X1VC 3FDDA 3W97D 3O62C 4G92B 1KX3B 3LZ0D 4J8UC 3X1UC 1ZLAC 1P3MA 3REKD 2LY8A 3AV1D 3W97B 5DNMC 3UT9D 4XUJD 1T3UA 3KXBD 3C1BB 5AV5D 4WJ3C 3WTPC 5AVBB 5B31G 5C3IC 3H0RC 3AZFD 4NE3A 4E45A 5B2JC 3TU4A 3AZND 2YFWB 3W97C 2YFVA 2F2AC 3LZ0C 4H9SC 3REIC 3WA9D 4EO5C 3MGQA 5BS7A 3REKC 5JRGD 3AV1C 3C1CB 3AZNB 3UT9C 4XUJC 2NZDA 5CPJD 2Y2NA 3KXBC 5AV5C 3NQJA 1M1AB 1N1JB 5CPIA 5B33B 3AZFC 2FJ7D 5B1LD 3AZNC 3REHB 4J8VB 2DQNC 3AZKD 3AZID 2NQBA 4J8XA 3WA9C 5B32G 1Z2CB 2AROA 5GT0D 5JRGC 3AZEB 3AZGD 4QLCB 3MNND 3WKJB 3AZKB 3AZIB 3MGRD 3RELD 1M19D 5CPJC 5B31B 3IP4C 1KX3A 3W99B 4NFTA 1EQZB 3AZGB 3AV2B 1KX4D 3B6FB 5B0YD 5CHLB 2FJ7C 1WWSA 5AVCD 3AN2B 2RVQD 4M6BA 5B1LC 5B24D 3MGSB 3AZKC 3C1BA 2UWXA 5GT0C 3AZGC 1Q9CA 3REJA 3MNNC 5B1MD 1P3AB 3MGRC 3LELC 3RELC 1M19C 1ID3A 2YFWA 3NQUB 1BH9B 5B0ZD 1H3OA 3A6NA 3MGPA 4Z66A 1P3FD 3B6GD 1KX4C 5B0YC 1BH8A 4DRAA 5AVCC 2RVQC 3C1CA 3AL0C 4YM6D 5B24C 1M18D 1P3FB 3VH5A 1TZYB 4H9QB 2DF4C 5B32B 1P3ID 2Y2HA 4CAYA 4YS3A 1M1AA 5JA4B 3LZ1D 2G5IC 5B33A 5B1MC 3W96A 3F6TA 1AOID 3REHA 2Y2KA 3H0MC 4J8VA 1P3KD 5AV9B 5B0ZC 4LD9B 2XD5A 3B6GC 3LZ1B 1P3FC 4DRBA 5AV8B 4WV4B 2HUEB 3X1SB 2CV5C 1KX5D 3AZEA 1W2EA 4ZUXB 4QLCA 4YM6C 3LJAB 3UTBD 1P3LB 5CP6B 3WKJA 3AZHA 1P3BD 3AZMD 1M18C 1P3IC 5B31A 3W99A 2BYMB 4R8PD 1EQZA 4WU9B 3AV2A 3LZ1C 5G49B 3B6FA 3B0BA 3UTBB 3VH5W 3AZMB 2FFFB 3AN2A 3AFAD 4H9PB 3MVDA 1HTAA 3X1VD 1AOIC 1S32B 1P3PB 1P3KC 5DNND 3TU4D 4H9OB 1KX5C 3AFAB 3X1VB 1P3AA 2ZY5A 2JE5A 1P3BC 3O62B 4J8UB 2Y2GA 3X1UB 4R8PC 4Z5TA 1ZLAB 3V9RB 4XZQD 3B0CW 3WTPD 1P3GD 4H9NA 4WU8A 5DNMB 3AFAC 2Y2OA 3EPHA 4JJNA 1TZYA 4H9QA 5DNNC 3WTPB 1P3GB 3TU4C 5C3IB 2Y2PA 3REID 5JA4A 5B2JB 3AYWA 3B0DC 5BS7C 4J8WD 5KDMB 5GSUD 3LZ0B 2BYKB 4LD9A 1B67A 5AV9A 3REIB 1P3OA 4EO5B 3REKB 5AV6D 5AV8A 4XZQC 1P3GC 3X1SA 3AV1B 1U35D 4X23D 3AZLA 4ZUXA 3UT9B 4XUJB 1P3LA 5CP6A 5CPIC 1P34A 3KXBB 5GXQD 5AV5B 3UTAD 5GT3D 1U35B 2BYMA 4X23B 3EPKA 3EG5B 4WU9A 5G49A 3AZFB 4KHAB 4J8XC 2F8NH 4J8WC 2CWEA 4NE5A 5GSUC 3REJD 1P3PA 4WNNB 3WA9B 5AV6C 1ID3D 5JRGB 4H9OA 1U35C 4KGCD 4X23C 3A6ND 4Z66D 3KWQD 5CPJB 3O62A 5GXQC 3UTAC 4J8UA 5GT3C 3X1UA 1ZLAA 2ZY2A 3X1TD 5B40D 3WAAD 2FJ7B 1ULYA 5B1LB 4YS3D 4E44A 2L5AA 3REJC 3LELD 3X1TB 1ID3C 5GT0B 4KGCC 5B2ID 3A6NC 3MGPC 3MNNB 4Z66C 1BFMA 5B2JA 5BNXB 2F8NG 3MGRB 3KWQC 3LELB 3RELB 1M19B 3W97A 5F99D 5KDMA 4ZBJC 2BYKA 4H9SA 3KUYD 2JSSA 1KX4B 3X1TC 3REKA 5B40C 5AVBA 5B0YB 3WAAC 3AV1A 5AVCB 2Y2JA 5F99B 3R45B 3UT9A 4YS3C 3AZJD 4G91B 5B24B 4KUDD 1F66D 2PYOD 3KXBA 5AV5A 2J8PA 5B2IC 3AZFA 2CV5D 4KHAA 5B1MB 2PYOB 3AZNA 5F99C 5BT1D 5B0ZB 4G91C 3KUYC 3B6GB 4WNNA 3W98D 3WA9A 2IO5C 2CV5B 5FUGB 2HIOD 4UUZB 1N1JA 4YM6B 2F8ND 3AZJC 1M18B 5CPKD 4KUDC 5CPJA 1F66C 2PYOC 1P3IB 5E5AD 5AY8D 1HQ3D 4Z2MH 5BNVB 2F8NB 4NE6A 2FJ7A 5B1LA 1AOIB 2W8SA 5BT1C 1HQ3B 4WZSB 3AZIA 3AZKA 1P3KB 1TAFB 1P3MD 3W98C 1KX5B 5GT0A 3AZGA 4UPKA 2HIOC
chains in the Genus database with same CATH topology
5BO0B 5BNXA 1P3BB 3MGRA 3RELA 5CPKC 1M19A 3VH5T 5E5AC 4AWLC 5AY8C 4R8PB 1HQ3C 3MGSA 1KX4A 1R4VA 5B0YA 3R45A 1P3MC 3MGQD 5DNNB 3AYWC 4HGAB 3NQUA 3TU4B 3VH6A 1BH9A 2NZDD 3B0DB 3B0CT 5B1MA 2ZY3A 1JFIB 5CPID 3B6GA 1P3FA 5B32A 4XZQB 4HGAC 1P34C 3NQJB 5FUGA 2NQBD 4YM6A 4J8XD 5CPIB 4H9RB 3MGQC 1M18A 2AROD 1P3IA 3LZ1A 5BNVA 4J8XB 2NZDC 2Y2LA 2Y2MA 2VQRA 1KX3D 4J8WB 5GSUB 3VH6W 3LJAA 1P3KA 1TAFA 5AV6B 1KX5A 2NQBC 3UTBA 3C1BD 5BO0A 1P3BA 3AZMA 5GXQB 5AVBD 4H9PA 2AROC 3UTAB 5GT3B 1S32A 4R8PA 1WWIA 2ZM5A 3WTPE 4G92C 1KX3C 3AFAA 3MGPD 3X1VA 3REJB 5DNNA 4CSRB 3A1IA 1ID3B 3C1CD 4KGCB 3V9RA 2RIQA 1H3OB 3A6NB 3MGPB 4Z66B 3KWQB 3C1BC 1JFIA 3P5JB 5AVBC 5DNMA 1BH8B 4ZBJB 1M1AD 5B33D 5B40B 3W96D 4XZQA 3WTPA 1P3GA 3H0LC 3WAAB 1A7WA 3REHD 4CAYB 2ZY4A 4J8VD 4YS3B 4H9RA 3AZED 3W96B 3LZ0A 3C1CC 2BG1A 4QLCD 2Y2QA 5B2IB 3REIA 3WKJD 3AZHD 2G5HC 3W99D 5B31D 4J8WA 1EQZD 4XUJA 5GSUA 1PZRA 3AV2D 3KUYB 1M1AC 1B6WA 3B6FD 5B33C 2IO5B 5AV6A 3W96C 3AZHB 3AN2D 1U35A 3MVDD 4X23A 3REHC 4J8VC 3MGSD 3AZJB 4KUDB 1F66B 5GXQA 3UTAA 3AZEC 5GT3A 3EPLA 3MVDB 4QLCC 1P3AD 3WKJC 3KFUG 3AZHC 3AZIC 5JRGA 3W99C 5B31C 4Z5TD 1EQZC 3AV2C 3W98B 3B6FC 2Y2IA 4CSRA 4WU8D 3AN2C 4KGCA 3MVDC 2HIOB 4JJND 4Z5TB 3MGSC 1TZYD 5B32D 3KWQA 5CPKB 4H9NB 5E5AB 4AWLB 5AY8B 4WU8B 3X1TA 3AYWD 1P3AC 4JJNB 5B40A 3WAAA 4DQYB 4LD9D 5AV9D 4Z5TC 3MNNA 1P3OD 1P3MB 5AV8D 3LELA 3X1SD 3EPJA 3AYWB 3AZLD 3A1KA 2XD1A 4WU8C 4ZUXD 3KSYA 5B2IA 3LJAD 1P3LD 5CP6D 4JJNC 1P34D 1P3OB 1TZYC 5B32C 1KU5A 5AVCA 5F99A 3AZLB 4WU9D 5B24A 3KUYA 1P34B 2YFVB 4Z2MG 1S32D 1P3PD 4LD9C 5AV9C 3AZJA 1P3OC 3MGQB 5AV8C 1F66A 2HUEC 3X1SC 2PYOA 4KUDA 3AZLC 5B0ZA 4ZUXC 3LJAC 1P3LC 5CP6C 2NZDB 2CV5A 3O62D 4J8UD 4UUZA 3X1UD 4WU9C 1ZLAD 2JCHA 3W98A 3UTBC 1F1EA 3AZMC 5DNMD 2HIOA 2NQBB 1S32C 1P3PC 2F8NA 2F8NK 5CPKA 2AROB 5E5AA 1AOIA 5AY8A 1HQ3A 3VH6T 5B2JD 3X1VC 3FDDA 3W97D 3O62C 4G92B 1KX3B 3LZ0D 4J8UC 3X1UC 1ZLAC 1P3MA 3REKD 2LY8A 3AV1D 3W97B 5DNMC 3UT9D 4XUJD 1T3UA 3KXBD 3C1BB 5AV5D 4WJ3C 3WTPC 5AVBB 5B31G 5C3IC 3H0RC 3AZFD 4NE3A 4E45A 5B2JC 3TU4A 3AZND 2YFWB 3W97C 2YFVA 2F2AC 3LZ0C 4H9SC 3REIC 3WA9D 4EO5C 3MGQA 5BS7A 3REKC 5JRGD 3AV1C 3C1CB 3AZNB 3UT9C 4XUJC 2NZDA 5CPJD 2Y2NA 3KXBC 5AV5C 3NQJA 1M1AB 1N1JB 5CPIA 5B33B 3AZFC 2FJ7D 5B1LD 3AZNC 3REHB 4J8VB 2DQNC 3AZKD 3AZID 2NQBA 4J8XA 3WA9C 5B32G 1Z2CB 2AROA 5GT0D 5JRGC 3AZEB 3AZGD 4QLCB 3MNND 3WKJB 3AZKB 3AZIB 3MGRD 3RELD 1M19D 5CPJC 5B31B 3IP4C 1KX3A 3W99B 4NFTA 1EQZB 3AZGB 3AV2B 1KX4D 3B6FB 5B0YD 5CHLB 2FJ7C 1WWSA 5AVCD 3AN2B 2RVQD 4M6BA 5B1LC 5B24D 3MGSB 3AZKC 3C1BA 2UWXA 5GT0C 3AZGC 1Q9CA 3REJA 3MNNC 5B1MD 1P3AB 3MGRC 3LELC 3RELC 1M19C 1ID3A 2YFWA 3NQUB 1BH9B 5B0ZD 1H3OA 3A6NA 3MGPA 4Z66A 1P3FD 3B6GD 1KX4C 5B0YC 1BH8A 4DRAA 5AVCC 2RVQC 3C1CA 3AL0C 4YM6D 5B24C 1M18D 1P3FB 3VH5A 1TZYB 4H9QB 2DF4C 5B32B 1P3ID 2Y2HA 4CAYA 4YS3A 1M1AA 5JA4B 3LZ1D 2G5IC 5B33A 5B1MC 3W96A 3F6TA 1AOID 3REHA 2Y2KA 3H0MC 4J8VA 1P3KD 5AV9B 5B0ZC 4LD9B 2XD5A 3B6GC 3LZ1B 1P3FC 4DRBA 5AV8B 4WV4B 2HUEB 3X1SB 2CV5C 1KX5D 3AZEA 1W2EA 4ZUXB 4QLCA 4YM6C 3LJAB 3UTBD 1P3LB 5CP6B 3WKJA 3AZHA 1P3BD 3AZMD 1M18C 1P3IC 5B31A 3W99A 2BYMB 4R8PD 1EQZA 4WU9B 3AV2A 3LZ1C 5G49B 3B6FA 3B0BA 3UTBB 3VH5W 3AZMB 2FFFB 3AN2A 3AFAD 4H9PB 3MVDA 1HTAA 3X1VD 1AOIC 1S32B 1P3PB 1P3KC 5DNND 3TU4D 4H9OB 1KX5C 3AFAB 3X1VB 1P3AA 2ZY5A 2JE5A 1P3BC 3O62B 4J8UB 2Y2GA 3X1UB 4R8PC 4Z5TA 1ZLAB 3V9RB 4XZQD 3B0CW 3WTPD 1P3GD 4H9NA 4WU8A 5DNMB 3AFAC 2Y2OA 3EPHA 4JJNA 1TZYA 4H9QA 5DNNC 3WTPB 1P3GB 3TU4C 5C3IB 2Y2PA 3REID 5JA4A 5B2JB 3AYWA 3B0DC 5BS7C 4J8WD 5KDMB 5GSUD 3LZ0B 2BYKB 4LD9A 1B67A 5AV9A 3REIB 1P3OA 4EO5B 3REKB 5AV6D 5AV8A 4XZQC 1P3GC 3X1SA 3AV1B 1U35D 4X23D 3AZLA 4ZUXA 3UT9B 4XUJB 1P3LA 5CP6A 5CPIC 1P34A 3KXBB 5GXQD 5AV5B 3UTAD 5GT3D 1U35B 2BYMA 4X23B 3EPKA 3EG5B 4WU9A 5G49A 3AZFB 4KHAB 4J8XC 2F8NH 4J8WC 2CWEA 4NE5A 5GSUC 3REJD 1P3PA 4WNNB 3WA9B 5AV6C 1ID3D 5JRGB 4H9OA 1U35C 4KGCD 4X23C 3A6ND 4Z66D 3KWQD 5CPJB 3O62A 5GXQC 3UTAC 4J8UA 5GT3C 3X1UA 1ZLAA 2ZY2A 3X1TD 5B40D 3WAAD 2FJ7B 1ULYA 5B1LB 4YS3D 4E44A 2L5AA 3REJC 3LELD 3X1TB 1ID3C 5GT0B 4KGCC 5B2ID 3A6NC 3MGPC 3MNNB 4Z66C 1BFMA 5B2JA 5BNXB 2F8NG 3MGRB 3KWQC 3LELB 3RELB 1M19B 3W97A 5F99D 5KDMA 4ZBJC 2BYKA 4H9SA 3KUYD 2JSSA 1KX4B 3X1TC 3REKA 5B40C 5AVBA 5B0YB 3WAAC 3AV1A 5AVCB 2Y2JA 5F99B 3R45B 3UT9A 4YS3C 3AZJD 4G91B 5B24B 4KUDD 1F66D 2PYOD 3KXBA 5AV5A 2J8PA 5B2IC 3AZFA 2CV5D 4KHAA 5B1MB 2PYOB 3AZNA 5F99C 5BT1D 5B0ZB 4G91C 3KUYC 3B6GB 4WNNA 3W98D 3WA9A 2IO5C 2CV5B 5FUGB 2HIOD 4UUZB 1N1JA 4YM6B 2F8ND 3AZJC 1M18B 5CPKD 4KUDC 5CPJA 1F66C 2PYOC 1P3IB 5E5AD 5AY8D 1HQ3D 4Z2MH 5BNVB 2F8NB 4NE6A 2FJ7A 5B1LA 1AOIB 2W8SA 5BT1C 1HQ3B 4WZSB 3AZIA 3AZKA 1P3KB 1TAFB 1P3MD 3W98C 1KX5B 5GT0A 3AZGA 4UPKA 2HIOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BO0 B;  5BNX A;  1P3B B;  3MGR A;  3REL A;  5CPK C;  1M19 A;  3VH5 T;  5E5A C;  4AWL C;  5AY8 C;  4R8P B;  1HQ3 C;  3MGS A;  1KX4 A;  1R4V A;  5B0Y A;  3R45 A;  1P3M C;  3MGQ D;  5DNN B;  3AYW C;  4HGA B;  3NQU A;  3TU4 B;  3VH6 A;  1BH9 A;  2NZD D;  3B0D B;  3B0C T;  5B1M A;  1JFI B;  5CPI D;  3B6G A;  1P3F A;  5B32 A;  4XZQ B;  4HGA C;  1P34 C;  3NQJ B;  5FUG A;  2NQB D;  4YM6 A;  4J8X D;  5CPI B;  4H9R B;  3MGQ C;  1M18 A;  2ARO D;  1P3I A;  3LZ1 A;  5BNV A;  4J8X B;  2NZD C;  1KX3 D;  4J8W B;  5GSU B;  3VH6 W;  3LJA A;  1P3K A;  1TAF A;  5AV6 B;  1KX5 A;  2NQB C;  3UTB A;  3C1B D;  5BO0 A;  1P3B A;  3AZM A;  5GXQ B;  5AVB D;  4H9P A;  2ARO C;  3UTA B;  5GT3 B;  1S32 A;  4R8P A;  1WWI A;  3WTP E;  4G92 C;  1KX3 C;  3AFA A;  3MGP D;  3X1V A;  3REJ B;  5DNN A;  4CSR B;  1ID3 B;  3C1C D;  4KGC B;  3V9R A;  3A6N B;  1H3O B;  3MGP B;  4Z66 B;  3KWQ B;  3C1B C;  1JFI A;  5AVB C;  5DNM A;  1BH8 B;  4ZBJ B;  1M1A D;  5B33 D;  5B40 B;  3W96 D;  4XZQ A;  3WTP A;  1P3G A;  3WAA B;  1A7W A;  3REH D;  4CAY B;  4J8V D;  4YS3 B;  4H9R A;  3AZE D;  3W96 B;  3LZ0 A;  3C1C C;  4QLC D;  5B2I B;  3REI A;  3WKJ D;  3AZH D;  3W99 D;  5B31 D;  4J8W A;  1EQZ D;  4XUJ A;  5GSU A;  3AV2 D;  1M1A C;  3KUY B;  1B6W A;  3B6F D;  5B33 C;  2IO5 B;  5AV6 A;  3W96 C;  3AZH B;  3AN2 D;  1U35 A;  3MVD D;  4X23 A;  3REH C;  4J8V C;  3MGS D;  3AZJ B;  4KUD B;  1F66 B;  5GXQ A;  3UTA A;  3AZE C;  5GT3 A;  3MVD B;  4QLC C;  1P3A D;  3WKJ C;  3AZH C;  3AZI C;  5JRG A;  3W99 C;  5B31 C;  4Z5T D;  1EQZ C;  3AV2 C;  3W98 B;  3B6F C;  4CSR A;  4WU8 D;  3AN2 C;  4KGC A;  3MVD C;  2HIO B;  4JJN D;  4Z5T B;  3MGS C;  1TZY D;  5B32 D;  3KWQ A;  5CPK B;  4H9N B;  5E5A B;  4AWL B;  5AY8 B;  4WU8 B;  3X1T A;  3AYW D;  1P3A C;  4JJN B;  5B40 A;  3WAA A;  4LD9 D;  5AV9 D;  4Z5T C;  3MNN A;  1P3O D;  1P3M B;  5AV8 D;  3LEL A;  3X1S D;  3AYW B;  3AZL D;  4WU8 C;  4ZUX D;  3KSY A;  5B2I A;  3LJA D;  1P3L D;  5CP6 D;  4JJN C;  1P34 D;  1P3O B;  1TZY C;  5B32 C;  1KU5 A;  5AVC A;  5F99 A;  3AZL B;  4WU9 D;  5B24 A;  3KUY A;  1P34 B;  2YFV B;  4Z2M G;  1S32 D;  1P3P D;  4LD9 C;  5AV9 C;  3AZJ A;  1P3O C;  3MGQ B;  5AV8 C;  1F66 A;  2HUE C;  3X1S C;  2PYO A;  4KUD A;  3AZL C;  5B0Z A;  4ZUX C;  3LJA C;  1P3L C;  5CP6 C;  2NZD B;  2CV5 A;  3O62 D;  4J8U D;  4UUZ A;  3X1U D;  4WU9 C;  1ZLA D;  3W98 A;  3UTB C;  1F1E A;  3AZM C;  5DNM D;  2HIO A;  2NQB B;  1S32 C;  1P3P C;  2F8N A;  2F8N K;  5CPK A;  2ARO B;  5E5A A;  1AOI A;  5AY8 A;  1HQ3 A;  3VH6 T;  5B2J D;  3X1V C;  3W97 D;  3O62 C;  4G92 B;  1KX3 B;  3LZ0 D;  4J8U C;  3X1U C;  1ZLA C;  1P3M A;  3REK D;  2LY8 A;  3AV1 D;  3W97 B;  5DNM C;  3UT9 D;  4XUJ D;  3KXB D;  3C1B B;  5AV5 D;  3WTP C;  5AVB B;  5B31 G;  5C3I C;  3AZF D;  4NE3 A;  4E45 A;  5B2J C;  3TU4 A;  3AZN D;  2YFW B;  3W97 C;  2YFV A;  3LZ0 C;  4H9S C;  3REI C;  3WA9 D;  4EO5 C;  3MGQ A;  5BS7 A;  3REK C;  5JRG D;  3AV1 C;  3C1C B;  3AZN B;  3UT9 C;  4XUJ C;  2NZD A;  5CPJ D;  3KXB C;  5AV5 C;  3NQJ A;  1M1A B;  1N1J B;  5CPI A;  5B33 B;  3AZF C;  2FJ7 D;  5B1L D;  3AZN C;  3REH B;  4J8V B;  3AZK D;  3AZI D;  2NQB A;  4J8X A;  3WA9 C;  5B32 G;  5GT0 D;  2ARO A;  3AZE B;  5JRG C;  3AZG D;  4QLC B;  3MNN D;  3WKJ B;  3AZK B;  3AZI B;  3MGR D;  3REL D;  1M19 D;  5CPJ C;  5B31 B;  1KX3 A;  3W99 B;  4NFT A;  1EQZ B;  3AZG B;  3AV2 B;  1KX4 D;  3B6F B;  5B0Y D;  5CHL B;  2FJ7 C;  1WWS A;  5AVC D;  3AN2 B;  2RVQ D;  4M6B A;  5B1L C;  5B24 D;  3MGS B;  3AZK C;  3C1B A;  5GT0 C;  3AZG C;  1Q9C A;  3REJ A;  3MNN C;  5B1M D;  1P3A B;  3MGR C;  3LEL C;  3REL C;  1M19 C;  1ID3 A;  2YFW A;  3NQU B;  1BH9 B;  5B0Z D;  1H3O A;  3A6N A;  3MGP A;  4Z66 A;  1P3F D;  3B6G D;  1KX4 C;  5B0Y C;  1BH8 A;  4DRA A;  5AVC C;  2RVQ C;  3C1C A;  4YM6 D;  5B24 C;  1M18 D;  1P3F B;  3VH5 A;  4H9Q B;  1TZY B;  5B32 B;  1P3I D;  4CAY A;  4YS3 A;  1M1A A;  5JA4 B;  3LZ1 D;  5B33 A;  5B1M C;  3W96 A;  1AOI D;  3REH A;  4J8V A;  4LD9 B;  1P3K D;  5AV9 B;  5B0Z C;  3B6G C;  3LZ1 B;  1P3F C;  4DRB A;  5AV8 B;  4WV4 B;  2HUE B;  3X1S B;  2CV5 C;  1KX5 D;  3AZE A;  4ZUX B;  4QLC A;  4YM6 C;  3LJA B;  3UTB D;  1P3L B;  5CP6 B;  3WKJ A;  3AZH A;  1P3B D;  3AZM D;  1M18 C;  1P3I C;  5B31 A;  3W99 A;  2BYM B;  4R8P D;  1EQZ A;  4WU9 B;  3AV2 A;  3LZ1 C;  5G49 B;  3B6F A;  3B0B A;  3UTB B;  3VH5 W;  3AZM B;  3AN2 A;  3AFA D;  4H9P B;  3MVD A;  1HTA A;  3X1V D;  1AOI C;  1S32 B;  1P3P B;  1P3K C;  5DNN D;  3TU4 D;  4H9O B;  1KX5 C;  3AFA B;  3X1V B;  1P3A A;  1P3B C;  3O62 B;  4J8U B;  3X1U B;  4R8P C;  4Z5T A;  1ZLA B;  3V9R B;  4XZQ D;  3B0C W;  3WTP D;  1P3G D;  4H9N A;  4WU8 A;  5DNM B;  3AFA C;  4JJN A;  1TZY A;  4H9Q A;  5DNN C;  3WTP B;  1P3G B;  3TU4 C;  5C3I B;  3REI D;  5JA4 A;  5B2J B;  3AYW A;  3B0D C;  5BS7 C;  4J8W D;  5KDM B;  5GSU D;  3LZ0 B;  2BYK B;  4LD9 A;  1B67 A;  5AV9 A;  3REI B;  1P3O A;  4EO5 B;  3REK B;  5AV6 D;  5AV8 A;  4XZQ C;  1P3G C;  3X1S A;  3AV1 B;  1U35 D;  4X23 D;  3AZL A;  4ZUX A;  3UT9 B;  4XUJ B;  1P3L A;  5CP6 A;  5CPI C;  1P34 A;  3KXB B;  5GXQ D;  5AV5 B;  3UTA D;  5GT3 D;  1U35 B;  2BYM A;  4X23 B;  4WU9 A;  5G49 A;  3AZF B;  4KHA B;  4J8X C;  2F8N H;  4J8W C;  2CWE A;  4NE5 A;  5GSU C;  3REJ D;  1P3P A;  4WNN B;  3WA9 B;  5AV6 C;  1ID3 D;  5JRG B;  4H9O A;  1U35 C;  4KGC D;  4X23 C;  3A6N D;  4Z66 D;  3KWQ D;  5CPJ B;  3O62 A;  5GXQ C;  3UTA C;  4J8U A;  5GT3 C;  3X1U A;  1ZLA A;  3X1T D;  5B40 D;  3WAA D;  2FJ7 B;  1ULY A;  5B1L B;  4YS3 D;  4E44 A;  2L5A A;  3REJ C;  3LEL D;  3X1T B;  1ID3 C;  5GT0 B;  4KGC C;  5B2I D;  3A6N C;  3MGP C;  3MNN B;  4Z66 C;  1BFM A;  5B2J A;  5BNX B;  2F8N G;  3MGR B;  3KWQ C;  3LEL B;  3REL B;  1M19 B;  3W97 A;  5F99 D;  5KDM A;  4ZBJ C;  2BYK A;  4H9S A;  3KUY D;  2JSS A;  1KX4 B;  3X1T C;  3REK A;  5B40 C;  5AVB A;  5B0Y B;  3WAA C;  3AV1 A;  5AVC B;  5F99 B;  3R45 B;  3UT9 A;  4YS3 C;  3AZJ D;  4G91 B;  5B24 B;  4KUD D;  1F66 D;  2PYO D;  3KXB A;  5AV5 A;  5B2I C;  3AZF A;  2CV5 D;  4KHA A;  5B1M B;  2PYO B;  3AZN A;  5F99 C;  5BT1 D;  5B0Z B;  4G91 C;  3KUY C;  3B6G B;  4WNN A;  3W98 D;  3WA9 A;  2IO5 C;  2CV5 B;  5FUG B;  2HIO D;  4UUZ B;  1N1J A;  4YM6 B;  2F8N D;  3AZJ C;  1M18 B;  5CPK D;  4KUD C;  5CPJ A;  1F66 C;  2PYO C;  1P3I B;  5E5A D;  5AY8 D;  1HQ3 D;  4Z2M H;  5BNV B;  2F8N B;  4NE6 A;  2FJ7 A;  5B1L A;  1AOI B;  5BT1 C;  1P3K B;  1HQ3 B;  4WZS B;  3AZI A;  3AZK A;  1P3M D;  1TAF B;  3W98 C;  1KX5 B;  5GT0 A;  3AZG A;  2HIO C; 
#chains in the Genus database with same CATH topology
 5BO0 B;  5BNX A;  1P3B B;  3MGR A;  3REL A;  5CPK C;  1M19 A;  3VH5 T;  5E5A C;  4AWL C;  5AY8 C;  4R8P B;  1HQ3 C;  3MGS A;  1KX4 A;  1R4V A;  5B0Y A;  3R45 A;  1P3M C;  3MGQ D;  5DNN B;  3AYW C;  4HGA B;  3NQU A;  3TU4 B;  3VH6 A;  1BH9 A;  2NZD D;  3B0D B;  3B0C T;  5B1M A;  2ZY3 A;  1JFI B;  5CPI D;  3B6G A;  1P3F A;  5B32 A;  4XZQ B;  4HGA C;  1P34 C;  3NQJ B;  5FUG A;  2NQB D;  4YM6 A;  4J8X D;  5CPI B;  4H9R B;  3MGQ C;  1M18 A;  2ARO D;  1P3I A;  3LZ1 A;  5BNV A;  4J8X B;  2NZD C;  2Y2L A;  2Y2M A;  2VQR A;  1KX3 D;  4J8W B;  5GSU B;  3VH6 W;  3LJA A;  1P3K A;  1TAF A;  5AV6 B;  1KX5 A;  2NQB C;  3UTB A;  3C1B D;  5BO0 A;  1P3B A;  3AZM A;  5GXQ B;  5AVB D;  4H9P A;  2ARO C;  3UTA B;  5GT3 B;  1S32 A;  4R8P A;  1WWI A;  2ZM5 A;  3WTP E;  4G92 C;  1KX3 C;  3AFA A;  3MGP D;  3X1V A;  3REJ B;  5DNN A;  4CSR B;  3A1I A;  1ID3 B;  3C1C D;  4KGC B;  3V9R A;  2RIQ A;  1H3O B;  3A6N B;  3MGP B;  4Z66 B;  3KWQ B;  3C1B C;  1JFI A;  3P5J B;  5AVB C;  5DNM A;  1BH8 B;  4ZBJ B;  1M1A D;  5B33 D;  5B40 B;  3W96 D;  4XZQ A;  3WTP A;  1P3G A;  3H0L C;  3WAA B;  1A7W A;  3REH D;  4CAY B;  2ZY4 A;  4J8V D;  4YS3 B;  4H9R A;  3AZE D;  3W96 B;  3LZ0 A;  3C1C C;  2BG1 A;  4QLC D;  2Y2Q A;  5B2I B;  3REI A;  3WKJ D;  3AZH D;  2G5H C;  3W99 D;  5B31 D;  4J8W A;  1EQZ D;  4XUJ A;  5GSU A;  1PZR A;  3AV2 D;  3KUY B;  1M1A C;  1B6W A;  3B6F D;  5B33 C;  2IO5 B;  5AV6 A;  3W96 C;  3AZH B;  3AN2 D;  1U35 A;  3MVD D;  4X23 A;  3REH C;  4J8V C;  3MGS D;  3AZJ B;  4KUD B;  1F66 B;  5GXQ A;  3UTA A;  3AZE C;  5GT3 A;  3EPL A;  3MVD B;  4QLC C;  1P3A D;  3WKJ C;  3KFU G;  3AZH C;  3AZI C;  5JRG A;  3W99 C;  5B31 C;  4Z5T D;  1EQZ C;  3AV2 C;  3W98 B;  3B6F C;  2Y2I A;  4CSR A;  4WU8 D;  3AN2 C;  4KGC A;  3MVD C;  2HIO B;  4JJN D;  4Z5T B;  3MGS C;  1TZY D;  5B32 D;  3KWQ A;  5CPK B;  4H9N B;  5E5A B;  4AWL B;  5AY8 B;  4WU8 B;  3X1T A;  3AYW D;  1P3A C;  4JJN B;  5B40 A;  3WAA A;  4DQY B;  4LD9 D;  5AV9 D;  4Z5T C;  3MNN A;  1P3O D;  1P3M B;  5AV8 D;  3LEL A;  3X1S D;  3EPJ A;  3AYW B;  3AZL D;  3A1K A;  2XD1 A;  4WU8 C;  4ZUX D;  3KSY A;  5B2I A;  3LJA D;  1P3L D;  5CP6 D;  4JJN C;  1P34 D;  1P3O B;  1TZY C;  5B32 C;  1KU5 A;  5AVC A;  5F99 A;  3AZL B;  4WU9 D;  5B24 A;  3KUY A;  1P34 B;  2YFV B;  4Z2M G;  1S32 D;  1P3P D;  4LD9 C;  5AV9 C;  3AZJ A;  1P3O C;  3MGQ B;  5AV8 C;  1F66 A;  2HUE C;  3X1S C;  2PYO A;  4KUD A;  3AZL C;  5B0Z A;  4ZUX C;  3LJA C;  1P3L C;  5CP6 C;  2NZD B;  2CV5 A;  3O62 D;  4J8U D;  4UUZ A;  3X1U D;  4WU9 C;  1ZLA D;  2JCH A;  3W98 A;  3UTB C;  1F1E A;  3AZM C;  5DNM D;  2HIO A;  2NQB B;  1S32 C;  1P3P C;  2F8N A;  2F8N K;  5CPK A;  2ARO B;  5E5A A;  1AOI A;  5AY8 A;  1HQ3 A;  3VH6 T;  5B2J D;  3X1V C;  3FDD A;  3W97 D;  3O62 C;  4G92 B;  1KX3 B;  3LZ0 D;  4J8U C;  3X1U C;  1ZLA C;  1P3M A;  3REK D;  2LY8 A;  3AV1 D;  3W97 B;  5DNM C;  3UT9 D;  4XUJ D;  1T3U A;  3KXB D;  3C1B B;  5AV5 D;  4WJ3 C;  3WTP C;  5AVB B;  5B31 G;  5C3I C;  3H0R C;  3AZF D;  4NE3 A;  4E45 A;  5B2J C;  3TU4 A;  3AZN D;  2YFW B;  3W97 C;  2YFV A;  2F2A C;  3LZ0 C;  4H9S C;  3REI C;  3WA9 D;  4EO5 C;  3MGQ A;  5BS7 A;  3REK C;  5JRG D;  3AV1 C;  3C1C B;  3AZN B;  3UT9 C;  4XUJ C;  2NZD A;  5CPJ D;  2Y2N A;  3KXB C;  5AV5 C;  3NQJ A;  1M1A B;  1N1J B;  5CPI A;  5B33 B;  3AZF C;  2FJ7 D;  5B1L D;  3AZN C;  3REH B;  4J8V B;  2DQN C;  3AZK D;  3AZI D;  2NQB A;  4J8X A;  3WA9 C;  5B32 G;  1Z2C B;  2ARO A;  5GT0 D;  5JRG C;  3AZE B;  3AZG D;  4QLC B;  3MNN D;  3WKJ B;  3AZK B;  3AZI B;  3MGR D;  3REL D;  1M19 D;  5CPJ C;  5B31 B;  3IP4 C;  1KX3 A;  3W99 B;  4NFT A;  1EQZ B;  3AZG B;  3AV2 B;  1KX4 D;  3B6F B;  5B0Y D;  5CHL B;  2FJ7 C;  1WWS A;  5AVC D;  3AN2 B;  2RVQ D;  4M6B A;  5B1L C;  5B24 D;  3MGS B;  3AZK C;  3C1B A;  2UWX A;  5GT0 C;  3AZG C;  1Q9C A;  3REJ A;  3MNN C;  5B1M D;  1P3A B;  3MGR C;  3LEL C;  3REL C;  1M19 C;  1ID3 A;  2YFW A;  3NQU B;  1BH9 B;  5B0Z D;  1H3O A;  3A6N A;  3MGP A;  4Z66 A;  1P3F D;  3B6G D;  1KX4 C;  5B0Y C;  1BH8 A;  4DRA A;  5AVC C;  2RVQ C;  3C1C A;  3AL0 C;  4YM6 D;  5B24 C;  1M18 D;  1P3F B;  3VH5 A;  1TZY B;  4H9Q B;  2DF4 C;  5B32 B;  1P3I D;  2Y2H A;  4CAY A;  4YS3 A;  1M1A A;  5JA4 B;  3LZ1 D;  2G5I C;  5B33 A;  5B1M C;  3W96 A;  3F6T A;  1AOI D;  3REH A;  2Y2K A;  3H0M C;  4J8V A;  1P3K D;  5AV9 B;  5B0Z C;  4LD9 B;  2XD5 A;  3B6G C;  3LZ1 B;  1P3F C;  4DRB A;  5AV8 B;  4WV4 B;  2HUE B;  3X1S B;  2CV5 C;  1KX5 D;  3AZE A;  1W2E A;  4ZUX B;  4QLC A;  4YM6 C;  3LJA B;  3UTB D;  1P3L B;  5CP6 B;  3WKJ A;  3AZH A;  1P3B D;  3AZM D;  1M18 C;  1P3I C;  5B31 A;  3W99 A;  2BYM B;  4R8P D;  1EQZ A;  4WU9 B;  3AV2 A;  3LZ1 C;  5G49 B;  3B6F A;  3B0B A;  3UTB B;  3VH5 W;  3AZM B;  2FFF B;  3AN2 A;  3AFA D;  4H9P B;  3MVD A;  1HTA A;  3X1V D;  1AOI C;  1S32 B;  1P3P B;  1P3K C;  5DNN D;  3TU4 D;  4H9O B;  1KX5 C;  3AFA B;  3X1V B;  1P3A A;  2ZY5 A;  2JE5 A;  1P3B C;  3O62 B;  4J8U B;  2Y2G A;  3X1U B;  4R8P C;  4Z5T A;  1ZLA B;  3V9R B;  4XZQ D;  3B0C W;  3WTP D;  1P3G D;  4H9N A;  4WU8 A;  5DNM B;  3AFA C;  2Y2O A;  3EPH A;  4JJN A;  1TZY A;  4H9Q A;  5DNN C;  3WTP B;  1P3G B;  3TU4 C;  5C3I B;  2Y2P A;  3REI D;  5JA4 A;  5B2J B;  3AYW A;  3B0D C;  5BS7 C;  4J8W D;  5KDM B;  5GSU D;  3LZ0 B;  2BYK B;  4LD9 A;  1B67 A;  5AV9 A;  3REI B;  1P3O A;  4EO5 B;  3REK B;  5AV6 D;  5AV8 A;  4XZQ C;  1P3G C;  3X1S A;  3AV1 B;  1U35 D;  4X23 D;  3AZL A;  4ZUX A;  3UT9 B;  4XUJ B;  1P3L A;  5CP6 A;  5CPI C;  1P34 A;  3KXB B;  5GXQ D;  5AV5 B;  3UTA D;  5GT3 D;  1U35 B;  2BYM A;  4X23 B;  3EPK A;  3EG5 B;  4WU9 A;  5G49 A;  3AZF B;  4KHA B;  4J8X C;  2F8N H;  4J8W C;  2CWE A;  4NE5 A;  5GSU C;  3REJ D;  1P3P A;  4WNN B;  3WA9 B;  5AV6 C;  1ID3 D;  5JRG B;  4H9O A;  1U35 C;  4KGC D;  4X23 C;  3A6N D;  4Z66 D;  3KWQ D;  5CPJ B;  3O62 A;  5GXQ C;  3UTA C;  4J8U A;  5GT3 C;  3X1U A;  1ZLA A;  2ZY2 A;  3X1T D;  5B40 D;  3WAA D;  2FJ7 B;  1ULY A;  5B1L B;  4YS3 D;  4E44 A;  2L5A A;  3REJ C;  3LEL D;  3X1T B;  1ID3 C;  5GT0 B;  4KGC C;  5B2I D;  3A6N C;  3MGP C;  3MNN B;  4Z66 C;  1BFM A;  5B2J A;  5BNX B;  2F8N G;  3MGR B;  3KWQ C;  3LEL B;  3REL B;  1M19 B;  3W97 A;  5F99 D;  5KDM A;  4ZBJ C;  2BYK A;  4H9S A;  3KUY D;  2JSS A;  1KX4 B;  3X1T C;  3REK A;  5B40 C;  5AVB A;  5B0Y B;  3WAA C;  3AV1 A;  5AVC B;  2Y2J A;  5F99 B;  3R45 B;  3UT9 A;  4YS3 C;  3AZJ D;  4G91 B;  5B24 B;  4KUD D;  1F66 D;  2PYO D;  3KXB A;  5AV5 A;  2J8P A;  5B2I C;  3AZF A;  2CV5 D;  4KHA A;  5B1M B;  2PYO B;  3AZN A;  5F99 C;  5BT1 D;  5B0Z B;  4G91 C;  3KUY C;  3B6G B;  4WNN A;  3W98 D;  3WA9 A;  2IO5 C;  2CV5 B;  5FUG B;  2HIO D;  4UUZ B;  1N1J A;  4YM6 B;  2F8N D;  3AZJ C;  1M18 B;  5CPK D;  4KUD C;  5CPJ A;  1F66 C;  2PYO C;  1P3I B;  5E5A D;  5AY8 D;  1HQ3 D;  4Z2M H;  5BNV B;  2F8N B;  4NE6 A;  2FJ7 A;  5B1L A;  1AOI B;  2W8S A;  5BT1 C;  1HQ3 B;  4WZS B;  3AZI A;  3AZK A;  1P3K B;  1TAF B;  1P3M D;  3W98 C;  1KX5 B;  5GT0 A;  3AZG A;  4UPK A;  2HIO C; 
#chains in the Genus database with same CATH homology
 5BO0 B;  5BNX A;  1P3B B;  3MGR A;  3REL A;  5CPK C;  1M19 A;  3VH5 T;  5E5A C;  4AWL C;  5AY8 C;  4R8P B;  1HQ3 C;  3MGS A;  1KX4 A;  1R4V A;  5B0Y A;  3R45 A;  1P3M C;  3MGQ D;  5DNN B;  3AYW C;  4HGA B;  3NQU A;  3TU4 B;  3VH6 A;  1BH9 A;  2NZD D;  3B0D B;  3B0C T;  5B1M A;  2ZY3 A;  1JFI B;  5CPI D;  3B6G A;  1P3F A;  5B32 A;  4XZQ B;  4HGA C;  1P34 C;  3NQJ B;  5FUG A;  2NQB D;  4YM6 A;  4J8X D;  5CPI B;  4H9R B;  3MGQ C;  1M18 A;  2ARO D;  1P3I A;  3LZ1 A;  5BNV A;  4J8X B;  2NZD C;  2Y2L A;  2Y2M A;  2VQR A;  1KX3 D;  4J8W B;  5GSU B;  3VH6 W;  3LJA A;  1P3K A;  1TAF A;  5AV6 B;  1KX5 A;  2NQB C;  3UTB A;  3C1B D;  5BO0 A;  1P3B A;  3AZM A;  5GXQ B;  5AVB D;  4H9P A;  2ARO C;  3UTA B;  5GT3 B;  1S32 A;  4R8P A;  1WWI A;  2ZM5 A;  3WTP E;  4G92 C;  1KX3 C;  3AFA A;  3MGP D;  3X1V A;  3REJ B;  5DNN A;  4CSR B;  3A1I A;  1ID3 B;  3C1C D;  4KGC B;  3V9R A;  2RIQ A;  1H3O B;  3A6N B;  3MGP B;  4Z66 B;  3KWQ B;  3C1B C;  1JFI A;  3P5J B;  5AVB C;  5DNM A;  1BH8 B;  4ZBJ B;  1M1A D;  5B33 D;  5B40 B;  3W96 D;  4XZQ A;  3WTP A;  1P3G A;  3H0L C;  3WAA B;  1A7W A;  3REH D;  4CAY B;  2ZY4 A;  4J8V D;  4YS3 B;  4H9R A;  3AZE D;  3W96 B;  3LZ0 A;  3C1C C;  2BG1 A;  4QLC D;  2Y2Q A;  5B2I B;  3REI A;  3WKJ D;  3AZH D;  2G5H C;  3W99 D;  5B31 D;  4J8W A;  1EQZ D;  4XUJ A;  5GSU A;  1PZR A;  3AV2 D;  3KUY B;  1M1A C;  1B6W A;  3B6F D;  5B33 C;  2IO5 B;  5AV6 A;  3W96 C;  3AZH B;  3AN2 D;  1U35 A;  3MVD D;  4X23 A;  3REH C;  4J8V C;  3MGS D;  3AZJ B;  4KUD B;  1F66 B;  5GXQ A;  3UTA A;  3AZE C;  5GT3 A;  3EPL A;  3MVD B;  4QLC C;  1P3A D;  3WKJ C;  3KFU G;  3AZH C;  3AZI C;  5JRG A;  3W99 C;  5B31 C;  4Z5T D;  1EQZ C;  3AV2 C;  3W98 B;  3B6F C;  2Y2I A;  4CSR A;  4WU8 D;  3AN2 C;  4KGC A;  3MVD C;  2HIO B;  4JJN D;  4Z5T B;  3MGS C;  1TZY D;  5B32 D;  3KWQ A;  5CPK B;  4H9N B;  5E5A B;  4AWL B;  5AY8 B;  4WU8 B;  3X1T A;  3AYW D;  1P3A C;  4JJN B;  5B40 A;  3WAA A;  4DQY B;  4LD9 D;  5AV9 D;  4Z5T C;  3MNN A;  1P3O D;  1P3M B;  5AV8 D;  3LEL A;  3X1S D;  3EPJ A;  3AYW B;  3AZL D;  3A1K A;  2XD1 A;  4WU8 C;  4ZUX D;  3KSY A;  5B2I A;  3LJA D;  1P3L D;  5CP6 D;  4JJN C;  1P34 D;  1P3O B;  1TZY C;  5B32 C;  1KU5 A;  5AVC A;  5F99 A;  3AZL B;  4WU9 D;  5B24 A;  3KUY A;  1P34 B;  2YFV B;  4Z2M G;  1S32 D;  1P3P D;  4LD9 C;  5AV9 C;  3AZJ A;  1P3O C;  3MGQ B;  5AV8 C;  1F66 A;  2HUE C;  3X1S C;  2PYO A;  4KUD A;  3AZL C;  5B0Z A;  4ZUX C;  3LJA C;  1P3L C;  5CP6 C;  2NZD B;  2CV5 A;  3O62 D;  4J8U D;  4UUZ A;  3X1U D;  4WU9 C;  1ZLA D;  2JCH A;  3W98 A;  3UTB C;  1F1E A;  3AZM C;  5DNM D;  2HIO A;  2NQB B;  1S32 C;  1P3P C;  2F8N A;  2F8N K;  5CPK A;  2ARO B;  5E5A A;  1AOI A;  5AY8 A;  1HQ3 A;  3VH6 T;  5B2J D;  3X1V C;  3FDD A;  3W97 D;  3O62 C;  4G92 B;  1KX3 B;  3LZ0 D;  4J8U C;  3X1U C;  1ZLA C;  1P3M A;  3REK D;  2LY8 A;  3AV1 D;  3W97 B;  5DNM C;  3UT9 D;  4XUJ D;  1T3U A;  3KXB D;  3C1B B;  5AV5 D;  4WJ3 C;  3WTP C;  5AVB B;  5B31 G;  5C3I C;  3H0R C;  3AZF D;  4NE3 A;  4E45 A;  5B2J C;  3TU4 A;  3AZN D;  2YFW B;  3W97 C;  2YFV A;  2F2A C;  3LZ0 C;  4H9S C;  3REI C;  3WA9 D;  4EO5 C;  3MGQ A;  5BS7 A;  3REK C;  5JRG D;  3AV1 C;  3C1C B;  3AZN B;  3UT9 C;  4XUJ C;  2NZD A;  5CPJ D;  2Y2N A;  3KXB C;  5AV5 C;  3NQJ A;  1M1A B;  1N1J B;  5CPI A;  5B33 B;  3AZF C;  2FJ7 D;  5B1L D;  3AZN C;  3REH B;  4J8V B;  2DQN C;  3AZK D;  3AZI D;  2NQB A;  4J8X A;  3WA9 C;  5B32 G;  1Z2C B;  2ARO A;  5GT0 D;  5JRG C;  3AZE B;  3AZG D;  4QLC B;  3MNN D;  3WKJ B;  3AZK B;  3AZI B;  3MGR D;  3REL D;  1M19 D;  5CPJ C;  5B31 B;  3IP4 C;  1KX3 A;  3W99 B;  4NFT A;  1EQZ B;  3AZG B;  3AV2 B;  1KX4 D;  3B6F B;  5B0Y D;  5CHL B;  2FJ7 C;  1WWS A;  5AVC D;  3AN2 B;  2RVQ D;  4M6B A;  5B1L C;  5B24 D;  3MGS B;  3AZK C;  3C1B A;  2UWX A;  5GT0 C;  3AZG C;  1Q9C A;  3REJ A;  3MNN C;  5B1M D;  1P3A B;  3MGR C;  3LEL C;  3REL C;  1M19 C;  1ID3 A;  2YFW A;  3NQU B;  1BH9 B;  5B0Z D;  1H3O A;  3A6N A;  3MGP A;  4Z66 A;  1P3F D;  3B6G D;  1KX4 C;  5B0Y C;  1BH8 A;  4DRA A;  5AVC C;  2RVQ C;  3C1C A;  3AL0 C;  4YM6 D;  5B24 C;  1M18 D;  1P3F B;  3VH5 A;  1TZY B;  4H9Q B;  2DF4 C;  5B32 B;  1P3I D;  2Y2H A;  4CAY A;  4YS3 A;  1M1A A;  5JA4 B;  3LZ1 D;  2G5I C;  5B33 A;  5B1M C;  3W96 A;  3F6T A;  1AOI D;  3REH A;  2Y2K A;  3H0M C;  4J8V A;  1P3K D;  5AV9 B;  5B0Z C;  4LD9 B;  2XD5 A;  3B6G C;  3LZ1 B;  1P3F C;  4DRB A;  5AV8 B;  4WV4 B;  2HUE B;  3X1S B;  2CV5 C;  1KX5 D;  3AZE A;  1W2E A;  4ZUX B;  4QLC A;  4YM6 C;  3LJA B;  3UTB D;  1P3L B;  5CP6 B;  3WKJ A;  3AZH A;  1P3B D;  3AZM D;  1M18 C;  1P3I C;  5B31 A;  3W99 A;  2BYM B;  4R8P D;  1EQZ A;  4WU9 B;  3AV2 A;  3LZ1 C;  5G49 B;  3B6F A;  3B0B A;  3UTB B;  3VH5 W;  3AZM B;  2FFF B;  3AN2 A;  3AFA D;  4H9P B;  3MVD A;  1HTA A;  3X1V D;  1AOI C;  1S32 B;  1P3P B;  1P3K C;  5DNN D;  3TU4 D;  4H9O B;  1KX5 C;  3AFA B;  3X1V B;  1P3A A;  2ZY5 A;  2JE5 A;  1P3B C;  3O62 B;  4J8U B;  2Y2G A;  3X1U B;  4R8P C;  4Z5T A;  1ZLA B;  3V9R B;  4XZQ D;  3B0C W;  3WTP D;  1P3G D;  4H9N A;  4WU8 A;  5DNM B;  3AFA C;  2Y2O A;  3EPH A;  4JJN A;  1TZY A;  4H9Q A;  5DNN C;  3WTP B;  1P3G B;  3TU4 C;  5C3I B;  2Y2P A;  3REI D;  5JA4 A;  5B2J B;  3AYW A;  3B0D C;  5BS7 C;  4J8W D;  5KDM B;  5GSU D;  3LZ0 B;  2BYK B;  4LD9 A;  1B67 A;  5AV9 A;  3REI B;  1P3O A;  4EO5 B;  3REK B;  5AV6 D;  5AV8 A;  4XZQ C;  1P3G C;  3X1S A;  3AV1 B;  1U35 D;  4X23 D;  3AZL A;  4ZUX A;  3UT9 B;  4XUJ B;  1P3L A;  5CP6 A;  5CPI C;  1P34 A;  3KXB B;  5GXQ D;  5AV5 B;  3UTA D;  5GT3 D;  1U35 B;  2BYM A;  4X23 B;  3EPK A;  3EG5 B;  4WU9 A;  5G49 A;  3AZF B;  4KHA B;  4J8X C;  2F8N H;  4J8W C;  2CWE A;  4NE5 A;  5GSU C;  3REJ D;  1P3P A;  4WNN B;  3WA9 B;  5AV6 C;  1ID3 D;  5JRG B;  4H9O A;  1U35 C;  4KGC D;  4X23 C;  3A6N D;  4Z66 D;  3KWQ D;  5CPJ B;  3O62 A;  5GXQ C;  3UTA C;  4J8U A;  5GT3 C;  3X1U A;  1ZLA A;  2ZY2 A;  3X1T D;  5B40 D;  3WAA D;  2FJ7 B;  1ULY A;  5B1L B;  4YS3 D;  4E44 A;  2L5A A;  3REJ C;  3LEL D;  3X1T B;  1ID3 C;  5GT0 B;  4KGC C;  5B2I D;  3A6N C;  3MGP C;  3MNN B;  4Z66 C;  1BFM A;  5B2J A;  5BNX B;  2F8N G;  3MGR B;  3KWQ C;  3LEL B;  3REL B;  1M19 B;  3W97 A;  5F99 D;  5KDM A;  4ZBJ C;  2BYK A;  4H9S A;  3KUY D;  2JSS A;  1KX4 B;  3X1T C;  3REK A;  5B40 C;  5AVB A;  5B0Y B;  3WAA C;  3AV1 A;  5AVC B;  2Y2J A;  5F99 B;  3R45 B;  3UT9 A;  4YS3 C;  3AZJ D;  4G91 B;  5B24 B;  4KUD D;  1F66 D;  2PYO D;  3KXB A;  5AV5 A;  2J8P A;  5B2I C;  3AZF A;  2CV5 D;  4KHA A;  5B1M B;  2PYO B;  3AZN A;  5F99 C;  5BT1 D;  5B0Z B;  4G91 C;  3KUY C;  3B6G B;  4WNN A;  3W98 D;  3WA9 A;  2IO5 C;  2CV5 B;  5FUG B;  2HIO D;  4UUZ B;  1N1J A;  4YM6 B;  2F8N D;  3AZJ C;  1M18 B;  5CPK D;  4KUD C;  5CPJ A;  1F66 C;  2PYO C;  1P3I B;  5E5A D;  5AY8 D;  1HQ3 D;  4Z2M H;  5BNV B;  2F8N B;  4NE6 A;  2FJ7 A;  5B1L A;  1AOI B;  2W8S A;  5BT1 C;  1HQ3 B;  4WZS B;  3AZI A;  3AZK A;  1P3K B;  1TAF B;  1P3M D;  3W98 C;  1KX5 B;  5GT0 A;  3AZG A;  4UPK A;  2HIO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...