3B6FA

Nucleosome core particle treated with cisplatin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fA00
5CPIB 1P3GA 1F1EA 1M1AD 3REKC 4J8WD 3C1BC 3AZNC 3AZED 3AZID 3MGPD 3O62C 2NQBB 1ULYA 3X1UD 3LELA 5KDMB 4J8VD 5B33C 4J8WC 5DNMB 3R45B 5AV5B 3AZIC 5C3IB 3X1UC 3MNNB 3C1BA 3REKA 4H9NA 5AY8C 3AZNA 1ID3C 5AVBD 4J8VC 3O62A 5BS7C 5DNNB 3C1CD 5B40D 1WWSA 5GXQB 5B33A 2NZDD 3AV2D 3UT9B 4YS3C 5AY8A 1ID3A 3WAAC 4CSRB 5BS7A 2BYKB 5B1LA 3AV2C 5B31D 3X1VC 1H3OB 4X23D 5B24B 1EQZC 1R4VA 4YS3A 5B31C 2HIOA 3MGSB 3WAAA 4KHAB 3MGRD 5E5AD 4X23C 4XUJB 3NQUB 4NE6A 3X1VA 4KUDA 1BH8B 2HUEC 5GT3D 3AFAC 3W97C 5B0YB 3AZGB 1EQZA 3MGRC 1S32D 4EO5B 2PYOD 4ZUXD 5BO0A 1M19A 5GT3C 1M1AB 3AFAA 3W97A 3V9RB 4J8WB 4J8UD 3AZEB 3AZIB 3MGPB 5CPKC 4DRBA 5CHLB 3MGRA 3W96C 3X1UB 5G49B 1P3BD 1N1JA 3MVDD 4J8VB 4DRAA 2YFWB 1TAFB 5AVBB 5CPKA 2AROD 3W96A 3C1CB 5B32D 1M18C 3AV1D 1P3MD 2NZDB 3WTPC 3AV2B 2AROC 5AV6A 3A6NC 5B0ZD 4UUZA 5B31G 3UTAD 3NQJA 3AZKD 3LJAA 5B31B 1M18A 1P3LC 3LZ1C 4LD9C 3WTPA 4X23B 5CPJC 5FUGA 3TU4C 5CPIC 3A6NA 3AZFD 3W98D 1JFIB 3MGRB 5E5AB 1KX5D 1P34D 2NQBC 5CP6A 1P3LA 3LZ1A 4LD9A 3AZFC 5GT3B 1KX4A 5CPJA 3TU4A 5CPIA 2YFVB 5AV5C 1S32B 2PYOB 3MNNC 4ZUXB 1TZYD 2NQBA 4J8XD 3KWQD 1ZLAD 5KDMA 5GXQC 4J8UB 3R45A 5AV5A 5BNVB 1TZYC 1P3BB 4UUZB 4WZSB 3MNNA 3MVDB 4H9QB 5DNNA 5GXQA 5B32G 4Z5TD 5JA4A 2AROB 3UT9A 3A6NB 5B24C 5B32B 1P3MB 3REID 3MGSC 3B0CT 4CAYB 4CSRA 3KUYD 2BYKA 4XUJC 3W99D 5B0ZB 1F66D 1H3OA 5B0YC 3UTAB 3AZGC 2F8NH 5B24A 3AZKB 3KUYC 3WTPE 2F8ND 4EO5C 3MGSA 4KHAA 1F66C 5GSUD 4WU8D 1P3OD 4XUJA 3NQUA 3AZFB 3W98B 1M1AC 1BH8A 1KX3D 2BYMB 5B0YA 1KX5B 3AZEC 3AZGA 4R8PD 3MGPC 3AYWD 4HGAB 1P34B 5GSUC 3WKJD 3REHD 1P3OC 2L5AA 4R8PC 3WKJC 1M1AA 4J8WA 3V9RA 5JA4B 3AZEA 5AVBC 3AZIA 3MGPA 4E45A 1TZYB 3X1UA 5G49A 4J8XB 1P3OA 3C1CC 5B40C 3KWQB 1ZLAB 4J8VA 3AN2D 2CV5D 2NZDC 3WKJA 3LZ0D 2YFWA 1TAFA 3X1TD 5B2ID 5AVBA 1BH9B 3AN2C 2CV5C 3C1CA 5B40A 1AOID 5B2JD 4Z5TB 2NZDA 3AV2A 3MGQD 1A7WA 4WV4B 3REIB 3KUYB 5E5AC 3B0CW 4G91C 5B31A 1HTAA 3W99B 4H9PB 1F66B 3B6FD 2CWEA 4X23A 2F8NG 1U35D 2F8NB 1S32C 1JFIA 2PYOC 3UTBD 4ZUXC 5GSUB 5E5AA 3B6GD 4WU8B 1P3OB 4M6BA 3WA9D 4YM6D 5GT0D 2FJ7D 1KX3B 1P3PD 5GT3A 4J8UC 4H9OB 4R8PB 3AYWB 3WKJB 2YFVA 3REHB 3AZMD 3B6GC 1S32A 1HQ3D 4Z66D 5GT0C 4YM6C 4WU9D 1P3BC 2PYOA 4ZUXA 3MVDC 1P3PC 4NE3A 5B40B 1HQ3C 4J8UA 4Z66C 4WU9C 5BNVA 5GT0A 3VH6T 5B32C 4YM6A 1P3BA 3AV1C 3MVDA 1P3MC 3AN2B 3B0DC 4H9QA 2CV5B 3X1SD 3LZ0B 3AZLD 3X1TB 5B0ZC 5B2IB 3AZHD 1P3FD 2AROA 3UTAC 3AZKC 5B32A 3AV1A 1AOIB 2LY8A 5B2JB 1P3MA 4G91B 3AZHC 4CAYA 3MGQB 4KGCD 1P3FC 5B0ZA 3W98C 1P3KD 3UTAA 1KX5C 5F99D 3AZKA 1P34C 4HGAC 5BT1D 2F8NK 3B6FB 3B0BA 1U35B 3AZFA 3W98A 3UTBB 2BYMA 1KX5A 1P34A 3B6GB 3WA9B 5GT0B 4YM6B 3KXBD 2FJ7B 4J8XC 5DNMD 1P3PB 3KWQC 4XZQD 5AVCD 1ZLAC 5B1MD 3AZMB 3AZJD 1HQ3B 4JJND 4Z66B 3KXBC 4WU9B 5AV8D 5BNXB 1P3ID 1TZYA 4J8XA 3AV1B 3B0DB 3KWQA 1ZLAA 5AV8C 4Z5TC 3REJD 5JRGD 4NFTA 1P3AD 3KXBA 3REIC 4H9RB 3VH6W 1BH9A 3X1SB 3REJC 5JRGC 3RELD 3AZLB 3W99C 1P3GD 3AZHB 4Z5TA 1P3FB 3RELC 3REIA 3LELD 1P3GC 3KUYA 4KGCB 4WU8C 3VH5A 3W99A 4Z2MH 4H9PA 1F66A 4E44A 1KX3C 3REKD 3C1BD 3AZND 5F99B 3AYWC 3O62D 3REHC 2F8NA 2JSSA 5GSUA 5B33D 4WU8A 1KX3A 4H9OA 5AY8D 1ID3D 4R8PA 3AYWA 3KXBB 3REHA 3TU4B 5B1LD 4XZQB 5AVCB 5B1MB 3VH6A 3AZJB 4WNNB 4QLCD 3LZ0C 4JJNB 5AV8B 3X1TC 5B1LC 5B2IC 4YS3D 2HIOD 3WAAD 1P3IB 5AV9D 1AOIC 4QLCC 5B2JC 3X1VD 3AN2A 2CV5A 3REJB 4KUDD 5JRGB 1BFMA 3MGQC 2HIOC 1P3AB 5AV9C 3LZ0A 1EQZD 3X1TA 5B2IA 4G92B 2IO5B 4KUDC 1M19D 3RELB 3VH5T 1P3GB 4QLCA 5B2JA 1AOIA 3B6FC 3AFAD 3W97D 3MGQA 1WWIA 1U35C 5AV9A 1B67A 1M19C 4H9SC 3LELB 3UTBC 4AWLB 1Q9CA 4Z2MG 3WA9C 2FJ7C 3B6FA 3REKB 3C1BB 4H9NB 3AZNB 1U35A 5CPKD 3O62B 3W96D 4H9SA 3AZMC 3UTBA 5B33B 3B6GA 3WA9A 2FJ7A 1P3PA 5AV6D 5AY8B 1ID3B 3AZMA 1HQ3A 5B1LB 4Z66A 3LJAD 4WU9A 5BNXA 1M18D 5AV6C 3WTPD 1KU5A 3X1SC 4ZBJC 3AZLC 4QLCB 3A6ND 4YS3B 3LJAC 2HIOB 3WAAB 5AV9B 4NE5A 5CP6D 3X1VB 4KUDB 1P3LD 3LZ1D 4H9RA 4LD9D 1KX4D 5CPJD 3X1SA 4KGCC 3TU4D 3AZLA 1EQZB 5CPID 3AZHA 5CP6C 1P3FA 1P3KC 5BO0B 5F99C 1M19B 1KX4C 5BT1C 2NQBD 2HUEB 3VH5W 3AFAB 3W97B 4KGCA 5AV5D 3MNND 1N1JB 1P3KA 5F99A 5DNMC 5DNND 4XZQC 5AVCC 5C3IC 5GXQD 5B1MC 5CPKB 3W96B 3AZJC 3UT9D 4JJNC 5DNNC 1P3IC 5DNMA 5AV6B 4XZQA 5AVCA 3UT9C 5B1MA 4ZBJB 2RVQD 1P3AC 3AZJA 3KSYA 3NQJB 4WNNA 5B24D 3LJAB 5AV8A 4JJNA 1M18B 4G92C 2IO5C 3MGSD 1B6WA 3WTPB 1P3IA 5FUGB 2RVQC 4XUJD 3REJA 5JRGA 1P3AA 5B0YD 3AZGD 5CP6B 1P3LB 3LZ1B 3LELC 1P3KB 4LD9B 4AWLC 1KX4B 5CPJB 3RELA
chains in the Genus database with same CATH superfamily
5CPIB 1P3GA 1F1EA 1M1AD 3REKC 4J8WD 3C1BC 3AZNC 3AZED 3AZID 3MGPD 3O62C 2NQBB 1ULYA 3X1UD 3LELA 5KDMB 4J8VD 5B33C 4J8WC 3F6TA 5DNMB 3R45B 5AV5B 3AZIC 3AL0C 5C3IB 2ZY5A 3X1UC 3MNNB 3C1BA 3REKA 4H9NA 5AY8C 3AZNA 1ID3C 5AVBD 4J8VC 3O62A 5BS7C 5DNNB 3C1CD 5B40D 1WWSA 5GXQB 5B33A 1PZRA 2NZDD 3AV2D 3UT9B 4YS3C 5AY8A 1ID3A 1Z2CB 3WAAC 3EPKA 4CSRB 5BS7A 2BYKB 5B1LA 3AV2C 5B31D 3X1VC 3A1IA 1H3OB 4X23D 5B24B 1EQZC 1R4VA 4YS3A 5B31C 2HIOA 3MGSB 3WAAA 4KHAB 3MGRD 5E5AD 4X23C 4XUJB 3NQUB 4NE6A 3X1VA 4KUDA 1BH8B 2HUEC 5GT3D 3AFAC 3W97C 5B0YB 3AZGB 1EQZA 3MGRC 1S32D 4EO5B 2PYOD 4ZUXD 5BO0A 1M19A 5GT3C 1M1AB 3AFAA 3W97A 3V9RB 4J8WB 4J8UD 3AZEB 3AZIB 3MGPB 5CPKC 4DRBA 5CHLB 3MGRA 3W96C 3X1UB 5G49B 2Y2QA 1P3BD 1N1JA 3MVDD 4J8VB 4WJ3C 4DRAA 2YFWB 1TAFB 3A1KA 5AVBB 5CPKA 2AROD 3W96A 3C1CB 5B32D 2Y2LA 1M18C 3AV1D 1P3MD 2NZDB 3WTPC 3AV2B 2AROC 5AV6A 3A6NC 5B0ZD 4UUZA 5B31G 3UTAD 3NQJA 3AZKD 3LJAA 5B31B 1M18A 1P3LC 3LZ1C 4LD9C 3WTPA 4X23B 5CPJC 5FUGA 3TU4C 5CPIC 3A6NA 3AZFD 3W98D 1JFIB 3MGRB 5E5AB 1KX5D 1P34D 2NQBC 5CP6A 1P3LA 3LZ1A 4LD9A 3AZFC 5GT3B 1KX4A 5CPJA 3TU4A 5CPIA 2YFVB 5AV5C 1S32B 2PYOB 3MNNC 4ZUXB 1TZYD 2NQBA 4J8XD 3KWQD 1ZLAD 5KDMA 5GXQC 4J8UB 3R45A 5AV5A 5BNVB 1TZYC 1P3BB 4UUZB 4WZSB 3MNNA 3MVDB 4H9QB 5DNNA 2W8SA 5GXQA 5B32G 4Z5TD 5JA4A 2Y2GA 2AROB 3UT9A 3A6NB 4UPKA 5B24C 5B32B 1P3MB 2Y2IA 3MGSC 3REID 3B0CT 4CAYB 4CSRA 3KUYD 2JCHA 2BYKA 2G5HC 4XUJC 3W99D 5B0ZB 1F66D 1H3OA 5B0YC 3UTAB 3AZGC 2F8NH 5B24A 3AZKB 3KUYC 3WTPE 3H0LC 2F8ND 3H0RC 4EO5C 3MGSA 4KHAA 1F66C 2J8PA 5GSUD 4WU8D 1P3OD 2F2AC 4XUJA 3NQUA 3AZFB 3W98B 1M1AC 1BH8A 1KX3D 2BYMB 5B0YA 1KX5B 3AZEC 3AZGA 4R8PD 3MGPC 3AYWD 4HGAB 1P34B 5GSUC 3WKJD 3REHD 1P3OC 2L5AA 2ZY2A 4R8PC 3WKJC 1M1AA 4DQYB 4J8WA 3V9RA 5JA4B 3AZEA 5AVBC 3AZIA 3MGPA 4E45A 1TZYB 3X1UA 5G49A 4J8XB 1P3OA 3C1CC 5B40C 3KWQB 1ZLAB 4J8VA 3AN2D 2CV5D 2NZDC 3WKJA 3LZ0D 2YFWA 1TAFA 3EPHA 3X1TD 5B2ID 5AVBA 1BH9B 3AN2C 2CV5C 3C1CA 5B40A 1AOID 5B2JD 4Z5TB 2NZDA 3AV2A 2Y2KA 3MGQD 1A7WA 4WV4B 3REIB 3KUYB 5E5AC 3B0CW 4G91C 5B31A 1HTAA 3W99B 4H9PB 1F66B 3B6FD 2CWEA 4X23A 2F8NG 2DF4C 1U35D 2F8NB 1S32C 1JFIA 2PYOC 3UTBD 2JE5A 4ZUXC 5GSUB 5E5AA 3B6GD 4WU8B 1P3OB 4M6BA 3WA9D 4YM6D 5GT0D 2FJ7D 1KX3B 1P3PD 5GT3A 4J8UC 4H9OB 4R8PB 3AYWB 3WKJB 2YFVA 3REHB 3AZMD 3B6GC 1S32A 1HQ3D 5GT0C 4YM6C 4WU9D 4Z66D 2ZM5A 1P3BC 2PYOA 4ZUXA 3MVDC 1P3PC 4NE3A 5B40B 1HQ3C 4J8UA 4Z66C 4WU9C 5BNVA 5GT0A 3VH6T 5B32C 4YM6A 1P3BA 3AV1C 3MVDA 1P3MC 3AN2B 3B0DC 4H9QA 2CV5B 3X1SD 3LZ0B 3AZLD 3X1TB 5B0ZC 5B2IB 3AZHD 1P3FD 2AROA 3UTAC 3AZKC 1W2EA 5B32A 3AV1A 1AOIB 2LY8A 5B2JB 1P3MA 1T3UA 4G91B 3AZHC 4CAYA 3MGQB 4KGCD 1P3FC 5B0ZA 3W98C 3EPJA 3UTAA 1P3KD 1KX5C 5F99D 3AZKA 1P34C 4HGAC 2Y2JA 5BT1D 2F8NK 3B6FB 3B0BA 1U35B 3AZFA 3W98A 3UTBB 2BYMA 1KX5A 1P34A 3B6GB 3WA9B 5GT0B 4YM6B 3KXBD 2FJ7B 4J8XC 5DNMD 1P3PB 3KWQC 4XZQD 5AVCD 1ZLAC 5B1MD 2XD1A 3AZMB 3AZJD 1HQ3B 4JJND 4Z66B 3KXBC 4WU9B 5AV8D 5BNXB 1P3ID 1TZYA 4J8XA 3AV1B 3B0DB 3KWQA 1ZLAA 5AV8C 4Z5TC 3REJD 5JRGD 4NFTA 1P3AD 3KXBA 3REIC 4H9RB 3VH6W 1BH9A 3P5JB 3X1SB 3REJC 5JRGC 3RELD 3AZLB 3W99C 1P3GD 3AZHB 4Z5TA 1P3FB 2DQNC 3RELC 3REIA 3LELD 1P3GC 3KUYA 4KGCB 4WU8C 3VH5A 3W99A 4Z2MH 2G5IC 4H9PA 1F66A 4E44A 1KX3C 3REKD 3C1BD 3AZND 5F99B 3AYWC 3O62D 3REHC 2F8NA 2JSSA 3EG5B 5GSUA 5B33D 4WU8A 1KX3A 4H9OA 5AY8D 1ID3D 4R8PA 3AYWA 3KXBB 3REHA 3TU4B 5B1LD 4XZQB 5AVCB 5B1MB 3VH6A 2UWXA 3AZJB 2Y2PA 2FFFB 4WNNB 4QLCD 3LZ0C 4JJNB 5AV8B 3X1TC 5B1LC 5B2IC 4YS3D 2HIOD 3WAAD 1P3IB 5AV9D 1AOIC 4QLCC 5B2JC 2XD5A 3AN2A 3X1VD 3REJB 2CV5A 5JRGB 4KUDD 1BFMA 3MGQC 2HIOC 1P3AB 5AV9C 3LZ0A 1EQZD 3X1TA 5B2IA 4G92B 2IO5B 2ZY4A 4KUDC 1M19D 3RELB 3VH5T 1P3GB 4QLCA 5B2JA 1AOIA 3B6FC 3AFAD 3W97D 3MGQA 1WWIA 1U35C 5AV9A 1B67A 1M19C 4H9SC 3LELB 3IP4C 4AWLB 3UTBC 1Q9CA 4Z2MG 3WA9C 3FDDA 2FJ7C 3B6FA 3REKB 3C1BB 4H9NB 3AZNB 1U35A 5CPKD 3O62B 3W96D 4H9SA 3AZMC 3UTBA 2ZY3A 2RIQA 5B33B 3B6GA 3WA9A 2FJ7A 1P3PA 5AV6D 5AY8B 1ID3B 3AZMA 1HQ3A 2Y2OA 5B1LB 4Z66A 3LJAD 4WU9A 5BNXA 1M18D 5AV6C 3WTPD 1KU5A 3X1SC 4ZBJC 3AZLC 4QLCB 3A6ND 4YS3B 2Y2HA 3LJAC 2HIOB 3WAAB 5AV9B 4NE5A 3H0MC 5CP6D 3X1VB 4KUDB 1P3LD 3LZ1D 4H9RA 4LD9D 1KX4D 5CPJD 3X1SA 4KGCC 3TU4D 3AZLA 1EQZB 5CPID 3AZHA 5CP6C 2BG1A 1P3FA 1P3KC 5BO0B 5F99C 1M19B 1KX4C 5BT1C 2NQBD 2HUEB 3VH5W 3AFAB 3W97B 4KGCA 2VQRA 5AV5D 3MNND 1N1JB 1P3KA 2Y2MA 5F99A 3EPLA 5DNMC 5DNND 3KFUG 4XZQC 5AVCC 5C3IC 5GXQD 5B1MC 5CPKB 3W96B 3AZJC 3UT9D 4JJNC 5DNNC 1P3IC 5DNMA 5AV6B 4XZQA 5AVCA 3UT9C 5B1MA 4ZBJB 2RVQD 1P3AC 3AZJA 3KSYA 3NQJB 4WNNA 5B24D 3LJAB 5AV8A 4JJNA 1M18B 4G92C 2IO5C 3MGSD 1B6WA 3WTPB 1P3IA 5FUGB 2RVQC 4XUJD 3REJA 5JRGA 2Y2NA 1P3AA 5B0YD 3AZGD 5CP6B 1P3LB 3LZ1B 3LELC 1P3KB 4LD9B 4AWLC 1KX4B 5CPJB 3RELA
chains in the Genus database with same CATH topology
5CPIB 1P3GA 1F1EA 1M1AD 3REKC 4J8WD 3C1BC 3AZNC 3AZED 3AZID 3MGPD 3O62C 2NQBB 1ULYA 3X1UD 3LELA 5KDMB 4J8VD 5B33C 4J8WC 3F6TA 5DNMB 3R45B 5AV5B 3AZIC 3AL0C 5C3IB 2ZY5A 3X1UC 3MNNB 3C1BA 3REKA 4H9NA 5AY8C 3AZNA 1ID3C 5AVBD 4J8VC 3O62A 5BS7C 5DNNB 3C1CD 5B40D 1WWSA 5GXQB 5B33A 1PZRA 2NZDD 3AV2D 3UT9B 4YS3C 5AY8A 1ID3A 1Z2CB 3WAAC 3EPKA 4CSRB 5BS7A 2BYKB 5B1LA 3AV2C 5B31D 3X1VC 3A1IA 1H3OB 4X23D 5B24B 1EQZC 1R4VA 4YS3A 5B31C 2HIOA 3MGSB 3WAAA 4KHAB 3MGRD 5E5AD 4X23C 4XUJB 3NQUB 4NE6A 3X1VA 4KUDA 1BH8B 2HUEC 5GT3D 3AFAC 3W97C 5B0YB 3AZGB 1EQZA 3MGRC 1S32D 4EO5B 2PYOD 4ZUXD 5BO0A 1M19A 5GT3C 1M1AB 3AFAA 3W97A 3V9RB 4J8WB 4J8UD 3AZEB 3AZIB 3MGPB 5CPKC 4DRBA 5CHLB 3MGRA 3W96C 3X1UB 5G49B 2Y2QA 1P3BD 1N1JA 3MVDD 4J8VB 4WJ3C 4DRAA 2YFWB 1TAFB 3A1KA 5AVBB 5CPKA 2AROD 3W96A 3C1CB 5B32D 2Y2LA 1M18C 3AV1D 1P3MD 2NZDB 3WTPC 3AV2B 2AROC 5AV6A 3A6NC 5B0ZD 4UUZA 5B31G 3UTAD 3NQJA 3AZKD 3LJAA 5B31B 1M18A 1P3LC 3LZ1C 4LD9C 3WTPA 4X23B 5CPJC 5FUGA 3TU4C 5CPIC 3A6NA 3AZFD 3W98D 1JFIB 3MGRB 5E5AB 1KX5D 1P34D 2NQBC 5CP6A 1P3LA 3LZ1A 4LD9A 3AZFC 5GT3B 1KX4A 5CPJA 3TU4A 5CPIA 2YFVB 5AV5C 1S32B 2PYOB 3MNNC 4ZUXB 1TZYD 2NQBA 4J8XD 3KWQD 1ZLAD 5KDMA 5GXQC 4J8UB 3R45A 5AV5A 5BNVB 1TZYC 1P3BB 4UUZB 4WZSB 3MNNA 3MVDB 4H9QB 5DNNA 2W8SA 5GXQA 5B32G 4Z5TD 5JA4A 2Y2GA 2AROB 3UT9A 3A6NB 4UPKA 5B24C 5B32B 1P3MB 2Y2IA 3MGSC 3REID 3B0CT 4CAYB 4CSRA 3KUYD 2JCHA 2BYKA 2G5HC 4XUJC 3W99D 5B0ZB 1F66D 1H3OA 5B0YC 3UTAB 3AZGC 2F8NH 5B24A 3AZKB 3KUYC 3WTPE 3H0LC 2F8ND 3H0RC 4EO5C 3MGSA 4KHAA 1F66C 2J8PA 5GSUD 4WU8D 1P3OD 2F2AC 4XUJA 3NQUA 3AZFB 3W98B 1M1AC 1BH8A 1KX3D 2BYMB 5B0YA 1KX5B 3AZEC 3AZGA 4R8PD 3MGPC 3AYWD 4HGAB 1P34B 5GSUC 3WKJD 3REHD 1P3OC 2L5AA 2ZY2A 4R8PC 3WKJC 1M1AA 4DQYB 4J8WA 3V9RA 5JA4B 3AZEA 5AVBC 3AZIA 3MGPA 4E45A 1TZYB 3X1UA 5G49A 4J8XB 1P3OA 3C1CC 5B40C 3KWQB 1ZLAB 4J8VA 3AN2D 2CV5D 2NZDC 3WKJA 3LZ0D 2YFWA 1TAFA 3EPHA 3X1TD 5B2ID 5AVBA 1BH9B 3AN2C 2CV5C 3C1CA 5B40A 1AOID 5B2JD 4Z5TB 2NZDA 3AV2A 2Y2KA 3MGQD 1A7WA 4WV4B 3REIB 3KUYB 5E5AC 3B0CW 4G91C 5B31A 1HTAA 3W99B 4H9PB 1F66B 3B6FD 2CWEA 4X23A 2F8NG 2DF4C 1U35D 2F8NB 1S32C 1JFIA 2PYOC 3UTBD 2JE5A 4ZUXC 5GSUB 5E5AA 3B6GD 4WU8B 1P3OB 4M6BA 3WA9D 4YM6D 5GT0D 2FJ7D 1KX3B 1P3PD 5GT3A 4J8UC 4H9OB 4R8PB 3AYWB 3WKJB 2YFVA 3REHB 3AZMD 3B6GC 1S32A 1HQ3D 5GT0C 4YM6C 4WU9D 4Z66D 2ZM5A 1P3BC 2PYOA 4ZUXA 3MVDC 1P3PC 4NE3A 5B40B 1HQ3C 4J8UA 4Z66C 4WU9C 5BNVA 5GT0A 3VH6T 5B32C 4YM6A 1P3BA 3AV1C 3MVDA 1P3MC 3AN2B 3B0DC 4H9QA 2CV5B 3X1SD 3LZ0B 3AZLD 3X1TB 5B0ZC 5B2IB 3AZHD 1P3FD 2AROA 3UTAC 3AZKC 1W2EA 5B32A 3AV1A 1AOIB 2LY8A 5B2JB 1P3MA 1T3UA 4G91B 3AZHC 4CAYA 3MGQB 4KGCD 1P3FC 5B0ZA 3W98C 3EPJA 3UTAA 1P3KD 1KX5C 5F99D 3AZKA 1P34C 4HGAC 2Y2JA 5BT1D 2F8NK 3B6FB 3B0BA 1U35B 3AZFA 3W98A 3UTBB 2BYMA 1KX5A 1P34A 3B6GB 3WA9B 5GT0B 4YM6B 3KXBD 2FJ7B 4J8XC 5DNMD 1P3PB 3KWQC 4XZQD 5AVCD 1ZLAC 5B1MD 2XD1A 3AZMB 3AZJD 1HQ3B 4JJND 4Z66B 3KXBC 4WU9B 5AV8D 5BNXB 1P3ID 1TZYA 4J8XA 3AV1B 3B0DB 3KWQA 1ZLAA 5AV8C 4Z5TC 3REJD 5JRGD 4NFTA 1P3AD 3KXBA 3REIC 4H9RB 3VH6W 1BH9A 3P5JB 3X1SB 3REJC 5JRGC 3RELD 3AZLB 3W99C 1P3GD 3AZHB 4Z5TA 1P3FB 2DQNC 3RELC 3REIA 3LELD 1P3GC 3KUYA 4KGCB 4WU8C 3VH5A 3W99A 4Z2MH 2G5IC 4H9PA 1F66A 4E44A 1KX3C 3REKD 3C1BD 3AZND 5F99B 3AYWC 3O62D 3REHC 2F8NA 2JSSA 3EG5B 5GSUA 5B33D 4WU8A 1KX3A 4H9OA 5AY8D 1ID3D 4R8PA 3AYWA 3KXBB 3REHA 3TU4B 5B1LD 4XZQB 5AVCB 5B1MB 3VH6A 2UWXA 3AZJB 2Y2PA 2FFFB 4WNNB 4QLCD 3LZ0C 4JJNB 5AV8B 3X1TC 5B1LC 5B2IC 4YS3D 2HIOD 3WAAD 1P3IB 5AV9D 1AOIC 4QLCC 5B2JC 2XD5A 3AN2A 3X1VD 3REJB 2CV5A 5JRGB 4KUDD 1BFMA 3MGQC 2HIOC 1P3AB 5AV9C 3LZ0A 1EQZD 3X1TA 5B2IA 4G92B 2IO5B 2ZY4A 4KUDC 1M19D 3RELB 3VH5T 1P3GB 4QLCA 5B2JA 1AOIA 3B6FC 3AFAD 3W97D 3MGQA 1WWIA 1U35C 5AV9A 1B67A 1M19C 4H9SC 3LELB 3IP4C 4AWLB 3UTBC 1Q9CA 4Z2MG 3WA9C 3FDDA 2FJ7C 3B6FA 3REKB 3C1BB 4H9NB 3AZNB 1U35A 5CPKD 3O62B 3W96D 4H9SA 3AZMC 3UTBA 2ZY3A 2RIQA 5B33B 3B6GA 3WA9A 2FJ7A 1P3PA 5AV6D 5AY8B 1ID3B 3AZMA 1HQ3A 2Y2OA 5B1LB 4Z66A 3LJAD 4WU9A 5BNXA 1M18D 5AV6C 3WTPD 1KU5A 3X1SC 4ZBJC 3AZLC 4QLCB 3A6ND 4YS3B 2Y2HA 3LJAC 2HIOB 3WAAB 5AV9B 4NE5A 3H0MC 5CP6D 3X1VB 4KUDB 1P3LD 3LZ1D 4H9RA 4LD9D 1KX4D 5CPJD 3X1SA 4KGCC 3TU4D 3AZLA 1EQZB 5CPID 3AZHA 5CP6C 2BG1A 1P3FA 1P3KC 5BO0B 5F99C 1M19B 1KX4C 5BT1C 2NQBD 2HUEB 3VH5W 3AFAB 3W97B 4KGCA 2VQRA 5AV5D 3MNND 1N1JB 1P3KA 2Y2MA 5F99A 3EPLA 5DNMC 5DNND 3KFUG 4XZQC 5AVCC 5C3IC 5GXQD 5B1MC 5CPKB 3W96B 3AZJC 3UT9D 4JJNC 5DNNC 1P3IC 5DNMA 5AV6B 4XZQA 5AVCA 3UT9C 5B1MA 4ZBJB 2RVQD 1P3AC 3AZJA 3KSYA 3NQJB 4WNNA 5B24D 3LJAB 5AV8A 4JJNA 1M18B 4G92C 2IO5C 3MGSD 1B6WA 3WTPB 1P3IA 5FUGB 2RVQC 4XUJD 3REJA 5JRGA 2Y2NA 1P3AA 5B0YD 3AZGD 5CP6B 1P3LB 3LZ1B 3LELC 1P3KB 4LD9B 4AWLC 1KX4B 5CPJB 3RELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI B;  1P3G A;  1F1E A;  1M1A D;  3REK C;  4J8W D;  3C1B C;  3AZN C;  3AZE D;  3AZI D;  3MGP D;  3O62 C;  2NQB B;  1ULY A;  3X1U D;  3LEL A;  5KDM B;  4J8V D;  5B33 C;  4J8W C;  5DNM B;  3R45 B;  5AV5 B;  3AZI C;  5C3I B;  3X1U C;  3MNN B;  3C1B A;  3REK A;  4H9N A;  5AY8 C;  3AZN A;  1ID3 C;  5AVB D;  4J8V C;  3O62 A;  5BS7 C;  5DNN B;  3C1C D;  5B40 D;  1WWS A;  5GXQ B;  5B33 A;  2NZD D;  3AV2 D;  3UT9 B;  4YS3 C;  5AY8 A;  1ID3 A;  3WAA C;  4CSR B;  5BS7 A;  2BYK B;  5B1L A;  3AV2 C;  5B31 D;  3X1V C;  1H3O B;  4X23 D;  5B24 B;  1EQZ C;  1R4V A;  4YS3 A;  5B31 C;  2HIO A;  3MGS B;  3WAA A;  4KHA B;  3MGR D;  5E5A D;  4X23 C;  4XUJ B;  3NQU B;  4NE6 A;  3X1V A;  4KUD A;  1BH8 B;  2HUE C;  5GT3 D;  3AFA C;  3W97 C;  5B0Y B;  3AZG B;  1EQZ A;  3MGR C;  1S32 D;  4EO5 B;  2PYO D;  4ZUX D;  5BO0 A;  1M19 A;  5GT3 C;  1M1A B;  3AFA A;  3W97 A;  3V9R B;  4J8W B;  4J8U D;  3AZE B;  3AZI B;  3MGP B;  5CPK C;  4DRB A;  5CHL B;  3MGR A;  3W96 C;  3X1U B;  5G49 B;  1P3B D;  1N1J A;  3MVD D;  4J8V B;  4DRA A;  2YFW B;  1TAF B;  5AVB B;  5CPK A;  2ARO D;  3W96 A;  3C1C B;  5B32 D;  1M18 C;  3AV1 D;  1P3M D;  2NZD B;  3WTP C;  3AV2 B;  2ARO C;  5AV6 A;  3A6N C;  5B0Z D;  4UUZ A;  5B31 G;  3UTA D;  3NQJ A;  3AZK D;  3LJA A;  5B31 B;  1M18 A;  1P3L C;  3LZ1 C;  4LD9 C;  3WTP A;  4X23 B;  5CPJ C;  5FUG A;  3TU4 C;  5CPI C;  3A6N A;  3AZF D;  3W98 D;  1JFI B;  3MGR B;  5E5A B;  1KX5 D;  1P34 D;  2NQB C;  5CP6 A;  1P3L A;  3LZ1 A;  4LD9 A;  3AZF C;  5GT3 B;  1KX4 A;  5CPJ A;  3TU4 A;  5CPI A;  2YFV B;  5AV5 C;  1S32 B;  2PYO B;  3MNN C;  4ZUX B;  1TZY D;  2NQB A;  4J8X D;  3KWQ D;  1ZLA D;  5KDM A;  5GXQ C;  4J8U B;  3R45 A;  5AV5 A;  5BNV B;  1TZY C;  1P3B B;  4UUZ B;  4WZS B;  3MNN A;  3MVD B;  4H9Q B;  5DNN A;  5GXQ A;  5B32 G;  4Z5T D;  5JA4 A;  2ARO B;  3UT9 A;  3A6N B;  5B24 C;  5B32 B;  1P3M B;  3REI D;  3MGS C;  3B0C T;  4CAY B;  4CSR A;  3KUY D;  2BYK A;  4XUJ C;  3W99 D;  5B0Z B;  1F66 D;  1H3O A;  5B0Y C;  3UTA B;  3AZG C;  2F8N H;  5B24 A;  3AZK B;  3KUY C;  3WTP E;  2F8N D;  4EO5 C;  3MGS A;  4KHA A;  1F66 C;  5GSU D;  4WU8 D;  1P3O D;  4XUJ A;  3NQU A;  3AZF B;  3W98 B;  1M1A C;  1BH8 A;  1KX3 D;  2BYM B;  5B0Y A;  1KX5 B;  3AZE C;  3AZG A;  4R8P D;  3MGP C;  3AYW D;  4HGA B;  1P34 B;  5GSU C;  3WKJ D;  3REH D;  1P3O C;  2L5A A;  4R8P C;  3WKJ C;  1M1A A;  4J8W A;  3V9R A;  5JA4 B;  3AZE A;  5AVB C;  3AZI A;  3MGP A;  4E45 A;  1TZY B;  3X1U A;  5G49 A;  4J8X B;  1P3O A;  3C1C C;  5B40 C;  3KWQ B;  1ZLA B;  4J8V A;  3AN2 D;  2CV5 D;  2NZD C;  3WKJ A;  3LZ0 D;  2YFW A;  1TAF A;  3X1T D;  5B2I D;  5AVB A;  1BH9 B;  3AN2 C;  2CV5 C;  3C1C A;  5B40 A;  1AOI D;  5B2J D;  4Z5T B;  2NZD A;  3AV2 A;  3MGQ D;  1A7W A;  4WV4 B;  3REI B;  3KUY B;  5E5A C;  3B0C W;  4G91 C;  5B31 A;  1HTA A;  3W99 B;  4H9P B;  1F66 B;  3B6F D;  2CWE A;  4X23 A;  2F8N G;  1U35 D;  2F8N B;  1S32 C;  1JFI A;  2PYO C;  3UTB D;  4ZUX C;  5GSU B;  5E5A A;  3B6G D;  4WU8 B;  1P3O B;  4M6B A;  3WA9 D;  4YM6 D;  5GT0 D;  2FJ7 D;  1KX3 B;  1P3P D;  5GT3 A;  4J8U C;  4H9O B;  4R8P B;  3AYW B;  3WKJ B;  2YFV A;  3REH B;  3AZM D;  3B6G C;  1S32 A;  1HQ3 D;  4Z66 D;  5GT0 C;  4YM6 C;  4WU9 D;  1P3B C;  2PYO A;  4ZUX A;  3MVD C;  1P3P C;  4NE3 A;  5B40 B;  1HQ3 C;  4J8U A;  4Z66 C;  4WU9 C;  5BNV A;  5GT0 A;  3VH6 T;  5B32 C;  4YM6 A;  1P3B A;  3AV1 C;  3MVD A;  1P3M C;  3AN2 B;  3B0D C;  4H9Q A;  2CV5 B;  3X1S D;  3LZ0 B;  3AZL D;  3X1T B;  5B0Z C;  5B2I B;  3AZH D;  1P3F D;  2ARO A;  3UTA C;  3AZK C;  5B32 A;  3AV1 A;  1AOI B;  2LY8 A;  5B2J B;  1P3M A;  4G91 B;  3AZH C;  4CAY A;  3MGQ B;  4KGC D;  1P3F C;  5B0Z A;  3W98 C;  1P3K D;  3UTA A;  1KX5 C;  5F99 D;  3AZK A;  1P34 C;  4HGA C;  5BT1 D;  2F8N K;  3B6F B;  3B0B A;  1U35 B;  3AZF A;  3W98 A;  3UTB B;  2BYM A;  1KX5 A;  1P34 A;  3B6G B;  3WA9 B;  5GT0 B;  4YM6 B;  3KXB D;  2FJ7 B;  4J8X C;  5DNM D;  1P3P B;  3KWQ C;  4XZQ D;  5AVC D;  1ZLA C;  5B1M D;  3AZM B;  3AZJ D;  1HQ3 B;  4JJN D;  4Z66 B;  3KXB C;  4WU9 B;  5AV8 D;  5BNX B;  1P3I D;  1TZY A;  4J8X A;  3AV1 B;  3B0D B;  3KWQ A;  1ZLA A;  5AV8 C;  4Z5T C;  3REJ D;  5JRG D;  4NFT A;  1P3A D;  3KXB A;  3REI C;  4H9R B;  3VH6 W;  1BH9 A;  3X1S B;  3REJ C;  5JRG C;  3REL D;  3AZL B;  3W99 C;  1P3G D;  3AZH B;  4Z5T A;  1P3F B;  3REL C;  3REI A;  3LEL D;  1P3G C;  3KUY A;  4KGC B;  4WU8 C;  3VH5 A;  3W99 A;  4Z2M H;  4H9P A;  1F66 A;  4E44 A;  1KX3 C;  3REK D;  3C1B D;  3AZN D;  5F99 B;  3AYW C;  3O62 D;  3REH C;  2F8N A;  2JSS A;  5GSU A;  5B33 D;  4WU8 A;  1KX3 A;  4H9O A;  5AY8 D;  1ID3 D;  4R8P A;  3AYW A;  3KXB B;  3REH A;  3TU4 B;  5B1L D;  4XZQ B;  5AVC B;  5B1M B;  3VH6 A;  3AZJ B;  4WNN B;  4QLC D;  3LZ0 C;  4JJN B;  5AV8 B;  3X1T C;  5B1L C;  5B2I C;  4YS3 D;  2HIO D;  3WAA D;  1P3I B;  5AV9 D;  1AOI C;  4QLC C;  5B2J C;  3X1V D;  3AN2 A;  2CV5 A;  3REJ B;  4KUD D;  5JRG B;  1BFM A;  3MGQ C;  2HIO C;  1P3A B;  5AV9 C;  3LZ0 A;  1EQZ D;  3X1T A;  5B2I A;  4G92 B;  2IO5 B;  4KUD C;  1M19 D;  3REL B;  3VH5 T;  1P3G B;  4QLC A;  5B2J A;  1AOI A;  3B6F C;  3AFA D;  3W97 D;  3MGQ A;  1WWI A;  1U35 C;  5AV9 A;  1B67 A;  1M19 C;  4H9S C;  3LEL B;  3UTB C;  4AWL B;  1Q9C A;  4Z2M G;  3WA9 C;  2FJ7 C;  3B6F A;  3REK B;  3C1B B;  4H9N B;  3AZN B;  1U35 A;  5CPK D;  3O62 B;  3W96 D;  4H9S A;  3AZM C;  3UTB A;  5B33 B;  3B6G A;  3WA9 A;  2FJ7 A;  1P3P A;  5AV6 D;  5AY8 B;  1ID3 B;  3AZM A;  1HQ3 A;  5B1L B;  4Z66 A;  3LJA D;  4WU9 A;  5BNX A;  1M18 D;  5AV6 C;  3WTP D;  1KU5 A;  3X1S C;  4ZBJ C;  3AZL C;  4QLC B;  3A6N D;  4YS3 B;  3LJA C;  2HIO B;  3WAA B;  5AV9 B;  4NE5 A;  5CP6 D;  3X1V B;  4KUD B;  1P3L D;  3LZ1 D;  4H9R A;  4LD9 D;  1KX4 D;  5CPJ D;  3X1S A;  4KGC C;  3TU4 D;  3AZL A;  1EQZ B;  5CPI D;  3AZH A;  5CP6 C;  1P3F A;  1P3K C;  5BO0 B;  5F99 C;  1M19 B;  1KX4 C;  5BT1 C;  2NQB D;  2HUE B;  3VH5 W;  3AFA B;  3W97 B;  4KGC A;  5AV5 D;  3MNN D;  1N1J B;  1P3K A;  5F99 A;  5DNM C;  5DNN D;  4XZQ C;  5AVC C;  5C3I C;  5GXQ D;  5B1M C;  5CPK B;  3W96 B;  3AZJ C;  3UT9 D;  4JJN C;  5DNN C;  1P3I C;  5DNM A;  5AV6 B;  4XZQ A;  5AVC A;  3UT9 C;  5B1M A;  4ZBJ B;  2RVQ D;  1P3A C;  3AZJ A;  3KSY A;  3NQJ B;  4WNN A;  5B24 D;  3LJA B;  5AV8 A;  4JJN A;  1M18 B;  4G92 C;  2IO5 C;  3MGS D;  1B6W A;  3WTP B;  1P3I A;  5FUG B;  2RVQ C;  4XUJ D;  3REJ A;  5JRG A;  1P3A A;  5B0Y D;  3AZG D;  5CP6 B;  1P3L B;  3LZ1 B;  3LEL C;  1P3K B;  4LD9 B;  4AWL C;  1KX4 B;  5CPJ B;  3REL A; 
#chains in the Genus database with same CATH topology
 5CPI B;  1P3G A;  1F1E A;  1M1A D;  3REK C;  4J8W D;  3C1B C;  3AZN C;  3AZE D;  3AZI D;  3MGP D;  3O62 C;  2NQB B;  1ULY A;  3X1U D;  3LEL A;  5KDM B;  4J8V D;  5B33 C;  4J8W C;  3F6T A;  5DNM B;  3R45 B;  5AV5 B;  3AZI C;  3AL0 C;  5C3I B;  2ZY5 A;  3X1U C;  3MNN B;  3C1B A;  3REK A;  4H9N A;  5AY8 C;  3AZN A;  1ID3 C;  5AVB D;  4J8V C;  3O62 A;  5BS7 C;  5DNN B;  3C1C D;  5B40 D;  1WWS A;  5GXQ B;  5B33 A;  1PZR A;  2NZD D;  3AV2 D;  3UT9 B;  4YS3 C;  5AY8 A;  1ID3 A;  1Z2C B;  3WAA C;  3EPK A;  4CSR B;  5BS7 A;  2BYK B;  5B1L A;  3AV2 C;  5B31 D;  3X1V C;  3A1I A;  1H3O B;  4X23 D;  5B24 B;  1EQZ C;  1R4V A;  4YS3 A;  5B31 C;  2HIO A;  3MGS B;  3WAA A;  4KHA B;  3MGR D;  5E5A D;  4X23 C;  4XUJ B;  3NQU B;  4NE6 A;  3X1V A;  4KUD A;  1BH8 B;  2HUE C;  5GT3 D;  3AFA C;  3W97 C;  5B0Y B;  3AZG B;  1EQZ A;  3MGR C;  1S32 D;  4EO5 B;  2PYO D;  4ZUX D;  5BO0 A;  1M19 A;  5GT3 C;  1M1A B;  3AFA A;  3W97 A;  3V9R B;  4J8W B;  4J8U D;  3AZE B;  3AZI B;  3MGP B;  5CPK C;  4DRB A;  5CHL B;  3MGR A;  3W96 C;  3X1U B;  5G49 B;  2Y2Q A;  1P3B D;  1N1J A;  3MVD D;  4J8V B;  4WJ3 C;  4DRA A;  2YFW B;  1TAF B;  3A1K A;  5AVB B;  5CPK A;  2ARO D;  3W96 A;  3C1C B;  5B32 D;  2Y2L A;  1M18 C;  3AV1 D;  1P3M D;  2NZD B;  3WTP C;  3AV2 B;  2ARO C;  5AV6 A;  3A6N C;  5B0Z D;  4UUZ A;  5B31 G;  3UTA D;  3NQJ A;  3AZK D;  3LJA A;  5B31 B;  1M18 A;  1P3L C;  3LZ1 C;  4LD9 C;  3WTP A;  4X23 B;  5CPJ C;  5FUG A;  3TU4 C;  5CPI C;  3A6N A;  3AZF D;  3W98 D;  1JFI B;  3MGR B;  5E5A B;  1KX5 D;  1P34 D;  2NQB C;  5CP6 A;  1P3L A;  3LZ1 A;  4LD9 A;  3AZF C;  5GT3 B;  1KX4 A;  5CPJ A;  3TU4 A;  5CPI A;  2YFV B;  5AV5 C;  1S32 B;  2PYO B;  3MNN C;  4ZUX B;  1TZY D;  2NQB A;  4J8X D;  3KWQ D;  1ZLA D;  5KDM A;  5GXQ C;  4J8U B;  3R45 A;  5AV5 A;  5BNV B;  1TZY C;  1P3B B;  4UUZ B;  4WZS B;  3MNN A;  3MVD B;  4H9Q B;  5DNN A;  2W8S A;  5GXQ A;  5B32 G;  4Z5T D;  5JA4 A;  2Y2G A;  2ARO B;  3UT9 A;  3A6N B;  4UPK A;  5B24 C;  5B32 B;  1P3M B;  2Y2I A;  3MGS C;  3REI D;  3B0C T;  4CAY B;  4CSR A;  3KUY D;  2JCH A;  2BYK A;  2G5H C;  4XUJ C;  3W99 D;  5B0Z B;  1F66 D;  1H3O A;  5B0Y C;  3UTA B;  3AZG C;  2F8N H;  5B24 A;  3AZK B;  3KUY C;  3WTP E;  3H0L C;  2F8N D;  3H0R C;  4EO5 C;  3MGS A;  4KHA A;  1F66 C;  2J8P A;  5GSU D;  4WU8 D;  1P3O D;  2F2A C;  4XUJ A;  3NQU A;  3AZF B;  3W98 B;  1M1A C;  1BH8 A;  1KX3 D;  2BYM B;  5B0Y A;  1KX5 B;  3AZE C;  3AZG A;  4R8P D;  3MGP C;  3AYW D;  4HGA B;  1P34 B;  5GSU C;  3WKJ D;  3REH D;  1P3O C;  2L5A A;  2ZY2 A;  4R8P C;  3WKJ C;  1M1A A;  4DQY B;  4J8W A;  3V9R A;  5JA4 B;  3AZE A;  5AVB C;  3AZI A;  3MGP A;  4E45 A;  1TZY B;  3X1U A;  5G49 A;  4J8X B;  1P3O A;  3C1C C;  5B40 C;  3KWQ B;  1ZLA B;  4J8V A;  3AN2 D;  2CV5 D;  2NZD C;  3WKJ A;  3LZ0 D;  2YFW A;  1TAF A;  3EPH A;  3X1T D;  5B2I D;  5AVB A;  1BH9 B;  3AN2 C;  2CV5 C;  3C1C A;  5B40 A;  1AOI D;  5B2J D;  4Z5T B;  2NZD A;  3AV2 A;  2Y2K A;  3MGQ D;  1A7W A;  4WV4 B;  3REI B;  3KUY B;  5E5A C;  3B0C W;  4G91 C;  5B31 A;  1HTA A;  3W99 B;  4H9P B;  1F66 B;  3B6F D;  2CWE A;  4X23 A;  2F8N G;  2DF4 C;  1U35 D;  2F8N B;  1S32 C;  1JFI A;  2PYO C;  3UTB D;  2JE5 A;  4ZUX C;  5GSU B;  5E5A A;  3B6G D;  4WU8 B;  1P3O B;  4M6B A;  3WA9 D;  4YM6 D;  5GT0 D;  2FJ7 D;  1KX3 B;  1P3P D;  5GT3 A;  4J8U C;  4H9O B;  4R8P B;  3AYW B;  3WKJ B;  2YFV A;  3REH B;  3AZM D;  3B6G C;  1S32 A;  1HQ3 D;  5GT0 C;  4YM6 C;  4WU9 D;  4Z66 D;  2ZM5 A;  1P3B C;  2PYO A;  4ZUX A;  3MVD C;  1P3P C;  4NE3 A;  5B40 B;  1HQ3 C;  4J8U A;  4Z66 C;  4WU9 C;  5BNV A;  5GT0 A;  3VH6 T;  5B32 C;  4YM6 A;  1P3B A;  3AV1 C;  3MVD A;  1P3M C;  3AN2 B;  3B0D C;  4H9Q A;  2CV5 B;  3X1S D;  3LZ0 B;  3AZL D;  3X1T B;  5B0Z C;  5B2I B;  3AZH D;  1P3F D;  2ARO A;  3UTA C;  3AZK C;  1W2E A;  5B32 A;  3AV1 A;  1AOI B;  2LY8 A;  5B2J B;  1P3M A;  1T3U A;  4G91 B;  3AZH C;  4CAY A;  3MGQ B;  4KGC D;  1P3F C;  5B0Z A;  3W98 C;  3EPJ A;  3UTA A;  1P3K D;  1KX5 C;  5F99 D;  3AZK A;  1P34 C;  4HGA C;  2Y2J A;  5BT1 D;  2F8N K;  3B6F B;  3B0B A;  1U35 B;  3AZF A;  3W98 A;  3UTB B;  2BYM A;  1KX5 A;  1P34 A;  3B6G B;  3WA9 B;  5GT0 B;  4YM6 B;  3KXB D;  2FJ7 B;  4J8X C;  5DNM D;  1P3P B;  3KWQ C;  4XZQ D;  5AVC D;  1ZLA C;  5B1M D;  2XD1 A;  3AZM B;  3AZJ D;  1HQ3 B;  4JJN D;  4Z66 B;  3KXB C;  4WU9 B;  5AV8 D;  5BNX B;  1P3I D;  1TZY A;  4J8X A;  3AV1 B;  3B0D B;  3KWQ A;  1ZLA A;  5AV8 C;  4Z5T C;  3REJ D;  5JRG D;  4NFT A;  1P3A D;  3KXB A;  3REI C;  4H9R B;  3VH6 W;  1BH9 A;  3P5J B;  3X1S B;  3REJ C;  5JRG C;  3REL D;  3AZL B;  3W99 C;  1P3G D;  3AZH B;  4Z5T A;  1P3F B;  2DQN C;  3REL C;  3REI A;  3LEL D;  1P3G C;  3KUY A;  4KGC B;  4WU8 C;  3VH5 A;  3W99 A;  4Z2M H;  2G5I C;  4H9P A;  1F66 A;  4E44 A;  1KX3 C;  3REK D;  3C1B D;  3AZN D;  5F99 B;  3AYW C;  3O62 D;  3REH C;  2F8N A;  2JSS A;  3EG5 B;  5GSU A;  5B33 D;  4WU8 A;  1KX3 A;  4H9O A;  5AY8 D;  1ID3 D;  4R8P A;  3AYW A;  3KXB B;  3REH A;  3TU4 B;  5B1L D;  4XZQ B;  5AVC B;  5B1M B;  3VH6 A;  2UWX A;  3AZJ B;  2Y2P A;  2FFF B;  4WNN B;  4QLC D;  3LZ0 C;  4JJN B;  5AV8 B;  3X1T C;  5B1L C;  5B2I C;  4YS3 D;  2HIO D;  3WAA D;  1P3I B;  5AV9 D;  1AOI C;  4QLC C;  5B2J C;  2XD5 A;  3AN2 A;  3X1V D;  3REJ B;  2CV5 A;  5JRG B;  4KUD D;  1BFM A;  3MGQ C;  2HIO C;  1P3A B;  5AV9 C;  3LZ0 A;  1EQZ D;  3X1T A;  5B2I A;  4G92 B;  2IO5 B;  2ZY4 A;  4KUD C;  1M19 D;  3REL B;  3VH5 T;  1P3G B;  4QLC A;  5B2J A;  1AOI A;  3B6F C;  3AFA D;  3W97 D;  3MGQ A;  1WWI A;  1U35 C;  5AV9 A;  1B67 A;  1M19 C;  4H9S C;  3LEL B;  3IP4 C;  4AWL B;  3UTB C;  1Q9C A;  4Z2M G;  3WA9 C;  3FDD A;  2FJ7 C;  3B6F A;  3REK B;  3C1B B;  4H9N B;  3AZN B;  1U35 A;  5CPK D;  3O62 B;  3W96 D;  4H9S A;  3AZM C;  3UTB A;  2ZY3 A;  2RIQ A;  5B33 B;  3B6G A;  3WA9 A;  2FJ7 A;  1P3P A;  5AV6 D;  5AY8 B;  1ID3 B;  3AZM A;  1HQ3 A;  2Y2O A;  5B1L B;  4Z66 A;  3LJA D;  4WU9 A;  5BNX A;  1M18 D;  5AV6 C;  3WTP D;  1KU5 A;  3X1S C;  4ZBJ C;  3AZL C;  4QLC B;  3A6N D;  4YS3 B;  2Y2H A;  3LJA C;  2HIO B;  3WAA B;  5AV9 B;  4NE5 A;  3H0M C;  5CP6 D;  3X1V B;  4KUD B;  1P3L D;  3LZ1 D;  4H9R A;  4LD9 D;  1KX4 D;  5CPJ D;  3X1S A;  4KGC C;  3TU4 D;  3AZL A;  1EQZ B;  5CPI D;  3AZH A;  5CP6 C;  2BG1 A;  1P3F A;  1P3K C;  5BO0 B;  5F99 C;  1M19 B;  1KX4 C;  5BT1 C;  2NQB D;  2HUE B;  3VH5 W;  3AFA B;  3W97 B;  4KGC A;  2VQR A;  5AV5 D;  3MNN D;  1N1J B;  1P3K A;  2Y2M A;  5F99 A;  3EPL A;  5DNM C;  5DNN D;  3KFU G;  4XZQ C;  5AVC C;  5C3I C;  5GXQ D;  5B1M C;  5CPK B;  3W96 B;  3AZJ C;  3UT9 D;  4JJN C;  5DNN C;  1P3I C;  5DNM A;  5AV6 B;  4XZQ A;  5AVC A;  3UT9 C;  5B1M A;  4ZBJ B;  2RVQ D;  1P3A C;  3AZJ A;  3KSY A;  3NQJ B;  4WNN A;  5B24 D;  3LJA B;  5AV8 A;  4JJN A;  1M18 B;  4G92 C;  2IO5 C;  3MGS D;  1B6W A;  3WTP B;  1P3I A;  5FUG B;  2RVQ C;  4XUJ D;  3REJ A;  5JRG A;  2Y2N A;  1P3A A;  5B0Y D;  3AZG D;  5CP6 B;  1P3L B;  3LZ1 B;  3LEL C;  1P3K B;  4LD9 B;  4AWL C;  1KX4 B;  5CPJ B;  3REL A; 
#chains in the Genus database with same CATH homology
 5CPI B;  1P3G A;  1F1E A;  1M1A D;  3REK C;  4J8W D;  3C1B C;  3AZN C;  3AZE D;  3AZI D;  3MGP D;  3O62 C;  2NQB B;  1ULY A;  3X1U D;  3LEL A;  5KDM B;  4J8V D;  5B33 C;  4J8W C;  3F6T A;  5DNM B;  3R45 B;  5AV5 B;  3AZI C;  3AL0 C;  5C3I B;  2ZY5 A;  3X1U C;  3MNN B;  3C1B A;  3REK A;  4H9N A;  5AY8 C;  3AZN A;  1ID3 C;  5AVB D;  4J8V C;  3O62 A;  5BS7 C;  5DNN B;  3C1C D;  5B40 D;  1WWS A;  5GXQ B;  5B33 A;  1PZR A;  2NZD D;  3AV2 D;  3UT9 B;  4YS3 C;  5AY8 A;  1ID3 A;  1Z2C B;  3WAA C;  3EPK A;  4CSR B;  5BS7 A;  2BYK B;  5B1L A;  3AV2 C;  5B31 D;  3X1V C;  3A1I A;  1H3O B;  4X23 D;  5B24 B;  1EQZ C;  1R4V A;  4YS3 A;  5B31 C;  2HIO A;  3MGS B;  3WAA A;  4KHA B;  3MGR D;  5E5A D;  4X23 C;  4XUJ B;  3NQU B;  4NE6 A;  3X1V A;  4KUD A;  1BH8 B;  2HUE C;  5GT3 D;  3AFA C;  3W97 C;  5B0Y B;  3AZG B;  1EQZ A;  3MGR C;  1S32 D;  4EO5 B;  2PYO D;  4ZUX D;  5BO0 A;  1M19 A;  5GT3 C;  1M1A B;  3AFA A;  3W97 A;  3V9R B;  4J8W B;  4J8U D;  3AZE B;  3AZI B;  3MGP B;  5CPK C;  4DRB A;  5CHL B;  3MGR A;  3W96 C;  3X1U B;  5G49 B;  2Y2Q A;  1P3B D;  1N1J A;  3MVD D;  4J8V B;  4WJ3 C;  4DRA A;  2YFW B;  1TAF B;  3A1K A;  5AVB B;  5CPK A;  2ARO D;  3W96 A;  3C1C B;  5B32 D;  2Y2L A;  1M18 C;  3AV1 D;  1P3M D;  2NZD B;  3WTP C;  3AV2 B;  2ARO C;  5AV6 A;  3A6N C;  5B0Z D;  4UUZ A;  5B31 G;  3UTA D;  3NQJ A;  3AZK D;  3LJA A;  5B31 B;  1M18 A;  1P3L C;  3LZ1 C;  4LD9 C;  3WTP A;  4X23 B;  5CPJ C;  5FUG A;  3TU4 C;  5CPI C;  3A6N A;  3AZF D;  3W98 D;  1JFI B;  3MGR B;  5E5A B;  1KX5 D;  1P34 D;  2NQB C;  5CP6 A;  1P3L A;  3LZ1 A;  4LD9 A;  3AZF C;  5GT3 B;  1KX4 A;  5CPJ A;  3TU4 A;  5CPI A;  2YFV B;  5AV5 C;  1S32 B;  2PYO B;  3MNN C;  4ZUX B;  1TZY D;  2NQB A;  4J8X D;  3KWQ D;  1ZLA D;  5KDM A;  5GXQ C;  4J8U B;  3R45 A;  5AV5 A;  5BNV B;  1TZY C;  1P3B B;  4UUZ B;  4WZS B;  3MNN A;  3MVD B;  4H9Q B;  5DNN A;  2W8S A;  5GXQ A;  5B32 G;  4Z5T D;  5JA4 A;  2Y2G A;  2ARO B;  3UT9 A;  3A6N B;  4UPK A;  5B24 C;  5B32 B;  1P3M B;  2Y2I A;  3MGS C;  3REI D;  3B0C T;  4CAY B;  4CSR A;  3KUY D;  2JCH A;  2BYK A;  2G5H C;  4XUJ C;  3W99 D;  5B0Z B;  1F66 D;  1H3O A;  5B0Y C;  3UTA B;  3AZG C;  2F8N H;  5B24 A;  3AZK B;  3KUY C;  3WTP E;  3H0L C;  2F8N D;  3H0R C;  4EO5 C;  3MGS A;  4KHA A;  1F66 C;  2J8P A;  5GSU D;  4WU8 D;  1P3O D;  2F2A C;  4XUJ A;  3NQU A;  3AZF B;  3W98 B;  1M1A C;  1BH8 A;  1KX3 D;  2BYM B;  5B0Y A;  1KX5 B;  3AZE C;  3AZG A;  4R8P D;  3MGP C;  3AYW D;  4HGA B;  1P34 B;  5GSU C;  3WKJ D;  3REH D;  1P3O C;  2L5A A;  2ZY2 A;  4R8P C;  3WKJ C;  1M1A A;  4DQY B;  4J8W A;  3V9R A;  5JA4 B;  3AZE A;  5AVB C;  3AZI A;  3MGP A;  4E45 A;  1TZY B;  3X1U A;  5G49 A;  4J8X B;  1P3O A;  3C1C C;  5B40 C;  3KWQ B;  1ZLA B;  4J8V A;  3AN2 D;  2CV5 D;  2NZD C;  3WKJ A;  3LZ0 D;  2YFW A;  1TAF A;  3EPH A;  3X1T D;  5B2I D;  5AVB A;  1BH9 B;  3AN2 C;  2CV5 C;  3C1C A;  5B40 A;  1AOI D;  5B2J D;  4Z5T B;  2NZD A;  3AV2 A;  2Y2K A;  3MGQ D;  1A7W A;  4WV4 B;  3REI B;  3KUY B;  5E5A C;  3B0C W;  4G91 C;  5B31 A;  1HTA A;  3W99 B;  4H9P B;  1F66 B;  3B6F D;  2CWE A;  4X23 A;  2F8N G;  2DF4 C;  1U35 D;  2F8N B;  1S32 C;  1JFI A;  2PYO C;  3UTB D;  2JE5 A;  4ZUX C;  5GSU B;  5E5A A;  3B6G D;  4WU8 B;  1P3O B;  4M6B A;  3WA9 D;  4YM6 D;  5GT0 D;  2FJ7 D;  1KX3 B;  1P3P D;  5GT3 A;  4J8U C;  4H9O B;  4R8P B;  3AYW B;  3WKJ B;  2YFV A;  3REH B;  3AZM D;  3B6G C;  1S32 A;  1HQ3 D;  5GT0 C;  4YM6 C;  4WU9 D;  4Z66 D;  2ZM5 A;  1P3B C;  2PYO A;  4ZUX A;  3MVD C;  1P3P C;  4NE3 A;  5B40 B;  1HQ3 C;  4J8U A;  4Z66 C;  4WU9 C;  5BNV A;  5GT0 A;  3VH6 T;  5B32 C;  4YM6 A;  1P3B A;  3AV1 C;  3MVD A;  1P3M C;  3AN2 B;  3B0D C;  4H9Q A;  2CV5 B;  3X1S D;  3LZ0 B;  3AZL D;  3X1T B;  5B0Z C;  5B2I B;  3AZH D;  1P3F D;  2ARO A;  3UTA C;  3AZK C;  1W2E A;  5B32 A;  3AV1 A;  1AOI B;  2LY8 A;  5B2J B;  1P3M A;  1T3U A;  4G91 B;  3AZH C;  4CAY A;  3MGQ B;  4KGC D;  1P3F C;  5B0Z A;  3W98 C;  3EPJ A;  3UTA A;  1P3K D;  1KX5 C;  5F99 D;  3AZK A;  1P34 C;  4HGA C;  2Y2J A;  5BT1 D;  2F8N K;  3B6F B;  3B0B A;  1U35 B;  3AZF A;  3W98 A;  3UTB B;  2BYM A;  1KX5 A;  1P34 A;  3B6G B;  3WA9 B;  5GT0 B;  4YM6 B;  3KXB D;  2FJ7 B;  4J8X C;  5DNM D;  1P3P B;  3KWQ C;  4XZQ D;  5AVC D;  1ZLA C;  5B1M D;  2XD1 A;  3AZM B;  3AZJ D;  1HQ3 B;  4JJN D;  4Z66 B;  3KXB C;  4WU9 B;  5AV8 D;  5BNX B;  1P3I D;  1TZY A;  4J8X A;  3AV1 B;  3B0D B;  3KWQ A;  1ZLA A;  5AV8 C;  4Z5T C;  3REJ D;  5JRG D;  4NFT A;  1P3A D;  3KXB A;  3REI C;  4H9R B;  3VH6 W;  1BH9 A;  3P5J B;  3X1S B;  3REJ C;  5JRG C;  3REL D;  3AZL B;  3W99 C;  1P3G D;  3AZH B;  4Z5T A;  1P3F B;  2DQN C;  3REL C;  3REI A;  3LEL D;  1P3G C;  3KUY A;  4KGC B;  4WU8 C;  3VH5 A;  3W99 A;  4Z2M H;  2G5I C;  4H9P A;  1F66 A;  4E44 A;  1KX3 C;  3REK D;  3C1B D;  3AZN D;  5F99 B;  3AYW C;  3O62 D;  3REH C;  2F8N A;  2JSS A;  3EG5 B;  5GSU A;  5B33 D;  4WU8 A;  1KX3 A;  4H9O A;  5AY8 D;  1ID3 D;  4R8P A;  3AYW A;  3KXB B;  3REH A;  3TU4 B;  5B1L D;  4XZQ B;  5AVC B;  5B1M B;  3VH6 A;  2UWX A;  3AZJ B;  2Y2P A;  2FFF B;  4WNN B;  4QLC D;  3LZ0 C;  4JJN B;  5AV8 B;  3X1T C;  5B1L C;  5B2I C;  4YS3 D;  2HIO D;  3WAA D;  1P3I B;  5AV9 D;  1AOI C;  4QLC C;  5B2J C;  2XD5 A;  3AN2 A;  3X1V D;  3REJ B;  2CV5 A;  5JRG B;  4KUD D;  1BFM A;  3MGQ C;  2HIO C;  1P3A B;  5AV9 C;  3LZ0 A;  1EQZ D;  3X1T A;  5B2I A;  4G92 B;  2IO5 B;  2ZY4 A;  4KUD C;  1M19 D;  3REL B;  3VH5 T;  1P3G B;  4QLC A;  5B2J A;  1AOI A;  3B6F C;  3AFA D;  3W97 D;  3MGQ A;  1WWI A;  1U35 C;  5AV9 A;  1B67 A;  1M19 C;  4H9S C;  3LEL B;  3IP4 C;  4AWL B;  3UTB C;  1Q9C A;  4Z2M G;  3WA9 C;  3FDD A;  2FJ7 C;  3B6F A;  3REK B;  3C1B B;  4H9N B;  3AZN B;  1U35 A;  5CPK D;  3O62 B;  3W96 D;  4H9S A;  3AZM C;  3UTB A;  2ZY3 A;  2RIQ A;  5B33 B;  3B6G A;  3WA9 A;  2FJ7 A;  1P3P A;  5AV6 D;  5AY8 B;  1ID3 B;  3AZM A;  1HQ3 A;  2Y2O A;  5B1L B;  4Z66 A;  3LJA D;  4WU9 A;  5BNX A;  1M18 D;  5AV6 C;  3WTP D;  1KU5 A;  3X1S C;  4ZBJ C;  3AZL C;  4QLC B;  3A6N D;  4YS3 B;  2Y2H A;  3LJA C;  2HIO B;  3WAA B;  5AV9 B;  4NE5 A;  3H0M C;  5CP6 D;  3X1V B;  4KUD B;  1P3L D;  3LZ1 D;  4H9R A;  4LD9 D;  1KX4 D;  5CPJ D;  3X1S A;  4KGC C;  3TU4 D;  3AZL A;  1EQZ B;  5CPI D;  3AZH A;  5CP6 C;  2BG1 A;  1P3F A;  1P3K C;  5BO0 B;  5F99 C;  1M19 B;  1KX4 C;  5BT1 C;  2NQB D;  2HUE B;  3VH5 W;  3AFA B;  3W97 B;  4KGC A;  2VQR A;  5AV5 D;  3MNN D;  1N1J B;  1P3K A;  2Y2M A;  5F99 A;  3EPL A;  5DNM C;  5DNN D;  3KFU G;  4XZQ C;  5AVC C;  5C3I C;  5GXQ D;  5B1M C;  5CPK B;  3W96 B;  3AZJ C;  3UT9 D;  4JJN C;  5DNN C;  1P3I C;  5DNM A;  5AV6 B;  4XZQ A;  5AVC A;  3UT9 C;  5B1M A;  4ZBJ B;  2RVQ D;  1P3A C;  3AZJ A;  3KSY A;  3NQJ B;  4WNN A;  5B24 D;  3LJA B;  5AV8 A;  4JJN A;  1M18 B;  4G92 C;  2IO5 C;  3MGS D;  1B6W A;  3WTP B;  1P3I A;  5FUG B;  2RVQ C;  4XUJ D;  3REJ A;  5JRG A;  2Y2N A;  1P3A A;  5B0Y D;  3AZG D;  5CP6 B;  1P3L B;  3LZ1 B;  3LEL C;  1P3K B;  4LD9 B;  4AWL C;  1KX4 B;  5CPJ B;  3REL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...