4QLCB

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcB00
4HGAC 2F8NA 5BO0B 5B2IA 4H9OA 4H9NA 3LZ1A 1AOID 1P3AD 1AOIB 3LJAC 3TU4B 1P3AB 2BYMA 4KGCC 4XZQB 3AZJD 5GT0C 4H9PB 5E5AC 3LZ0A 3AZJB 3UT9C 4XUJC 4WV4B 1KX5C 3WKJC 4J8VC 2NQBD 2NQBB 1F66C 1P3MC 1P3LD 1P3LB 4JJNC 1M1AB 5CPKC 3W98C 3A6NB 3B6FC 5F99C 4J8UD 1U35D 1TZYA 3V9RA 4J8UB 3KXBD 5B40D 3KXBB 1P3BB 4NE5A 1ID3A 1P3KA 5GT3A 2CV5B 5B1MD 2NZDA 1HQ3C 3VH5W 1P3GC 2LY8A 1S32D 1KU5A 1S32B 4WU9D 5CPID 4WU9B 5CPIB 1P3FD 5B31G 1P3FB 5AVBA 1P3PC 5G49B 5AV5B 3AZHC 5JRGD 5JRGB 4HGAB 3MVDC 3AYWC 3W98A 5BS7A 3MGQA 3X1VA 4YS3A 3VH5T 5B31D 3RELC 1R4VA 5GT0B 3AZKC 4XUJD 1KX5D 1KX5B 4XUJB 3WKJB 4LD9C 3W99C 5GXQC 4QLCD 4NE6A 1F66B 1F66D 3VH5A 4JJND 5B0YD 4JJNB 5B0YB 5CPKD 5CPKB 5F99D 5F99B 4M6BA 3AZNC 4H9RA 1P3OC 2FJ7D 3REJA 2FJ7B 2RVQC 3AV1C 3REHA 5FUGB 5AV9A 4Z2MH 3C1CC 1HQ3B 1P3GB 5DNNC 5CPJC 2HUEC 1P34A 1M19D 3AFAD 1M19B 1ZLAD 5AVCA 3AZHD 1KX4A 3AZHB 4Z5TA 5AY8D 1P3IC 5AY8B 4KHAB 5KDMA 3AYWD 3WTPC 3MVDB 3AYWB 3B6GA 1M18C 3AZIC 3WTPE 3VH6W 4H9SC 5B2JC 4J8WA 3REIA 3C1BD 4H9QB 3C1BB 5BO0A 3LELA 3KWQC 3RELD 5DNMD 1BH8B 3B0DC 3RELB 4ZBJC 3WAAC 3X1TD 3X1TB 1P3AA 4LD9D 4LD9B 3W97D 3W97B 5B0ZC 1HTAA 5GXQB 3W96D 3W96B 3AZED 4H9PA 4UUZB 5B33C 4CAYA 2YFWB 5B1LC 4KUDC 5C3IB 1P3LA 1P3OD 1P3OB 3AV2C 3MGPC 3AV1D 3AV1B 3MNNC 1ULYA 1U35A 4ZUXD 4ZUXB 5CP6C 3C1CD 5B40A 3C1CB 4J8XD 3AZGD 3AZGB 3VH6A 3WA9B 3WA9D 5CPJD 5GSUD 5DNNB 3UTAC 5CPJB 1EQZC 3MGSA 5B24A 4YM6C 5B1MA 5BT1C 4Z66D 4Z66B 1P3IB 3TU4D 2CWEA 4WU9A 5CPIA 3NQUB 1P3FA 5B2IC 3AZMD 4XZQD 5B2JB 3AZMB 1TAFB 3KSYA 3X1SD 4AWLC 3X1SB 3LZ1C 3O62D 1H3OB 3O62B 3KWQD 3KWQB 5AV6A 1JFIB 1BH9B 3B0DB 3WAAD 3B0CW 4ZBJB 3WAAB 5AV8A 4Z2MG 1M1AD 2AROA 3AZLC 3A6ND 5B0ZB 3LZ0C 3UTBA 5B31A 1P3BD 3AN2A 4G91C 5JA4B 1F66A 4QLCA 1N1JA 2CV5D 3AV2D 1TZYC 5B0YA 3AV2B 3KUYD 3MGPB 3KUYB 3MNNB 1ID3C 3B0CT 1P3KC 5CP6B 5GT3C 3UTAD 2FJ7A 1EQZD 3UTAB 1EQZB 5AV5D 2NZDC 4YM6D 4YM6B 5BNXA 5AVBC 4EO5C 3LJAD 3LJAB 2HIOA 1M19A 3AFAA 5B32C 1WWIA 4KGCD 1ZLAA 4R8PA 4KGCB 5B2IB 3NQJB 4AWLB 2BYKA 5AY8A 5E5AD 4DRBA 5E5AB 5GT0D 3LZ1B 3UT9D 5BS7C 3X1VC 3MGQC 3UT9B 4J8VD 4DRAA 3AYWA 4J8VB 2PYOA 4YS3C 1P3MD 2BYMB 1P3MB 4X23A 3X1UA 3C1BA 3AZLD 3AZLB 4WNNA 3LZ0D 5BNVA 3B6FD 3LZ0B 3B6FB 5DNMA 1B6WA 3X1TA 1KX3A 3W97A 3W96A 1TZYB 3REKA 1BFMA 1HQ3D 4UUZA 3AZEA 1P3GD 1ID3D 1ID3B 3REJC 5B32G 1P3KD 1P3KB 1P3PD 1P3PB 5AV9C 3MGRC 2NZDB 3AV1A 4ZUXA 3MVDD 3AZGA 3R45A 4J8XA 3WA9A 1P34C 3AZFA 5GSUA 4EO5B 5AVCC 1KX4C 4Z5TC 5B32D 2F8NH 5B32B 3B6GC 4Z66A 3W98D 1AOIA 3W98B 3TU4A 3AZKD 3X1VD 3AZKB 3X1VB 4J8WC 3REIC 4WU8C 3W99D 5GXQD 4E44A 4YS3B 3W99B 3LELC 3AZMA 4XZQA 4CSRB 3X1SA 5CHLB 3AZJA 1H3OA 3O62A 3KWQA 1P3AC 1JFIA 2NQBA 3AZND 3WAAA 3AZNB 1A7WA 1M1AA 2RVQD 3A6NA 4J8UA 3KXBA 1P3BA 4G92C 5DNND 2HUEB 5JA4A 4WZSB 2CV5A 1U35C 5AV9D 1Q9CA 5AV9B 3MGRD 2YFVB 3MGRB 3KUYA 5B40C 1S32A 1P3ID 3WTPD 3MGSC 3WTPB 1M18D 1M18B 5B24C 3AZID 3UTAA 3AZIB 5B1MC 5G49A 5AV5A 5B2JD 5JRGA 3B6GD 3B6GB 4WU9C 5CPIC 1P3FC 3LJAA 2JSSA 4J8WB 4WU8D 4KGCA 5B0ZD 4WU8B 2IO5C 3LELD 3NQJA 3LELB 5AV6C 5GT0A 5E5AA 5B33D 5B33B 3UT9A 4XUJA 5B1LD 5AV8C 1KX5A 5B1LB 4J8VA 3WKJA 4KUDB 4KUDD 2AROC 1P3MA 4E45A 4JJNA 3UTBC 5B31C 3AZLA 3MGPD 5CPKA 3B6FA 5F99A 3MNND 3AN2C 4CAYB 5CP6D 2F8NG 4QLCC 4G92B 5B0YC 5FUGA 1U35B 5BT1D 1HQ3A 1WWSA 5B40B 1P3GA 2FJ7C 3MGSD 3MGSB 5B24D 5B24B 2F8ND 1P3PA 2F8NB 5B2ID 5B1MB 2L5AA 3AZHA 4H9OB 4KHAA 3LZ1D 4H9NB 3MVDA 2HIOC 1M19C 3AFAC 1ZLAC 4R8PC 4H9QA 5B32A 5AY8C 2IO5B 1BH8A 5AV6D 3RELA 2PYOC 5AV6B 3AZKA 5AV8D 4X23C 5AV8B 4LD9A 4G91B 2AROD 3X1UC 3C1BC 2AROB 3W99A 5GXQA 4CSRA 3UTBD 1TZYD 3UTBB 3V9RB 5B31B 5DNMC 3X1TC 2YFWA 3AN2D 1KX3C 3AN2B 3W97C 3AZNA 4QLCB 5GT3D 1N1JB 3REHC 5GT3B 1P3OA 3W96C 3REKC 2NZDD 3AZEC 3C1CA 5C3IC 5DNNA 5CPJA 5AVBD 5AVBB 4ZUXC 2YFVA 3MGRA 3AZGC 5BNXB 4J8XC 3WA9C 3AZFC 3WKJD 5GSUC 1P3IA 3WTPA 3MGQD 3MGQB 3NQUA 2HIOD 1M18A 2HIOB 4YS3D 3AZIA 3AFAB 4R8PD 1ZLAB 4R8PB 4H9SA 5B2JA 1TAFA 4Z66C 1AOIC 2BYKB 3TU4C 1BH9A 2PYOD 2PYOB 4X23D 3AZMC 4X23B 4XZQC 3X1UD 3X1SC 4WU8A 3B0BA 3X1UB 5B0ZA 3AZJC 3O62C 4WNNB 5BNVB 2F8NK 5DNMB 2NQBC 5B33A 1P3LC 1KX3D 4H9RB 5B1LA 1KX3B 4KUDA 3REJD 1M1AC 3REJB 3A6NC 1B67A 3REHD 3REHB 4J8UC 3AV2A 1F1EA 3MGPA 3REKD 3KXBC 3REKB 1P3BC 3AZEB 4NE3A 4NFTA 3MNNA 5CP6A 3VH6T 1P34D 1P34B 2CV5C 1EQZA 3KUYC 5AVCD 5AVCB 4YM6A 1KX4D 1KX4B 4Z5TD 4Z5TB 1S32C 5KDMB 3R45B 4J8XB 3AZFD 3AZFB 5GSUB 5AV5C 4J8WD 3REID 3REIB 5JRGC
chains in the Genus database with same CATH superfamily
4HGAC 2F8NA 5BO0B 5B2IA 4DQYB 4H9OA 4UPKA 4H9NA 3LZ1A 1AOID 1P3AD 1AOIB 3LJAC 3TU4B 1P3AB 2BYMA 4KGCC 2Y2QA 4XZQB 3AZJD 5GT0C 4H9PB 5E5AC 3LZ0A 3AZJB 3UT9C 4XUJC 4WV4B 1KX5C 3WKJC 4J8VC 2NQBD 2NQBB 1F66C 1P3MC 1P3LD 1P3LB 3F6TA 4JJNC 1M1AB 5CPKC 3W98C 3A6NB 3B6FC 5F99C 4J8UD 1U35D 1TZYA 3V9RA 4J8UB 3KXBD 5B40D 3KXBB 1P3BB 4NE5A 1ID3A 1P3KA 5GT3A 2Y2OA 2CV5B 5B1MD 2NZDA 1HQ3C 3VH5W 1P3GC 2LY8A 1S32D 1KU5A 1S32B 4WU9D 5CPID 4WU9B 5CPIB 1P3FD 5B31G 1P3FB 5AVBA 1P3PC 2J8PA 5G49B 5AV5B 3AZHC 5JRGD 5JRGB 4HGAB 2G5HC 3MVDC 3AYWC 3W98A 5BS7A 3MGQA 2DF4C 3X1VA 4YS3A 3VH5T 5B31D 3RELC 1R4VA 5GT0B 3AZKC 4XUJD 1KX5D 2XD1A 4XUJB 1KX5B 3WKJB 4LD9C 3W99C 5GXQC 4QLCD 4NE6A 1F66B 1F66D 3VH5A 4JJND 3EPJA 5B0YD 4JJNB 5B0YB 5CPKD 5CPKB 5F99D 5F99B 4M6BA 3AZNC 4H9RA 1P3OC 3EPKA 2FJ7D 3WA9D 3REJA 2FJ7B 2RVQC 3AV1C 2VQRA 3REHA 5FUGB 5AV9A 4Z2MH 3C1CC 1HQ3B 1P3GB 5DNNC 5CPJC 2HUEC 2ZY4A 2ZM5A 1P34A 1M19D 3AFAD 1M19B 1ZLAD 5AVCA 3AL0C 3AZHD 1KX4A 3AZHB 4Z5TA 5AY8D 1P3IC 5AY8B 4KHAB 5KDMA 3AYWD 3WTPC 3MVDB 3AYWB 3B6GA 1M18C 3AZIC 3WTPE 2ZY2A 3VH6W 4H9SC 5B2JC 4J8WA 3REIA 3C1BD 4H9QB 3C1BB 5BO0A 3LELA 3KWQC 3RELD 5DNMD 1BH8B 3B0DC 3RELB 4ZBJC 3WAAC 3X1TD 3EG5B 3X1TB 1P3AA 4LD9D 4LD9B 3W97D 3W97B 2W8SA 1HTAA 5GXQB 5B0ZC 3W96D 3FDDA 3W96B 3AZED 4H9PA 4UUZB 5B33C 4CAYA 2YFWB 5B1LC 4KUDC 5C3IB 1P3LA 1P3OD 1P3OB 3AV2C 2ZY5A 3MGPC 3AV1D 3AV1B 3MNNC 1ULYA 1U35A 4ZUXD 4ZUXB 5CP6C 3C1CD 5B40A 2XD5A 3C1CB 4J8XD 3AZGD 3VH6A 3AZGB 2Y2MA 3H0RC 5CPJD 5GSUD 5DNNB 3UTAC 5CPJB 1EQZC 3WA9B 3MGSA 2Y2IA 5B24A 4YM6C 2Y2LA 5B1MA 5BT1C 4Z66D 4Z66B 1P3IB 3TU4D 2CWEA 4WU9A 5CPIA 3NQUB 1P3FA 2Y2KA 5B2IC 3AZMD 4XZQD 5B2JB 3AZMB 1TAFB 3KSYA 3X1SD 4AWLC 3X1SB 3LZ1C 3O62D 1H3OB 3O62B 3KWQD 3KWQB 5AV6A 2Y2NA 1JFIB 1BH9B 3B0DB 3WAAD 3B0CW 4ZBJB 3WAAB 5AV8A 4Z2MG 2Y2PA 1M1AD 2AROA 3AZLC 3A6ND 5B0ZB 3LZ0C 3UTBA 5B31A 1P3BD 2Y2HA 3AN2A 3IP4C 4G91C 5JA4B 1F66A 4QLCA 1N1JA 2CV5D 1T3UA 3AV2D 1TZYC 2Y2JA 5B0YA 3AV2B 3KUYD 3MGPB 3KUYB 3MNNB 1ID3C 3B0CT 1P3KC 5CP6B 5GT3C 3UTAD 2FJ7A 2JE5A 3UTAB 1EQZD 1EQZB 2G5IC 5AV5D 2NZDC 4YM6D 4YM6B 5BNXA 5AVBC 4EO5C 3LJAD 3LJAB 2HIOA 1M19A 2Y2GA 3AFAA 5B32C 1WWIA 4KGCD 1ZLAA 4R8PA 4KGCB 5B2IB 3NQJB 4AWLB 2BYKA 5AY8A 5E5AD 4DRBA 5E5AB 5GT0D 3LZ1B 3UT9D 5BS7C 3X1VC 3MGQC 3UT9B 4J8VD 4DRAA 3AYWA 4J8VB 2PYOA 4YS3C 1P3MD 2BYMB 1P3MB 4X23A 3X1UA 3C1BA 3AZLD 3AZLB 4WNNA 3LZ0D 5BNVA 3B6FD 3LZ0B 3B6FB 5DNMA 1B6WA 3X1TA 1KX3A 3W97A 3W96A 1TZYB 3REKA 1BFMA 1HQ3D 4UUZA 3AZEA 1P3GD 1ID3D 1ID3B 3REJC 5B32G 1P3KD 1P3KB 3H0LC 1P3PD 1P3PB 5AV9C 3MGRC 2NZDB 3AV1A 2RIQA 4ZUXA 3MVDD 3AZGA 3R45A 4J8XA 3WA9A 1P34C 3AZFA 5GSUA 4EO5B 5AVCC 1KX4C 4Z5TC 5B32D 2F8NH 5B32B 3B6GC 4Z66A 3W98D 1AOIA 3W98B 3TU4A 3AZKD 3X1VD 3AZKB 3X1VB 4J8WC 3REIC 4WU8C 3W99D 5GXQD 4E44A 4YS3B 3W99B 3LELC 3AZMA 4XZQA 4CSRB 3X1SA 5CHLB 3AZJA 1H3OA 3O62A 2JCHA 3KWQA 1P3AC 1JFIA 2NQBA 3AZND 3WAAA 3AZNB 1A7WA 1M1AA 2RVQD 3A6NA 4J8UA 3KXBA 1P3BA 4G92C 5DNND 2HUEB 5JA4A 4WZSB 2UWXA 2CV5A 2F2AC 1U35C 3EPHA 5AV9D 1Q9CA 5AV9B 3MGRD 2YFVB 3MGRB 3KUYA 5B40C 1S32A 1P3ID 3WTPD 3MGSC 3WTPB 1M18D 1M18B 5B24C 3AZID 3UTAA 3AZIB 5B1MC 5G49A 5AV5A 5B2JD 5JRGA 3B6GD 1PZRA 3B6GB 4WU9C 5CPIC 1P3FC 3LJAA 2BG1A 2JSSA 4J8WB 4WU8D 4KGCA 5B0ZD 4WU8B 4WJ3C 2IO5C 3LELD 3NQJA 3LELB 5AV6C 5GT0A 5E5AA 5B33D 5B33B 3UT9A 4XUJA 5B1LD 5AV8C 1KX5A 5B1LB 4J8VA 3WKJA 4KUDB 4KUDD 2AROC 1P3MA 3H0MC 2DQNC 4E45A 4JJNA 3UTBC 5B31C 3AZLA 3MGPD 5CPKA 3B6FA 5F99A 3MNND 3AN2C 4CAYB 5CP6D 2F8NG 4QLCC 4G92B 5B0YC 5FUGA 1U35B 5BT1D 1HQ3A 1WWSA 5B40B 1P3GA 2FJ7C 3MGSD 3MGSB 5B24D 5B24B 2F8ND 1P3PA 3EPLA 5B2ID 2F8NB 5B1MB 2L5AA 3AZHA 4H9OB 4KHAA 3LZ1D 4H9NB 3MVDA 2HIOC 1M19C 3AFAC 1ZLAC 4R8PC 4H9QA 5B32A 5AY8C 3P5JB 2IO5B 1BH8A 5AV6D 3RELA 2PYOC 5AV6B 3AZKA 3A1KA 5AV8D 4X23C 5AV8B 4LD9A 4G91B 2AROD 3X1UC 3C1BC 2AROB 3W99A 5GXQA 4CSRA 3UTBD 1TZYD 3UTBB 3V9RB 5B31B 5DNMC 3X1TC 2YFWA 3AN2D 1KX3C 3AN2B 3W97C 3AZNA 4QLCB 5GT3D 1N1JB 3REHC 5GT3B 1P3OA 3W96C 3REKC 2NZDD 3AZEC 3C1CA 5C3IC 5DNNA 5CPJA 5AVBD 5AVBB 2FFFB 4ZUXC 2YFVA 3MGRA 3AZGC 5BNXB 4J8XC 3WA9C 3AZFC 3WKJD 5GSUC 1P3IA 3WTPA 3MGQD 3MGQB 3NQUA 2HIOD 1M18A 2HIOB 4YS3D 3AZIA 3AFAB 4R8PD 1ZLAB 4R8PB 4H9SA 5B2JA 1TAFA 2ZY3A 4Z66C 1AOIC 2BYKB 3TU4C 1BH9A 2PYOD 1W2EA 2PYOB 4X23D 3AZMC 4X23B 4XZQC 3X1UD 3X1SC 4WU8A 3B0BA 3X1UB 5B0ZA 3AZJC 3O62C 4WNNB 5BNVB 2F8NK 5DNMB 2NQBC 5B33A 1P3LC 1KX3D 3A1IA 4H9RB 5B1LA 1KX3B 4KUDA 3REJD 1M1AC 3REJB 3A6NC 1B67A 3REHD 3REHB 4J8UC 3AV2A 1F1EA 3MGPA 3REKD 3KXBC 3REKB 1P3BC 3AZEB 4NE3A 4NFTA 3MNNA 5CP6A 3VH6T 3KFUG 1P34D 1P34B 2CV5C 1Z2CB 1EQZA 3KUYC 5AVCD 5AVCB 4YM6A 1KX4D 1KX4B 4Z5TD 4Z5TB 1S32C 5KDMB 3R45B 4J8XB 3AZFD 3AZFB 5GSUB 5AV5C 4J8WD 3REID 3REIB 5JRGC
chains in the Genus database with same CATH topology
4HGAC 2F8NA 5BO0B 5B2IA 4DQYB 4H9OA 4UPKA 4H9NA 3LZ1A 1AOID 1P3AD 1AOIB 3LJAC 3TU4B 1P3AB 2BYMA 4KGCC 2Y2QA 4XZQB 3AZJD 5GT0C 4H9PB 5E5AC 3LZ0A 3AZJB 3UT9C 4XUJC 4WV4B 1KX5C 3WKJC 4J8VC 2NQBD 2NQBB 1F66C 1P3MC 1P3LD 1P3LB 3F6TA 4JJNC 1M1AB 5CPKC 3W98C 3A6NB 3B6FC 5F99C 4J8UD 1U35D 1TZYA 3V9RA 4J8UB 3KXBD 5B40D 3KXBB 1P3BB 4NE5A 1ID3A 1P3KA 5GT3A 2Y2OA 2CV5B 5B1MD 2NZDA 1HQ3C 3VH5W 1P3GC 2LY8A 1S32D 1KU5A 1S32B 4WU9D 5CPID 4WU9B 5CPIB 1P3FD 5B31G 1P3FB 5AVBA 1P3PC 2J8PA 5G49B 5AV5B 3AZHC 5JRGD 5JRGB 4HGAB 2G5HC 3MVDC 3AYWC 3W98A 5BS7A 3MGQA 2DF4C 3X1VA 4YS3A 3VH5T 5B31D 3RELC 1R4VA 5GT0B 3AZKC 4XUJD 1KX5D 2XD1A 4XUJB 1KX5B 3WKJB 4LD9C 3W99C 5GXQC 4QLCD 4NE6A 1F66B 1F66D 3VH5A 4JJND 3EPJA 5B0YD 4JJNB 5B0YB 5CPKD 5CPKB 5F99D 5F99B 4M6BA 3AZNC 4H9RA 1P3OC 3EPKA 2FJ7D 3WA9D 3REJA 2FJ7B 2RVQC 3AV1C 2VQRA 3REHA 5FUGB 5AV9A 4Z2MH 3C1CC 1HQ3B 1P3GB 5DNNC 5CPJC 2HUEC 2ZY4A 2ZM5A 1P34A 1M19D 3AFAD 1M19B 1ZLAD 5AVCA 3AL0C 3AZHD 1KX4A 3AZHB 4Z5TA 5AY8D 1P3IC 5AY8B 4KHAB 5KDMA 3AYWD 3WTPC 3MVDB 3AYWB 3B6GA 1M18C 3AZIC 3WTPE 2ZY2A 3VH6W 4H9SC 5B2JC 4J8WA 3REIA 3C1BD 4H9QB 3C1BB 5BO0A 3LELA 3KWQC 3RELD 5DNMD 1BH8B 3B0DC 3RELB 4ZBJC 3WAAC 3X1TD 3EG5B 3X1TB 1P3AA 4LD9D 4LD9B 3W97D 3W97B 2W8SA 1HTAA 5GXQB 5B0ZC 3W96D 3FDDA 3W96B 3AZED 4H9PA 4UUZB 5B33C 4CAYA 2YFWB 5B1LC 4KUDC 5C3IB 1P3LA 1P3OD 1P3OB 3AV2C 2ZY5A 3MGPC 3AV1D 3AV1B 3MNNC 1ULYA 1U35A 4ZUXD 4ZUXB 5CP6C 3C1CD 5B40A 2XD5A 3C1CB 4J8XD 3AZGD 3VH6A 3AZGB 2Y2MA 3H0RC 5CPJD 5GSUD 5DNNB 3UTAC 5CPJB 1EQZC 3WA9B 3MGSA 2Y2IA 5B24A 4YM6C 2Y2LA 5B1MA 5BT1C 4Z66D 4Z66B 1P3IB 3TU4D 2CWEA 4WU9A 5CPIA 3NQUB 1P3FA 2Y2KA 5B2IC 3AZMD 4XZQD 5B2JB 3AZMB 1TAFB 3KSYA 3X1SD 4AWLC 3X1SB 3LZ1C 3O62D 1H3OB 3O62B 3KWQD 3KWQB 5AV6A 2Y2NA 1JFIB 1BH9B 3B0DB 3WAAD 3B0CW 4ZBJB 3WAAB 5AV8A 4Z2MG 2Y2PA 1M1AD 2AROA 3AZLC 3A6ND 5B0ZB 3LZ0C 3UTBA 5B31A 1P3BD 2Y2HA 3AN2A 3IP4C 4G91C 5JA4B 1F66A 4QLCA 1N1JA 2CV5D 1T3UA 3AV2D 1TZYC 2Y2JA 5B0YA 3AV2B 3KUYD 3MGPB 3KUYB 3MNNB 1ID3C 3B0CT 1P3KC 5CP6B 5GT3C 3UTAD 2FJ7A 2JE5A 3UTAB 1EQZD 1EQZB 2G5IC 5AV5D 2NZDC 4YM6D 4YM6B 5BNXA 5AVBC 4EO5C 3LJAD 3LJAB 2HIOA 1M19A 2Y2GA 3AFAA 5B32C 1WWIA 4KGCD 1ZLAA 4R8PA 4KGCB 5B2IB 3NQJB 4AWLB 2BYKA 5AY8A 5E5AD 4DRBA 5E5AB 5GT0D 3LZ1B 3UT9D 5BS7C 3X1VC 3MGQC 3UT9B 4J8VD 4DRAA 3AYWA 4J8VB 2PYOA 4YS3C 1P3MD 2BYMB 1P3MB 4X23A 3X1UA 3C1BA 3AZLD 3AZLB 4WNNA 3LZ0D 5BNVA 3B6FD 3LZ0B 3B6FB 5DNMA 1B6WA 3X1TA 1KX3A 3W97A 3W96A 1TZYB 3REKA 1BFMA 1HQ3D 4UUZA 3AZEA 1P3GD 1ID3D 1ID3B 3REJC 5B32G 1P3KD 1P3KB 3H0LC 1P3PD 1P3PB 5AV9C 3MGRC 2NZDB 3AV1A 2RIQA 4ZUXA 3MVDD 3AZGA 3R45A 4J8XA 3WA9A 1P34C 3AZFA 5GSUA 4EO5B 5AVCC 1KX4C 4Z5TC 5B32D 2F8NH 5B32B 3B6GC 4Z66A 3W98D 1AOIA 3W98B 3TU4A 3AZKD 3X1VD 3AZKB 3X1VB 4J8WC 3REIC 4WU8C 3W99D 5GXQD 4E44A 4YS3B 3W99B 3LELC 3AZMA 4XZQA 4CSRB 3X1SA 5CHLB 3AZJA 1H3OA 3O62A 2JCHA 3KWQA 1P3AC 1JFIA 2NQBA 3AZND 3WAAA 3AZNB 1A7WA 1M1AA 2RVQD 3A6NA 4J8UA 3KXBA 1P3BA 4G92C 5DNND 2HUEB 5JA4A 4WZSB 2UWXA 2CV5A 2F2AC 1U35C 3EPHA 5AV9D 1Q9CA 5AV9B 3MGRD 2YFVB 3MGRB 3KUYA 5B40C 1S32A 1P3ID 3WTPD 3MGSC 3WTPB 1M18D 1M18B 5B24C 3AZID 3UTAA 3AZIB 5B1MC 5G49A 5AV5A 5B2JD 5JRGA 3B6GD 1PZRA 3B6GB 4WU9C 5CPIC 1P3FC 3LJAA 2BG1A 2JSSA 4J8WB 4WU8D 4KGCA 5B0ZD 4WU8B 4WJ3C 2IO5C 3LELD 3NQJA 3LELB 5AV6C 5GT0A 5E5AA 5B33D 5B33B 3UT9A 4XUJA 5B1LD 5AV8C 1KX5A 5B1LB 4J8VA 3WKJA 4KUDB 4KUDD 2AROC 1P3MA 3H0MC 2DQNC 4E45A 4JJNA 3UTBC 5B31C 3AZLA 3MGPD 5CPKA 3B6FA 5F99A 3MNND 3AN2C 4CAYB 5CP6D 2F8NG 4QLCC 4G92B 5B0YC 5FUGA 1U35B 5BT1D 1HQ3A 1WWSA 5B40B 1P3GA 2FJ7C 3MGSD 3MGSB 5B24D 5B24B 2F8ND 1P3PA 3EPLA 5B2ID 2F8NB 5B1MB 2L5AA 3AZHA 4H9OB 4KHAA 3LZ1D 4H9NB 3MVDA 2HIOC 1M19C 3AFAC 1ZLAC 4R8PC 4H9QA 5B32A 5AY8C 3P5JB 2IO5B 1BH8A 5AV6D 3RELA 2PYOC 5AV6B 3AZKA 3A1KA 5AV8D 4X23C 5AV8B 4LD9A 4G91B 2AROD 3X1UC 3C1BC 2AROB 3W99A 5GXQA 4CSRA 3UTBD 1TZYD 3UTBB 3V9RB 5B31B 5DNMC 3X1TC 2YFWA 3AN2D 1KX3C 3AN2B 3W97C 3AZNA 4QLCB 5GT3D 1N1JB 3REHC 5GT3B 1P3OA 3W96C 3REKC 2NZDD 3AZEC 3C1CA 5C3IC 5DNNA 5CPJA 5AVBD 5AVBB 2FFFB 4ZUXC 2YFVA 3MGRA 3AZGC 5BNXB 4J8XC 3WA9C 3AZFC 3WKJD 5GSUC 1P3IA 3WTPA 3MGQD 3MGQB 3NQUA 2HIOD 1M18A 2HIOB 4YS3D 3AZIA 3AFAB 4R8PD 1ZLAB 4R8PB 4H9SA 5B2JA 1TAFA 2ZY3A 4Z66C 1AOIC 2BYKB 3TU4C 1BH9A 2PYOD 1W2EA 2PYOB 4X23D 3AZMC 4X23B 4XZQC 3X1UD 3X1SC 4WU8A 3B0BA 3X1UB 5B0ZA 3AZJC 3O62C 4WNNB 5BNVB 2F8NK 5DNMB 2NQBC 5B33A 1P3LC 1KX3D 3A1IA 4H9RB 5B1LA 1KX3B 4KUDA 3REJD 1M1AC 3REJB 3A6NC 1B67A 3REHD 3REHB 4J8UC 3AV2A 1F1EA 3MGPA 3REKD 3KXBC 3REKB 1P3BC 3AZEB 4NE3A 4NFTA 3MNNA 5CP6A 3VH6T 3KFUG 1P34D 1P34B 2CV5C 1Z2CB 1EQZA 3KUYC 5AVCD 5AVCB 4YM6A 1KX4D 1KX4B 4Z5TD 4Z5TB 1S32C 5KDMB 3R45B 4J8XB 3AZFD 3AZFB 5GSUB 5AV5C 4J8WD 3REID 3REIB 5JRGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA C;  2F8N A;  5BO0 B;  5B2I A;  4H9O A;  4H9N A;  3LZ1 A;  1AOI D;  1P3A D;  1AOI B;  3LJA C;  3TU4 B;  1P3A B;  2BYM A;  4KGC C;  4XZQ B;  3AZJ D;  5GT0 C;  4H9P B;  5E5A C;  3LZ0 A;  3AZJ B;  3UT9 C;  4XUJ C;  4WV4 B;  1KX5 C;  3WKJ C;  4J8V C;  2NQB D;  2NQB B;  1F66 C;  1P3M C;  1P3L D;  1P3L B;  4JJN C;  1M1A B;  5CPK C;  3W98 C;  3A6N B;  3B6F C;  5F99 C;  4J8U D;  1U35 D;  1TZY A;  3V9R A;  4J8U B;  3KXB D;  5B40 D;  3KXB B;  1P3B B;  4NE5 A;  1ID3 A;  1P3K A;  5GT3 A;  2CV5 B;  5B1M D;  2NZD A;  1HQ3 C;  3VH5 W;  1P3G C;  2LY8 A;  1S32 D;  1KU5 A;  1S32 B;  4WU9 D;  5CPI D;  4WU9 B;  5CPI B;  1P3F D;  5B31 G;  1P3F B;  5AVB A;  1P3P C;  5G49 B;  5AV5 B;  3AZH C;  5JRG D;  5JRG B;  4HGA B;  3MVD C;  3AYW C;  3W98 A;  5BS7 A;  3MGQ A;  3X1V A;  4YS3 A;  3VH5 T;  5B31 D;  3REL C;  1R4V A;  5GT0 B;  3AZK C;  4XUJ D;  1KX5 D;  1KX5 B;  4XUJ B;  3WKJ B;  4LD9 C;  3W99 C;  5GXQ C;  4QLC D;  4NE6 A;  1F66 B;  1F66 D;  3VH5 A;  4JJN D;  5B0Y D;  4JJN B;  5B0Y B;  5CPK D;  5CPK B;  5F99 D;  5F99 B;  4M6B A;  3AZN C;  4H9R A;  1P3O C;  2FJ7 D;  3REJ A;  2FJ7 B;  2RVQ C;  3AV1 C;  3REH A;  5FUG B;  5AV9 A;  4Z2M H;  3C1C C;  1HQ3 B;  1P3G B;  5DNN C;  5CPJ C;  2HUE C;  1P34 A;  1M19 D;  3AFA D;  1M19 B;  1ZLA D;  5AVC A;  3AZH D;  1KX4 A;  3AZH B;  4Z5T A;  5AY8 D;  1P3I C;  5AY8 B;  4KHA B;  5KDM A;  3AYW D;  3WTP C;  3MVD B;  3AYW B;  3B6G A;  1M18 C;  3AZI C;  3WTP E;  3VH6 W;  4H9S C;  5B2J C;  4J8W A;  3REI A;  3C1B D;  4H9Q B;  3C1B B;  5BO0 A;  3LEL A;  3KWQ C;  3REL D;  5DNM D;  1BH8 B;  3B0D C;  3REL B;  4ZBJ C;  3WAA C;  3X1T D;  3X1T B;  1P3A A;  4LD9 D;  4LD9 B;  3W97 D;  3W97 B;  5B0Z C;  1HTA A;  5GXQ B;  3W96 D;  3W96 B;  3AZE D;  4H9P A;  4UUZ B;  5B33 C;  4CAY A;  2YFW B;  5B1L C;  4KUD C;  5C3I B;  1P3L A;  1P3O D;  1P3O B;  3AV2 C;  3MGP C;  3AV1 D;  3AV1 B;  3MNN C;  1ULY A;  1U35 A;  4ZUX D;  4ZUX B;  5CP6 C;  3C1C D;  5B40 A;  3C1C B;  4J8X D;  3AZG D;  3AZG B;  3VH6 A;  3WA9 B;  3WA9 D;  5CPJ D;  5GSU D;  5DNN B;  3UTA C;  5CPJ B;  1EQZ C;  3MGS A;  5B24 A;  4YM6 C;  5B1M A;  5BT1 C;  4Z66 D;  4Z66 B;  1P3I B;  3TU4 D;  2CWE A;  4WU9 A;  5CPI A;  3NQU B;  1P3F A;  5B2I C;  3AZM D;  4XZQ D;  5B2J B;  3AZM B;  1TAF B;  3KSY A;  3X1S D;  4AWL C;  3X1S B;  3LZ1 C;  3O62 D;  1H3O B;  3O62 B;  3KWQ D;  3KWQ B;  5AV6 A;  1JFI B;  1BH9 B;  3B0D B;  3WAA D;  3B0C W;  4ZBJ B;  3WAA B;  5AV8 A;  4Z2M G;  1M1A D;  2ARO A;  3AZL C;  3A6N D;  5B0Z B;  3LZ0 C;  3UTB A;  5B31 A;  1P3B D;  3AN2 A;  4G91 C;  5JA4 B;  1F66 A;  4QLC A;  1N1J A;  2CV5 D;  3AV2 D;  1TZY C;  5B0Y A;  3AV2 B;  3KUY D;  3MGP B;  3KUY B;  3MNN B;  1ID3 C;  3B0C T;  1P3K C;  5CP6 B;  5GT3 C;  3UTA D;  2FJ7 A;  1EQZ D;  3UTA B;  1EQZ B;  5AV5 D;  2NZD C;  4YM6 D;  4YM6 B;  5BNX A;  5AVB C;  4EO5 C;  3LJA D;  3LJA B;  2HIO A;  1M19 A;  3AFA A;  5B32 C;  1WWI A;  4KGC D;  1ZLA A;  4R8P A;  4KGC B;  5B2I B;  3NQJ B;  4AWL B;  2BYK A;  5AY8 A;  5E5A D;  4DRB A;  5E5A B;  5GT0 D;  3LZ1 B;  3UT9 D;  5BS7 C;  3X1V C;  3MGQ C;  3UT9 B;  4J8V D;  4DRA A;  3AYW A;  4J8V B;  2PYO A;  4YS3 C;  1P3M D;  2BYM B;  1P3M B;  4X23 A;  3X1U A;  3C1B A;  3AZL D;  3AZL B;  4WNN A;  3LZ0 D;  5BNV A;  3B6F D;  3LZ0 B;  3B6F B;  5DNM A;  1B6W A;  3X1T A;  1KX3 A;  3W97 A;  3W96 A;  1TZY B;  3REK A;  1BFM A;  1HQ3 D;  4UUZ A;  3AZE A;  1P3G D;  1ID3 D;  1ID3 B;  3REJ C;  5B32 G;  1P3K D;  1P3K B;  1P3P D;  1P3P B;  5AV9 C;  3MGR C;  2NZD B;  3AV1 A;  4ZUX A;  3MVD D;  3AZG A;  3R45 A;  4J8X A;  3WA9 A;  1P34 C;  3AZF A;  5GSU A;  4EO5 B;  5AVC C;  1KX4 C;  4Z5T C;  5B32 D;  2F8N H;  5B32 B;  3B6G C;  4Z66 A;  3W98 D;  1AOI A;  3W98 B;  3TU4 A;  3AZK D;  3X1V D;  3AZK B;  3X1V B;  4J8W C;  3REI C;  4WU8 C;  3W99 D;  5GXQ D;  4E44 A;  4YS3 B;  3W99 B;  3LEL C;  3AZM A;  4XZQ A;  4CSR B;  3X1S A;  5CHL B;  3AZJ A;  1H3O A;  3O62 A;  3KWQ A;  1P3A C;  1JFI A;  2NQB A;  3AZN D;  3WAA A;  3AZN B;  1A7W A;  1M1A A;  2RVQ D;  3A6N A;  4J8U A;  3KXB A;  1P3B A;  4G92 C;  5DNN D;  2HUE B;  5JA4 A;  4WZS B;  2CV5 A;  1U35 C;  5AV9 D;  1Q9C A;  5AV9 B;  3MGR D;  2YFV B;  3MGR B;  3KUY A;  5B40 C;  1S32 A;  1P3I D;  3WTP D;  3MGS C;  3WTP B;  1M18 D;  1M18 B;  5B24 C;  3AZI D;  3UTA A;  3AZI B;  5B1M C;  5G49 A;  5AV5 A;  5B2J D;  5JRG A;  3B6G D;  3B6G B;  4WU9 C;  5CPI C;  1P3F C;  3LJA A;  2JSS A;  4J8W B;  4WU8 D;  4KGC A;  5B0Z D;  4WU8 B;  2IO5 C;  3LEL D;  3NQJ A;  3LEL B;  5AV6 C;  5GT0 A;  5E5A A;  5B33 D;  5B33 B;  3UT9 A;  4XUJ A;  5B1L D;  5AV8 C;  1KX5 A;  5B1L B;  4J8V A;  3WKJ A;  4KUD B;  4KUD D;  2ARO C;  1P3M A;  4E45 A;  4JJN A;  3UTB C;  5B31 C;  3AZL A;  3MGP D;  5CPK A;  3B6F A;  5F99 A;  3MNN D;  3AN2 C;  4CAY B;  5CP6 D;  2F8N G;  4QLC C;  4G92 B;  5B0Y C;  5FUG A;  1U35 B;  5BT1 D;  1HQ3 A;  1WWS A;  5B40 B;  1P3G A;  2FJ7 C;  3MGS D;  3MGS B;  5B24 D;  5B24 B;  2F8N D;  1P3P A;  2F8N B;  5B2I D;  5B1M B;  2L5A A;  3AZH A;  4H9O B;  4KHA A;  3LZ1 D;  4H9N B;  3MVD A;  2HIO C;  1M19 C;  3AFA C;  1ZLA C;  4R8P C;  4H9Q A;  5B32 A;  5AY8 C;  2IO5 B;  1BH8 A;  5AV6 D;  3REL A;  2PYO C;  5AV6 B;  3AZK A;  5AV8 D;  4X23 C;  5AV8 B;  4LD9 A;  4G91 B;  2ARO D;  3X1U C;  3C1B C;  2ARO B;  3W99 A;  5GXQ A;  4CSR A;  3UTB D;  1TZY D;  3UTB B;  3V9R B;  5B31 B;  5DNM C;  3X1T C;  2YFW A;  3AN2 D;  1KX3 C;  3AN2 B;  3W97 C;  3AZN A;  4QLC B;  5GT3 D;  1N1J B;  3REH C;  5GT3 B;  1P3O A;  3W96 C;  3REK C;  2NZD D;  3AZE C;  3C1C A;  5C3I C;  5DNN A;  5CPJ A;  5AVB D;  5AVB B;  4ZUX C;  2YFV A;  3MGR A;  3AZG C;  5BNX B;  4J8X C;  3WA9 C;  3AZF C;  3WKJ D;  5GSU C;  1P3I A;  3WTP A;  3MGQ D;  3MGQ B;  3NQU A;  2HIO D;  1M18 A;  2HIO B;  4YS3 D;  3AZI A;  3AFA B;  4R8P D;  1ZLA B;  4R8P B;  4H9S A;  5B2J A;  1TAF A;  4Z66 C;  1AOI C;  2BYK B;  3TU4 C;  1BH9 A;  2PYO D;  2PYO B;  4X23 D;  3AZM C;  4X23 B;  4XZQ C;  3X1U D;  3X1S C;  4WU8 A;  3B0B A;  3X1U B;  5B0Z A;  3AZJ C;  3O62 C;  4WNN B;  5BNV B;  2F8N K;  5DNM B;  2NQB C;  5B33 A;  1P3L C;  1KX3 D;  4H9R B;  5B1L A;  1KX3 B;  4KUD A;  3REJ D;  1M1A C;  3REJ B;  3A6N C;  1B67 A;  3REH D;  3REH B;  4J8U C;  3AV2 A;  1F1E A;  3MGP A;  3REK D;  3KXB C;  3REK B;  1P3B C;  3AZE B;  4NE3 A;  4NFT A;  3MNN A;  5CP6 A;  3VH6 T;  1P34 D;  1P34 B;  2CV5 C;  1EQZ A;  3KUY C;  5AVC D;  5AVC B;  4YM6 A;  1KX4 D;  1KX4 B;  4Z5T D;  4Z5T B;  1S32 C;  5KDM B;  3R45 B;  4J8X B;  3AZF D;  3AZF B;  5GSU B;  5AV5 C;  4J8W D;  3REI D;  3REI B;  5JRG C; 
#chains in the Genus database with same CATH topology
 4HGA C;  2F8N A;  5BO0 B;  5B2I A;  4DQY B;  4H9O A;  4UPK A;  4H9N A;  3LZ1 A;  1AOI D;  1P3A D;  1AOI B;  3LJA C;  3TU4 B;  1P3A B;  2BYM A;  4KGC C;  2Y2Q A;  4XZQ B;  3AZJ D;  5GT0 C;  4H9P B;  5E5A C;  3LZ0 A;  3AZJ B;  3UT9 C;  4XUJ C;  4WV4 B;  1KX5 C;  3WKJ C;  4J8V C;  2NQB D;  2NQB B;  1F66 C;  1P3M C;  1P3L D;  1P3L B;  3F6T A;  4JJN C;  1M1A B;  5CPK C;  3W98 C;  3A6N B;  3B6F C;  5F99 C;  4J8U D;  1U35 D;  1TZY A;  3V9R A;  4J8U B;  3KXB D;  5B40 D;  3KXB B;  1P3B B;  4NE5 A;  1ID3 A;  1P3K A;  5GT3 A;  2Y2O A;  2CV5 B;  5B1M D;  2NZD A;  1HQ3 C;  3VH5 W;  1P3G C;  2LY8 A;  1S32 D;  1KU5 A;  1S32 B;  4WU9 D;  5CPI D;  4WU9 B;  5CPI B;  1P3F D;  5B31 G;  1P3F B;  5AVB A;  1P3P C;  2J8P A;  5G49 B;  5AV5 B;  3AZH C;  5JRG D;  5JRG B;  4HGA B;  2G5H C;  3MVD C;  3AYW C;  3W98 A;  5BS7 A;  3MGQ A;  2DF4 C;  3X1V A;  4YS3 A;  3VH5 T;  5B31 D;  3REL C;  1R4V A;  5GT0 B;  3AZK C;  4XUJ D;  1KX5 D;  2XD1 A;  4XUJ B;  1KX5 B;  3WKJ B;  4LD9 C;  3W99 C;  5GXQ C;  4QLC D;  4NE6 A;  1F66 B;  1F66 D;  3VH5 A;  4JJN D;  3EPJ A;  5B0Y D;  4JJN B;  5B0Y B;  5CPK D;  5CPK B;  5F99 D;  5F99 B;  4M6B A;  3AZN C;  4H9R A;  1P3O C;  3EPK A;  2FJ7 D;  3WA9 D;  3REJ A;  2FJ7 B;  2RVQ C;  3AV1 C;  2VQR A;  3REH A;  5FUG B;  5AV9 A;  4Z2M H;  3C1C C;  1HQ3 B;  1P3G B;  5DNN C;  5CPJ C;  2HUE C;  2ZY4 A;  2ZM5 A;  1P34 A;  1M19 D;  3AFA D;  1M19 B;  1ZLA D;  5AVC A;  3AL0 C;  3AZH D;  1KX4 A;  3AZH B;  4Z5T A;  5AY8 D;  1P3I C;  5AY8 B;  4KHA B;  5KDM A;  3AYW D;  3WTP C;  3MVD B;  3AYW B;  3B6G A;  1M18 C;  3AZI C;  3WTP E;  2ZY2 A;  3VH6 W;  4H9S C;  5B2J C;  4J8W A;  3REI A;  3C1B D;  4H9Q B;  3C1B B;  5BO0 A;  3LEL A;  3KWQ C;  3REL D;  5DNM D;  1BH8 B;  3B0D C;  3REL B;  4ZBJ C;  3WAA C;  3X1T D;  3EG5 B;  3X1T B;  1P3A A;  4LD9 D;  4LD9 B;  3W97 D;  3W97 B;  2W8S A;  1HTA A;  5GXQ B;  5B0Z C;  3W96 D;  3FDD A;  3W96 B;  3AZE D;  4H9P A;  4UUZ B;  5B33 C;  4CAY A;  2YFW B;  5B1L C;  4KUD C;  5C3I B;  1P3L A;  1P3O D;  1P3O B;  3AV2 C;  2ZY5 A;  3MGP C;  3AV1 D;  3AV1 B;  3MNN C;  1ULY A;  1U35 A;  4ZUX D;  4ZUX B;  5CP6 C;  3C1C D;  5B40 A;  2XD5 A;  3C1C B;  4J8X D;  3AZG D;  3VH6 A;  3AZG B;  2Y2M A;  3H0R C;  5CPJ D;  5GSU D;  5DNN B;  3UTA C;  5CPJ B;  1EQZ C;  3WA9 B;  3MGS A;  2Y2I A;  5B24 A;  4YM6 C;  2Y2L A;  5B1M A;  5BT1 C;  4Z66 D;  4Z66 B;  1P3I B;  3TU4 D;  2CWE A;  4WU9 A;  5CPI A;  3NQU B;  1P3F A;  2Y2K A;  5B2I C;  3AZM D;  4XZQ D;  5B2J B;  3AZM B;  1TAF B;  3KSY A;  3X1S D;  4AWL C;  3X1S B;  3LZ1 C;  3O62 D;  1H3O B;  3O62 B;  3KWQ D;  3KWQ B;  5AV6 A;  2Y2N A;  1JFI B;  1BH9 B;  3B0D B;  3WAA D;  3B0C W;  4ZBJ B;  3WAA B;  5AV8 A;  4Z2M G;  2Y2P A;  1M1A D;  2ARO A;  3AZL C;  3A6N D;  5B0Z B;  3LZ0 C;  3UTB A;  5B31 A;  1P3B D;  2Y2H A;  3AN2 A;  3IP4 C;  4G91 C;  5JA4 B;  1F66 A;  4QLC A;  1N1J A;  2CV5 D;  1T3U A;  3AV2 D;  1TZY C;  2Y2J A;  5B0Y A;  3AV2 B;  3KUY D;  3MGP B;  3KUY B;  3MNN B;  1ID3 C;  3B0C T;  1P3K C;  5CP6 B;  5GT3 C;  3UTA D;  2FJ7 A;  2JE5 A;  3UTA B;  1EQZ D;  1EQZ B;  2G5I C;  5AV5 D;  2NZD C;  4YM6 D;  4YM6 B;  5BNX A;  5AVB C;  4EO5 C;  3LJA D;  3LJA B;  2HIO A;  1M19 A;  2Y2G A;  3AFA A;  5B32 C;  1WWI A;  4KGC D;  1ZLA A;  4R8P A;  4KGC B;  5B2I B;  3NQJ B;  4AWL B;  2BYK A;  5AY8 A;  5E5A D;  4DRB A;  5E5A B;  5GT0 D;  3LZ1 B;  3UT9 D;  5BS7 C;  3X1V C;  3MGQ C;  3UT9 B;  4J8V D;  4DRA A;  3AYW A;  4J8V B;  2PYO A;  4YS3 C;  1P3M D;  2BYM B;  1P3M B;  4X23 A;  3X1U A;  3C1B A;  3AZL D;  3AZL B;  4WNN A;  3LZ0 D;  5BNV A;  3B6F D;  3LZ0 B;  3B6F B;  5DNM A;  1B6W A;  3X1T A;  1KX3 A;  3W97 A;  3W96 A;  1TZY B;  3REK A;  1BFM A;  1HQ3 D;  4UUZ A;  3AZE A;  1P3G D;  1ID3 D;  1ID3 B;  3REJ C;  5B32 G;  1P3K D;  1P3K B;  3H0L C;  1P3P D;  1P3P B;  5AV9 C;  3MGR C;  2NZD B;  3AV1 A;  2RIQ A;  4ZUX A;  3MVD D;  3AZG A;  3R45 A;  4J8X A;  3WA9 A;  1P34 C;  3AZF A;  5GSU A;  4EO5 B;  5AVC C;  1KX4 C;  4Z5T C;  5B32 D;  2F8N H;  5B32 B;  3B6G C;  4Z66 A;  3W98 D;  1AOI A;  3W98 B;  3TU4 A;  3AZK D;  3X1V D;  3AZK B;  3X1V B;  4J8W C;  3REI C;  4WU8 C;  3W99 D;  5GXQ D;  4E44 A;  4YS3 B;  3W99 B;  3LEL C;  3AZM A;  4XZQ A;  4CSR B;  3X1S A;  5CHL B;  3AZJ A;  1H3O A;  3O62 A;  2JCH A;  3KWQ A;  1P3A C;  1JFI A;  2NQB A;  3AZN D;  3WAA A;  3AZN B;  1A7W A;  1M1A A;  2RVQ D;  3A6N A;  4J8U A;  3KXB A;  1P3B A;  4G92 C;  5DNN D;  2HUE B;  5JA4 A;  4WZS B;  2UWX A;  2CV5 A;  2F2A C;  1U35 C;  3EPH A;  5AV9 D;  1Q9C A;  5AV9 B;  3MGR D;  2YFV B;  3MGR B;  3KUY A;  5B40 C;  1S32 A;  1P3I D;  3WTP D;  3MGS C;  3WTP B;  1M18 D;  1M18 B;  5B24 C;  3AZI D;  3UTA A;  3AZI B;  5B1M C;  5G49 A;  5AV5 A;  5B2J D;  5JRG A;  3B6G D;  1PZR A;  3B6G B;  4WU9 C;  5CPI C;  1P3F C;  3LJA A;  2BG1 A;  2JSS A;  4J8W B;  4WU8 D;  4KGC A;  5B0Z D;  4WU8 B;  4WJ3 C;  2IO5 C;  3LEL D;  3NQJ A;  3LEL B;  5AV6 C;  5GT0 A;  5E5A A;  5B33 D;  5B33 B;  3UT9 A;  4XUJ A;  5B1L D;  5AV8 C;  1KX5 A;  5B1L B;  4J8V A;  3WKJ A;  4KUD B;  4KUD D;  2ARO C;  1P3M A;  3H0M C;  2DQN C;  4E45 A;  4JJN A;  3UTB C;  5B31 C;  3AZL A;  3MGP D;  5CPK A;  3B6F A;  5F99 A;  3MNN D;  3AN2 C;  4CAY B;  5CP6 D;  2F8N G;  4QLC C;  4G92 B;  5B0Y C;  5FUG A;  1U35 B;  5BT1 D;  1HQ3 A;  1WWS A;  5B40 B;  1P3G A;  2FJ7 C;  3MGS D;  3MGS B;  5B24 D;  5B24 B;  2F8N D;  1P3P A;  3EPL A;  5B2I D;  2F8N B;  5B1M B;  2L5A A;  3AZH A;  4H9O B;  4KHA A;  3LZ1 D;  4H9N B;  3MVD A;  2HIO C;  1M19 C;  3AFA C;  1ZLA C;  4R8P C;  4H9Q A;  5B32 A;  5AY8 C;  3P5J B;  2IO5 B;  1BH8 A;  5AV6 D;  3REL A;  2PYO C;  5AV6 B;  3AZK A;  3A1K A;  5AV8 D;  4X23 C;  5AV8 B;  4LD9 A;  4G91 B;  2ARO D;  3X1U C;  3C1B C;  2ARO B;  3W99 A;  5GXQ A;  4CSR A;  3UTB D;  1TZY D;  3UTB B;  3V9R B;  5B31 B;  5DNM C;  3X1T C;  2YFW A;  3AN2 D;  1KX3 C;  3AN2 B;  3W97 C;  3AZN A;  4QLC B;  5GT3 D;  1N1J B;  3REH C;  5GT3 B;  1P3O A;  3W96 C;  3REK C;  2NZD D;  3AZE C;  3C1C A;  5C3I C;  5DNN A;  5CPJ A;  5AVB D;  5AVB B;  2FFF B;  4ZUX C;  2YFV A;  3MGR A;  3AZG C;  5BNX B;  4J8X C;  3WA9 C;  3AZF C;  3WKJ D;  5GSU C;  1P3I A;  3WTP A;  3MGQ D;  3MGQ B;  3NQU A;  2HIO D;  1M18 A;  2HIO B;  4YS3 D;  3AZI A;  3AFA B;  4R8P D;  1ZLA B;  4R8P B;  4H9S A;  5B2J A;  1TAF A;  2ZY3 A;  4Z66 C;  1AOI C;  2BYK B;  3TU4 C;  1BH9 A;  2PYO D;  1W2E A;  2PYO B;  4X23 D;  3AZM C;  4X23 B;  4XZQ C;  3X1U D;  3X1S C;  4WU8 A;  3B0B A;  3X1U B;  5B0Z A;  3AZJ C;  3O62 C;  4WNN B;  5BNV B;  2F8N K;  5DNM B;  2NQB C;  5B33 A;  1P3L C;  1KX3 D;  3A1I A;  4H9R B;  5B1L A;  1KX3 B;  4KUD A;  3REJ D;  1M1A C;  3REJ B;  3A6N C;  1B67 A;  3REH D;  3REH B;  4J8U C;  3AV2 A;  1F1E A;  3MGP A;  3REK D;  3KXB C;  3REK B;  1P3B C;  3AZE B;  4NE3 A;  4NFT A;  3MNN A;  5CP6 A;  3VH6 T;  3KFU G;  1P34 D;  1P34 B;  2CV5 C;  1Z2C B;  1EQZ A;  3KUY C;  5AVC D;  5AVC B;  4YM6 A;  1KX4 D;  1KX4 B;  4Z5T D;  4Z5T B;  1S32 C;  5KDM B;  3R45 B;  4J8X B;  3AZF D;  3AZF B;  5GSU B;  5AV5 C;  4J8W D;  3REI D;  3REI B;  5JRG C; 
#chains in the Genus database with same CATH homology
 4HGA C;  2F8N A;  5BO0 B;  5B2I A;  4DQY B;  4H9O A;  4UPK A;  4H9N A;  3LZ1 A;  1AOI D;  1P3A D;  1AOI B;  3LJA C;  3TU4 B;  1P3A B;  2BYM A;  4KGC C;  2Y2Q A;  4XZQ B;  3AZJ D;  5GT0 C;  4H9P B;  5E5A C;  3LZ0 A;  3AZJ B;  3UT9 C;  4XUJ C;  4WV4 B;  1KX5 C;  3WKJ C;  4J8V C;  2NQB D;  2NQB B;  1F66 C;  1P3M C;  1P3L D;  1P3L B;  3F6T A;  4JJN C;  1M1A B;  5CPK C;  3W98 C;  3A6N B;  3B6F C;  5F99 C;  4J8U D;  1U35 D;  1TZY A;  3V9R A;  4J8U B;  3KXB D;  5B40 D;  3KXB B;  1P3B B;  4NE5 A;  1ID3 A;  1P3K A;  5GT3 A;  2Y2O A;  2CV5 B;  5B1M D;  2NZD A;  1HQ3 C;  3VH5 W;  1P3G C;  2LY8 A;  1S32 D;  1KU5 A;  1S32 B;  4WU9 D;  5CPI D;  4WU9 B;  5CPI B;  1P3F D;  5B31 G;  1P3F B;  5AVB A;  1P3P C;  2J8P A;  5G49 B;  5AV5 B;  3AZH C;  5JRG D;  5JRG B;  4HGA B;  2G5H C;  3MVD C;  3AYW C;  3W98 A;  5BS7 A;  3MGQ A;  2DF4 C;  3X1V A;  4YS3 A;  3VH5 T;  5B31 D;  3REL C;  1R4V A;  5GT0 B;  3AZK C;  4XUJ D;  1KX5 D;  2XD1 A;  4XUJ B;  1KX5 B;  3WKJ B;  4LD9 C;  3W99 C;  5GXQ C;  4QLC D;  4NE6 A;  1F66 B;  1F66 D;  3VH5 A;  4JJN D;  3EPJ A;  5B0Y D;  4JJN B;  5B0Y B;  5CPK D;  5CPK B;  5F99 D;  5F99 B;  4M6B A;  3AZN C;  4H9R A;  1P3O C;  3EPK A;  2FJ7 D;  3WA9 D;  3REJ A;  2FJ7 B;  2RVQ C;  3AV1 C;  2VQR A;  3REH A;  5FUG B;  5AV9 A;  4Z2M H;  3C1C C;  1HQ3 B;  1P3G B;  5DNN C;  5CPJ C;  2HUE C;  2ZY4 A;  2ZM5 A;  1P34 A;  1M19 D;  3AFA D;  1M19 B;  1ZLA D;  5AVC A;  3AL0 C;  3AZH D;  1KX4 A;  3AZH B;  4Z5T A;  5AY8 D;  1P3I C;  5AY8 B;  4KHA B;  5KDM A;  3AYW D;  3WTP C;  3MVD B;  3AYW B;  3B6G A;  1M18 C;  3AZI C;  3WTP E;  2ZY2 A;  3VH6 W;  4H9S C;  5B2J C;  4J8W A;  3REI A;  3C1B D;  4H9Q B;  3C1B B;  5BO0 A;  3LEL A;  3KWQ C;  3REL D;  5DNM D;  1BH8 B;  3B0D C;  3REL B;  4ZBJ C;  3WAA C;  3X1T D;  3EG5 B;  3X1T B;  1P3A A;  4LD9 D;  4LD9 B;  3W97 D;  3W97 B;  2W8S A;  1HTA A;  5GXQ B;  5B0Z C;  3W96 D;  3FDD A;  3W96 B;  3AZE D;  4H9P A;  4UUZ B;  5B33 C;  4CAY A;  2YFW B;  5B1L C;  4KUD C;  5C3I B;  1P3L A;  1P3O D;  1P3O B;  3AV2 C;  2ZY5 A;  3MGP C;  3AV1 D;  3AV1 B;  3MNN C;  1ULY A;  1U35 A;  4ZUX D;  4ZUX B;  5CP6 C;  3C1C D;  5B40 A;  2XD5 A;  3C1C B;  4J8X D;  3AZG D;  3VH6 A;  3AZG B;  2Y2M A;  3H0R C;  5CPJ D;  5GSU D;  5DNN B;  3UTA C;  5CPJ B;  1EQZ C;  3WA9 B;  3MGS A;  2Y2I A;  5B24 A;  4YM6 C;  2Y2L A;  5B1M A;  5BT1 C;  4Z66 D;  4Z66 B;  1P3I B;  3TU4 D;  2CWE A;  4WU9 A;  5CPI A;  3NQU B;  1P3F A;  2Y2K A;  5B2I C;  3AZM D;  4XZQ D;  5B2J B;  3AZM B;  1TAF B;  3KSY A;  3X1S D;  4AWL C;  3X1S B;  3LZ1 C;  3O62 D;  1H3O B;  3O62 B;  3KWQ D;  3KWQ B;  5AV6 A;  2Y2N A;  1JFI B;  1BH9 B;  3B0D B;  3WAA D;  3B0C W;  4ZBJ B;  3WAA B;  5AV8 A;  4Z2M G;  2Y2P A;  1M1A D;  2ARO A;  3AZL C;  3A6N D;  5B0Z B;  3LZ0 C;  3UTB A;  5B31 A;  1P3B D;  2Y2H A;  3AN2 A;  3IP4 C;  4G91 C;  5JA4 B;  1F66 A;  4QLC A;  1N1J A;  2CV5 D;  1T3U A;  3AV2 D;  1TZY C;  2Y2J A;  5B0Y A;  3AV2 B;  3KUY D;  3MGP B;  3KUY B;  3MNN B;  1ID3 C;  3B0C T;  1P3K C;  5CP6 B;  5GT3 C;  3UTA D;  2FJ7 A;  2JE5 A;  3UTA B;  1EQZ D;  1EQZ B;  2G5I C;  5AV5 D;  2NZD C;  4YM6 D;  4YM6 B;  5BNX A;  5AVB C;  4EO5 C;  3LJA D;  3LJA B;  2HIO A;  1M19 A;  2Y2G A;  3AFA A;  5B32 C;  1WWI A;  4KGC D;  1ZLA A;  4R8P A;  4KGC B;  5B2I B;  3NQJ B;  4AWL B;  2BYK A;  5AY8 A;  5E5A D;  4DRB A;  5E5A B;  5GT0 D;  3LZ1 B;  3UT9 D;  5BS7 C;  3X1V C;  3MGQ C;  3UT9 B;  4J8V D;  4DRA A;  3AYW A;  4J8V B;  2PYO A;  4YS3 C;  1P3M D;  2BYM B;  1P3M B;  4X23 A;  3X1U A;  3C1B A;  3AZL D;  3AZL B;  4WNN A;  3LZ0 D;  5BNV A;  3B6F D;  3LZ0 B;  3B6F B;  5DNM A;  1B6W A;  3X1T A;  1KX3 A;  3W97 A;  3W96 A;  1TZY B;  3REK A;  1BFM A;  1HQ3 D;  4UUZ A;  3AZE A;  1P3G D;  1ID3 D;  1ID3 B;  3REJ C;  5B32 G;  1P3K D;  1P3K B;  3H0L C;  1P3P D;  1P3P B;  5AV9 C;  3MGR C;  2NZD B;  3AV1 A;  2RIQ A;  4ZUX A;  3MVD D;  3AZG A;  3R45 A;  4J8X A;  3WA9 A;  1P34 C;  3AZF A;  5GSU A;  4EO5 B;  5AVC C;  1KX4 C;  4Z5T C;  5B32 D;  2F8N H;  5B32 B;  3B6G C;  4Z66 A;  3W98 D;  1AOI A;  3W98 B;  3TU4 A;  3AZK D;  3X1V D;  3AZK B;  3X1V B;  4J8W C;  3REI C;  4WU8 C;  3W99 D;  5GXQ D;  4E44 A;  4YS3 B;  3W99 B;  3LEL C;  3AZM A;  4XZQ A;  4CSR B;  3X1S A;  5CHL B;  3AZJ A;  1H3O A;  3O62 A;  2JCH A;  3KWQ A;  1P3A C;  1JFI A;  2NQB A;  3AZN D;  3WAA A;  3AZN B;  1A7W A;  1M1A A;  2RVQ D;  3A6N A;  4J8U A;  3KXB A;  1P3B A;  4G92 C;  5DNN D;  2HUE B;  5JA4 A;  4WZS B;  2UWX A;  2CV5 A;  2F2A C;  1U35 C;  3EPH A;  5AV9 D;  1Q9C A;  5AV9 B;  3MGR D;  2YFV B;  3MGR B;  3KUY A;  5B40 C;  1S32 A;  1P3I D;  3WTP D;  3MGS C;  3WTP B;  1M18 D;  1M18 B;  5B24 C;  3AZI D;  3UTA A;  3AZI B;  5B1M C;  5G49 A;  5AV5 A;  5B2J D;  5JRG A;  3B6G D;  1PZR A;  3B6G B;  4WU9 C;  5CPI C;  1P3F C;  3LJA A;  2BG1 A;  2JSS A;  4J8W B;  4WU8 D;  4KGC A;  5B0Z D;  4WU8 B;  4WJ3 C;  2IO5 C;  3LEL D;  3NQJ A;  3LEL B;  5AV6 C;  5GT0 A;  5E5A A;  5B33 D;  5B33 B;  3UT9 A;  4XUJ A;  5B1L D;  5AV8 C;  1KX5 A;  5B1L B;  4J8V A;  3WKJ A;  4KUD B;  4KUD D;  2ARO C;  1P3M A;  3H0M C;  2DQN C;  4E45 A;  4JJN A;  3UTB C;  5B31 C;  3AZL A;  3MGP D;  5CPK A;  3B6F A;  5F99 A;  3MNN D;  3AN2 C;  4CAY B;  5CP6 D;  2F8N G;  4QLC C;  4G92 B;  5B0Y C;  5FUG A;  1U35 B;  5BT1 D;  1HQ3 A;  1WWS A;  5B40 B;  1P3G A;  2FJ7 C;  3MGS D;  3MGS B;  5B24 D;  5B24 B;  2F8N D;  1P3P A;  3EPL A;  5B2I D;  2F8N B;  5B1M B;  2L5A A;  3AZH A;  4H9O B;  4KHA A;  3LZ1 D;  4H9N B;  3MVD A;  2HIO C;  1M19 C;  3AFA C;  1ZLA C;  4R8P C;  4H9Q A;  5B32 A;  5AY8 C;  3P5J B;  2IO5 B;  1BH8 A;  5AV6 D;  3REL A;  2PYO C;  5AV6 B;  3AZK A;  3A1K A;  5AV8 D;  4X23 C;  5AV8 B;  4LD9 A;  4G91 B;  2ARO D;  3X1U C;  3C1B C;  2ARO B;  3W99 A;  5GXQ A;  4CSR A;  3UTB D;  1TZY D;  3UTB B;  3V9R B;  5B31 B;  5DNM C;  3X1T C;  2YFW A;  3AN2 D;  1KX3 C;  3AN2 B;  3W97 C;  3AZN A;  4QLC B;  5GT3 D;  1N1J B;  3REH C;  5GT3 B;  1P3O A;  3W96 C;  3REK C;  2NZD D;  3AZE C;  3C1C A;  5C3I C;  5DNN A;  5CPJ A;  5AVB D;  5AVB B;  2FFF B;  4ZUX C;  2YFV A;  3MGR A;  3AZG C;  5BNX B;  4J8X C;  3WA9 C;  3AZF C;  3WKJ D;  5GSU C;  1P3I A;  3WTP A;  3MGQ D;  3MGQ B;  3NQU A;  2HIO D;  1M18 A;  2HIO B;  4YS3 D;  3AZI A;  3AFA B;  4R8P D;  1ZLA B;  4R8P B;  4H9S A;  5B2J A;  1TAF A;  2ZY3 A;  4Z66 C;  1AOI C;  2BYK B;  3TU4 C;  1BH9 A;  2PYO D;  1W2E A;  2PYO B;  4X23 D;  3AZM C;  4X23 B;  4XZQ C;  3X1U D;  3X1S C;  4WU8 A;  3B0B A;  3X1U B;  5B0Z A;  3AZJ C;  3O62 C;  4WNN B;  5BNV B;  2F8N K;  5DNM B;  2NQB C;  5B33 A;  1P3L C;  1KX3 D;  3A1I A;  4H9R B;  5B1L A;  1KX3 B;  4KUD A;  3REJ D;  1M1A C;  3REJ B;  3A6N C;  1B67 A;  3REH D;  3REH B;  4J8U C;  3AV2 A;  1F1E A;  3MGP A;  3REK D;  3KXB C;  3REK B;  1P3B C;  3AZE B;  4NE3 A;  4NFT A;  3MNN A;  5CP6 A;  3VH6 T;  3KFU G;  1P34 D;  1P34 B;  2CV5 C;  1Z2C B;  1EQZ A;  3KUY C;  5AVC D;  5AVC B;  4YM6 A;  1KX4 D;  1KX4 B;  4Z5T D;  4Z5T B;  1S32 C;  5KDM B;  3R45 B;  4J8X B;  3AZF D;  3AZF B;  5GSU B;  5AV5 C;  4J8W D;  3REI D;  3REI B;  5JRG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...