4QLCB

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromatin binding protein/dna
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcB00
3AZEB 3REJA 3REHC 3AZGC 1AOIC 5GSUA 2BYKA 5B33D 4UUZB 5CPJA 3WKJB 5E5AD 2YFVB 4XUJD 5C3IB 3W99C 5B2IC 4DRBA 5CPKC 3REKD 4CSRB 3AZHB 5AV5C 4Z2MH 5GXQB 4JJND 3X1VD 4R8PC 1ID3B 3W97C 3X1UD 5CP6B 3C1BB 3KWQD 5AV8D 1P3PA 3AZKD 3UTBB 2RVQD 4H9OA 5GT3A 4Z2MG 5B33C 3MGPD 5FUGA 5B32C 5E5AC 3VH5W 4XUJC 3TU4A 4NFTA 3KUYB 4YS3A 3REJD 3LELD 3AZNB 4H9NB 3UT9A 3REKC 3MGRD 3X1VB 1S32C 2F8NK 5AY8A 1P3KC 4JJNC 2YFWB 3X1UB 1KX5B 1P3AB 3C1CD 4QLCB 3RELB 1F1EA 2HIOC 4J8UD 5CPIA 3LZ1A 4KGCA 3KWQC 5AV8C 3O62D 3MGPB 3AZKC 3AZMD 3MGQA 5AVBC 2RVQC 4ZBJB 1P3MA 3WAAD 1BH9A 1KX4A 1TZYD 5B1LD 3KXBD 1M19D 2NZDA 1EQZD 3REJC 3LELC 3MGSD 5GSUC 4XZQB 3AZID 5CPJC 3MGRC 1HQ3A 5DNMA 3TU4D 1ZLAB 4YS3D 2F8ND 2PYOD 3A6ND 5B31B 2HUEC 3B6GA 4J8VA 2LY8A 3O62B 1F66B 4J8UC 2BYMB 3UTAA 5B1MA 3AYWB 3AFAD 3AZMC 3KXBB 4AWLC 3WA9A 1TZYC 3B0CT 5B1LC 3AV1B 1M19C 1P3PC 1P3GB 5B0ZB 3AZIB 1P3OD 1EQZC 5G49A 5B0YD 1BH8A 3AZEA 3MGSC 5GT3C 1P3FB 3VH6A 2F8NB 3LZ0D 3AZJD 3MVDD 2PYOB 3A6NB 3TU4C 2NZDD 3AV2B 4YS3C 4YM6D 3AN2B 2FJ7D 3MNNB 3LJAD 3W96A 3REHD 1KX3A 1HQ3D 4H9PA 4NE3A 3V9RA 5B2JB 5AV6B 4CSRA 3W98B 4G91C 1M18B 5AVCB 4ZUXD 3B0DB 5GXQA 1HTAA 1ID3A 4J8VD 5JA4B 5CPIC 5CPKD 5B0YB 4J8WA 1P3OC 5DNNB 3MGQC 5AV5D 1P3MC 4G92B 1M1AA 1A7WA 3NQUB 1KX4C 3B6FB 5AV9A 5JRGA 4YM6B 4Z5TB 3LZ0C 3AZJC 2FJ7B 1P3BB 2NZDC 3KUYA 3REHB 3AZGB 1AOIB 4M6BA 3AZNA 3LJAC 1HQ3C 5DNMC 3AZLA 3W99B 5B2IB 5B32D 4LD9A 4ZUXC 3WTPB 5CPKB 3REID 5B40A 1P3AA 5B24A 4WU8D 4X23D 4QLCA 4J8VC 4WU9A 3UTAC 5F99B 4H9RB 4R8PB 1S32D 4J8XA 1P3KD 3W97B 1U35A 4E45A 2CV5B 4J8WD 2HIOD 2AROD 5GT0A 5B33B 5AV9D 5E5AB 5AVBD 4XUJB 1ZLAA 4WNNA 3REIC 5B31G 1KU5A 4WU8C 4X23C 3W96C 3REKB 2NQBA 5B31A 1KX3C 5BNXB 5GSUD 3AZLD 1S32B 1P34A 1P3KB 1F66A 5CPJD 4KUDA 4JJNB 1TAFB 2BYMA 2F8NH 3AYWA 5B40D 5B24D 3X1TA 4WU9D 2JSSA 2HIOB 1H3OA 3KWQB 5AV8B 4J8WC 1WWIA 3AV1A 3NQJA 3AZKB 2AROC 1P3GA 5AVBB 5B0ZA 1M1AC 2L5AA 5AV9C 5JRGC 1P3FA 2CWEA 3R45B 3REJB 3LELB 4WV4B 5BS7A 5GSUB 5GT0D 1P3PD 3AZNC 3AN2A 3MGRB 3MNNA 3X1SA 5GT3D 3AZLC 5B2JA 4LD9C 5AV6A 3W98A 3C1CB 5BNVB 1M18A 5AVCA 4Z66A 5B40C 5B24C 3AZFA 2HUEB 2NQBD 4WU9C 1P3IA 3UT9D 4J8UB 1P34D 4H9SA 4KUDD 3AZMB 4J8XC 5AY8D 4AWLB 5DNNA 3WAAB 5KDMA 1U35C 1TZYB 5B1LB 1M19B 1P3LA 4KGCD 5CPID 1EQZB 3LZ1D 3MGSB 4H9OB 5GT0C 3AZGA 1AOIA 3MGQD 4KHAB 1P3MD 5CHLB 4NE5A 3TU4B 4EO5C 1KX4D 4YS3B 4UUZA 5B2IA 3WKJA 2YFVA 3WTPA 3VH5T 2NQBC 3X1SD 3UT9C 1P34C 2IO5C 1F66C 4KUDC 4G91B 5BO0B 5F99A 3AFAB 5DNMD 5AY8C 3AZHA 4R8PA 4H9QB 3VH6W 3AZFD 3X1TC 1P3ID 3W97A 5CPIB 3B6GD 4KGCC 2CV5A 1P3OB 3MGQB 3LZ1C 1P3GC 3UTAD 1P3MB 5CP6A 5B1MD 1BH9B 4HGAC 3C1BA 1KX4B 3LZ0B 3AZJB 3MVDB 1P3LD 5E5AA 2NZDB 3UTBA 4XUJA 3WTPE 3WA9D 4E44A 5BS7C 3AN2C 3LJAB 3AZED 3X1SC 1HQ3B 5DNMB 4H9NA 5AV6C 4CAYB 4ZUXB 4JJNA 4Z66C 3X1VA 3AZFC 4J8VB 1P3IC 2YFWA 3X1UA 1KX5A 1N1JB 3B6GC 3W96D 1WWSA 1KX3D 3RELA 5AV5B 3AZKA 5B1MC 3B0BA 5GXQD 3MGPA 1ID3D 1P3LC 4WZSB 3WA9C 5CP6D 3R45A 3C1BD 3LELA 3AZEC 1M1AD 3MGRA 3UTBD 4XZQA 5B32B 5JRGD 3WKJC 3REIB 3WTPC 5C3IC 3C1CA 4WU8B 5BNVA 4X23B 3W96B 3KUYD 1KX3B 4H9PB 3V9RB 3AZND 4DRAA 4J8UA 5F99C 3O62A 3AZHC 3AZMA 4LD9D 5GXQC 3B0CW 3WAAA 3VH5A 3VH6T 1KX5D 1P3AD 1ID3C 4QLCD 1TZYA 5B1LA 3KXBA 4J8WB 1M19A 3RELD 2CV5C 2AROB 3KSYA 5CP6C 1M1AB 1EQZA 3C1BC 3MGSA 5BT1D 4J8XD 5AV9B 5JRGB 1Q9CA 3AZIA 1U35D 3UTBC 4KHAA 1JFIB 2F8NG 2F8NA 2PYOA 3A6NA 3KUYC 3AV2A 4NE6A 3AZLB 2BYKB 1ULYA 4XZQD 5CPJB 4LD9B 5BO0A 3X1VC 5B40B 3AFAA 5B24B 4WU9B 4H9QA 1ZLAD 3X1UC 1KX5C 1P3AC 4QLCC 5B31D 3RELC 4J8XB 1F66D 1BFMA 5JA4A 1P3OA 5B0YA 1U35B 5BT1C 3AYWD 3MGPC 3X1TD 4ZBJC 3LZ0A 3AZJA 3MVDA 3NQUA 3B6FA 5GT0B 1P3PB 3AV1D 4YM6A 4Z5TA 2FJ7A 1P3BA 1P3GD 5B0ZD 3LJAA 5GT3B 4EO5B 3REHA 4XZQC 5FUGB 1P3FD 1B6WA 4WNNB 4CAYA 4ZUXA 3C1CC 2NQBB 3W99A 3AV2D 3UT9B 1ZLAC 1P34B 2IO5B 3AN2D 4KUDB 5CPKA 5B31C 3MNND 1N1JA 5AY8B 3O62C 5B2JD 5AV6D 5AV5A 3X1TB 3W98D 3WAAC 4H9RA 5AVCD 3AYWC 4Z66D 1H3OB 1M18D 1P3BC 3KXBC 1B67A 3NQJB 4KGCB 3LZ1B 1R4VA 3AV1C 4HGAB 5B0ZC 3AZIC 5DNND 5B32G 5B33A 1P3FC 5B32A 3B6FD 4Z5TD 2PYOC 3A6NC 1P3BD 3REIA 3AV2C 3X1SB 4WU8A 4X23A 3AZGD 1AOID 3MNNC 3REKA 4Z66B 3AFAC 5BNXA 5B2JC 1S32A 3AZFB 3W99D 1P3KA 1P3IB 3W98C 5B2ID 3WKJD 1M18C 1TAFA 5AVCC 3B0DC 3WTPD 3B6GB 3UTAB 4H9SC 2HIOA 2AROA 5B1MB 5KDMB 5B0YC 5F99D 3KWQA 5AV8A 3AZHD 4R8PD 5DNNC 1P3LB 5AVBA 4G92C 3MVDC 3W97D 3WA9B 3B6FC 4YM6C 4Z5TC 1JFIA 2FJ7C 2CV5D 5G49B 1BH8B
chains in the Genus database with same CATH superfamily
2BG1A 3AZEB 3REJA 3REHC 3AZGC 1AOIC 5GSUA 2BYKA 5B33D 4UUZB 2JE5A 5CPJA 3WKJB 5E5AD 2YFVB 4XUJD 5C3IB 3W99C 5B2IC 4DRBA 5CPKC 3REKD 4CSRB 3AZHB 4DQYB 5AV5C 4Z2MH 5GXQB 4JJND 3X1VD 4R8PC 1ID3B 3W97C 3X1UD 5CP6B 3C1BB 3KWQD 5AV8D 1P3PA 3AZKD 3UTBB 2RVQD 4H9OA 5GT3A 4Z2MG 5B33C 3MGPD 5FUGA 5B32C 5E5AC 3VH5W 4XUJC 3TU4A 4NFTA 3KUYB 4YS3A 2Y2PA 3LELD 3REJD 3AZNB 4H9NB 3UT9A 2DQNC 3REKC 3MGRD 3X1VB 1S32C 2F8NK 5AY8A 1P3KC 4JJNC 2YFWB 3X1UB 1KX5B 1P3AB 3C1CD 4QLCB 3RELB 1T3UA 1F1EA 2HIOC 4J8UD 5CPIA 3LZ1A 4KGCA 3KWQC 5AV8C 3O62D 3MGPB 3AZKC 3AZMD 3MGQA 5AVBC 2RVQC 4ZBJB 1P3MA 3WAAD 1BH9A 1KX4A 3AL0C 1TZYD 5B1LD 3KXBD 1M19D 3P5JB 2NZDA 1EQZD 3REJC 3LELC 3MGSD 5GSUC 4XZQB 3AZID 5CPJC 3MGRC 1HQ3A 5DNMA 3TU4D 1ZLAB 4YS3D 2F8ND 2PYOD 3A6ND 2RIQA 5B31B 2HUEC 2F2AC 3B6GA 4J8VA 2LY8A 3O62B 1F66B 2UWXA 4J8UC 3H0LC 3IP4C 2BYMB 3UTAA 5B1MA 3AYWB 3AFAD 3AZMC 3KXBB 4AWLC 2J8PA 2XD5A 3WA9A 1TZYC 3B0CT 5B1LC 3AV1B 1M19C 1P3PC 1P3GB 5B0ZB 3AZIB 1P3OD 1EQZC 5G49A 5B0YD 1BH8A 3AZEA 3MGSC 5GT3C 1P3FB 3VH6A 2F8NB 3FDDA 3LZ0D 3MVDD 3AZJD 3A6NB 3TU4C 2PYOB 2NZDD 3AV2B 4YS3C 4YM6D 3AN2B 2FJ7D 3MNNB 2G5HC 3LJAD 3W96A 3REHD 1KX3A 1HQ3D 4H9PA 4NE3A 4UPKA 3V9RA 5B2JB 4CSRA 5AV6B 3W98B 4G91C 1M18B 5AVCB 4ZUXD 3B0DB 5GXQA 1HTAA 1ID3A 2Y2QA 4J8VD 5JA4B 5CPIC 5CPKD 5B0YB 2Y2MA 4J8WA 1P3OC 5DNNB 3MGQC 5AV5D 1P3MC 4G92B 1M1AA 1A7WA 3NQUB 1KX4C 3B6FB 5AV9A 5JRGA 4YM6B 4Z5TB 3LZ0C 3AZJC 2FJ7B 1P3BB 2NZDC 3KFUG 3KUYA 3REHB 3AZGB 1AOIB 2Y2NA 4M6BA 3AZNA 3LJAC 1HQ3C 5DNMC 3AZLA 3W99B 5B2IB 5B32D 4LD9A 4ZUXC 3WTPB 5CPKB 3REID 5B40A 1P3AA 5B24A 4WU8D 4X23D 4QLCA 4J8VC 4WU9A 1W2EA 3UTAC 5F99B 4H9RB 4R8PB 1S32D 4J8XA 1P3KD 3W97B 4WJ3C 1U35A 4E45A 2CV5B 4J8WD 3EPKA 2HIOD 2AROD 5GT0A 5B33B 5E5AB 5AVBD 5AV9D 4XUJB 2XD1A 1ZLAA 4WNNA 3REIC 5B31G 1KU5A 4WU8C 4X23C 3W96C 3REKB 2NQBA 5B31A 1KX3C 2ZY5A 5BNXB 5GSUD 3AZLD 1S32B 1P34A 1P3KB 1F66A 5CPJD 4KUDA 4JJNB 1TAFB 2BYMA 2F8NH 2JCHA 2ZY4A 3AYWA 5B40D 5B24D 3X1TA 4WU9D 2JSSA 2HIOB 1H3OA 3KWQB 5AV8B 4J8WC 1WWIA 3AV1A 3NQJA 3AZKB 2AROC 1P3GA 5AVBB 5B0ZA 1M1AC 2L5AA 5AV9C 5JRGC 1P3FA 2CWEA 3R45B 3REJB 3LELB 4WV4B 5BS7A 5GSUB 5GT0D 1P3PD 3AZNC 3AN2A 3MGRB 3MNNA 3X1SA 5GT3D 3AZLC 3A1KA 5B2JA 4LD9C 5AV6A 3W98A 3C1CB 5BNVB 1M18A 5AVCA 4Z66A 5B40C 5B24C 3AZFA 2HUEB 2NQBD 4WU9C 1P3IA 3UT9D 4J8UB 1P34D 4H9SA 4KUDD 3AZMB 4J8XC 5AY8D 4AWLB 5DNNA 3WAAB 5KDMA 2ZY2A 1U35C 3H0MC 1TZYB 5B1LB 1M19B 1P3LA 4KGCD 5CPID 1EQZB 3LZ1D 3MGSB 4H9OB 5GT0C 3AZGA 1AOIA 3MGQD 2FFFB 4KHAB 3EPLA 5CHLB 4NE5A 1P3MD 3TU4B 4EO5C 1KX4D 4YS3B 4UUZA 5B2IA 3WKJA 2YFVA 3WTPA 3VH5T 2NQBC 3X1SD 3UT9C 1P34C 2IO5C 1F66C 4KUDC 4G91B 5BO0B 2Y2HA 5F99A 3AFAB 3EPHA 3EG5B 5DNMD 5AY8C 2Y2LA 3AZHA 4R8PA 4H9QB 3VH6W 3AZFD 3X1TC 3A1IA 1P3ID 3W97A 5CPIB 3B6GD 4KGCC 2CV5A 1P3OB 3MGQB 3LZ1C 1P3GC 3UTAD 1P3MB 5CP6A 5B1MD 1BH9B 4HGAC 3C1BA 1KX4B 3LZ0B 3AZJB 3MVDB 1P3LD 5E5AA 2NZDB 3UTBA 4XUJA 3WTPE 3WA9D 4E44A 5BS7C 3EPJA 3AN2C 3LJAB 3AZED 3X1SC 1HQ3B 2W8SA 5DNMB 4H9NA 5AV6C 4CAYB 2Y2KA 4ZUXB 4JJNA 4Z66C 3X1VA 3AZFC 4J8VB 1P3IC 2YFWA 3X1UA 2Y2OA 1KX5A 1N1JB 3B6GC 3W96D 1WWSA 1KX3D 3RELA 5AV5B 3AZKA 5B1MC 2VQRA 3B0BA 5GXQD 2ZM5A 3MGPA 1ID3D 1P3LC 4WZSB 3WA9C 3H0RC 5CP6D 3R45A 3C1BD 3LELA 1Z2CB 3AZEC 1M1AD 3MGRA 3UTBD 4XZQA 5B32B 5JRGD 3WKJC 3REIB 3WTPC 5C3IC 3C1CA 4WU8B 5BNVA 4X23B 3W96B 3KUYD 1KX3B 4H9PB 3V9RB 3AZND 4DRAA 4J8UA 5F99C 3O62A 3AZHC 3AZMA 4LD9D 5GXQC 3B0CW 3WAAA 3VH5A 3VH6T 1KX5D 1P3AD 1ID3C 4QLCD 1TZYA 5B1LA 3KXBA 4J8WB 1M19A 3RELD 2CV5C 2AROB 3KSYA 5CP6C 1M1AB 1EQZA 3C1BC 3MGSA 2G5IC 5BT1D 4J8XD 5AV9B 5JRGB 1Q9CA 3AZIA 1U35D 3UTBC 4KHAA 1JFIB 2F8NG 2F8NA 2PYOA 3A6NA 3KUYC 3AV2A 4NE6A 3AZLB 2DF4C 2BYKB 1ULYA 4XZQD 5CPJB 4LD9B 5BO0A 3X1VC 5B40B 3AFAA 5B24B 4WU9B 4H9QA 1ZLAD 3F6TA 3X1UC 1KX5C 1P3AC 4QLCC 5B31D 3RELC 4J8XB 1F66D 1BFMA 5JA4A 1P3OA 5B0YA 1U35B 5BT1C 3AYWD 3MGPC 3X1TD 4ZBJC 3LZ0A 3AZJA 3MVDA 3NQUA 3B6FA 5GT0B 1P3PB 3AV1D 4YM6A 4Z5TA 2FJ7A 1P3BA 1P3GD 5B0ZD 3LJAA 5GT3B 4EO5B 3REHA 4XZQC 5FUGB 1P3FD 1B6WA 4WNNB 4CAYA 4ZUXA 3C1CC 2NQBB 3W99A 3AV2D 3UT9B 1ZLAC 1P34B 2Y2IA 2IO5B 3AN2D 4KUDB 5CPKA 5B31C 3MNND 1N1JA 5AY8B 3O62C 5B2JD 5AV6D 5AV5A 3X1TB 3W98D 3WAAC 4H9RA 5AVCD 3AYWC 4Z66D 1H3OB 1M18D 1P3BC 3KXBC 1B67A 3NQJB 4KGCB 2Y2GA 3LZ1B 1R4VA 1PZRA 3AV1C 4HGAB 5B0ZC 3AZIC 5DNND 5B32G 5B33A 1P3FC 5B32A 3B6FD 4Z5TD 2PYOC 3A6NC 1P3BD 3REIA 3AV2C 2ZY3A 3X1SB 4WU8A 4X23A 3AZGD 1AOID 3MNNC 3REKA 4Z66B 3AFAC 5BNXA 5B2JC 1S32A 3AZFB 3W99D 1P3KA 1P3IB 3W98C 5B2ID 3WKJD 1M18C 1TAFA 5AVCC 3B0DC 3WTPD 3B6GB 3UTAB 4H9SC 2HIOA 2AROA 5B1MB 5KDMB 5B0YC 5F99D 3KWQA 5AV8A 3AZHD 4R8PD 5DNNC 1P3LB 5AVBA 4G92C 3MVDC 3W97D 3WA9B 2Y2JA 3B6FC 4YM6C 4Z5TC 1JFIA 2FJ7C 2CV5D 5G49B 1BH8B
chains in the Genus database with same CATH topology
2BG1A 3AZEB 3REJA 3REHC 3AZGC 1AOIC 5GSUA 2BYKA 5B33D 4UUZB 2JE5A 5CPJA 3WKJB 5E5AD 2YFVB 4XUJD 5C3IB 3W99C 5B2IC 4DRBA 5CPKC 3REKD 4CSRB 3AZHB 4DQYB 5AV5C 4Z2MH 5GXQB 4JJND 3X1VD 4R8PC 1ID3B 3W97C 3X1UD 5CP6B 3C1BB 3KWQD 5AV8D 1P3PA 3AZKD 3UTBB 2RVQD 4H9OA 5GT3A 4Z2MG 5B33C 3MGPD 5FUGA 5B32C 5E5AC 3VH5W 4XUJC 3TU4A 4NFTA 3KUYB 4YS3A 2Y2PA 3LELD 3REJD 3AZNB 4H9NB 3UT9A 2DQNC 3REKC 3MGRD 3X1VB 1S32C 2F8NK 5AY8A 1P3KC 4JJNC 2YFWB 3X1UB 1KX5B 1P3AB 3C1CD 4QLCB 3RELB 1T3UA 1F1EA 2HIOC 4J8UD 5CPIA 3LZ1A 4KGCA 3KWQC 5AV8C 3O62D 3MGPB 3AZKC 3AZMD 3MGQA 5AVBC 2RVQC 4ZBJB 1P3MA 3WAAD 1BH9A 1KX4A 3AL0C 1TZYD 5B1LD 3KXBD 1M19D 3P5JB 2NZDA 1EQZD 3REJC 3LELC 3MGSD 5GSUC 4XZQB 3AZID 5CPJC 3MGRC 1HQ3A 5DNMA 3TU4D 1ZLAB 4YS3D 2F8ND 2PYOD 3A6ND 2RIQA 5B31B 2HUEC 2F2AC 3B6GA 4J8VA 2LY8A 3O62B 1F66B 2UWXA 4J8UC 3H0LC 3IP4C 2BYMB 3UTAA 5B1MA 3AYWB 3AFAD 3AZMC 3KXBB 4AWLC 2J8PA 2XD5A 3WA9A 1TZYC 3B0CT 5B1LC 3AV1B 1M19C 1P3PC 1P3GB 5B0ZB 3AZIB 1P3OD 1EQZC 5G49A 5B0YD 1BH8A 3AZEA 3MGSC 5GT3C 1P3FB 3VH6A 2F8NB 3FDDA 3LZ0D 3MVDD 3AZJD 3A6NB 3TU4C 2PYOB 2NZDD 3AV2B 4YS3C 4YM6D 3AN2B 2FJ7D 3MNNB 2G5HC 3LJAD 3W96A 3REHD 1KX3A 1HQ3D 4H9PA 4NE3A 4UPKA 3V9RA 5B2JB 4CSRA 5AV6B 3W98B 4G91C 1M18B 5AVCB 4ZUXD 3B0DB 5GXQA 1HTAA 1ID3A 2Y2QA 4J8VD 5JA4B 5CPIC 5CPKD 5B0YB 2Y2MA 4J8WA 1P3OC 5DNNB 3MGQC 5AV5D 1P3MC 4G92B 1M1AA 1A7WA 3NQUB 1KX4C 3B6FB 5AV9A 5JRGA 4YM6B 4Z5TB 3LZ0C 3AZJC 2FJ7B 1P3BB 2NZDC 3KFUG 3KUYA 3REHB 3AZGB 1AOIB 2Y2NA 4M6BA 3AZNA 3LJAC 1HQ3C 5DNMC 3AZLA 3W99B 5B2IB 5B32D 4LD9A 4ZUXC 3WTPB 5CPKB 3REID 5B40A 1P3AA 5B24A 4WU8D 4X23D 4QLCA 4J8VC 4WU9A 1W2EA 3UTAC 5F99B 4H9RB 4R8PB 1S32D 4J8XA 1P3KD 3W97B 4WJ3C 1U35A 4E45A 2CV5B 4J8WD 3EPKA 2HIOD 2AROD 5GT0A 5B33B 5E5AB 5AVBD 5AV9D 4XUJB 2XD1A 1ZLAA 4WNNA 3REIC 5B31G 1KU5A 4WU8C 4X23C 3W96C 3REKB 2NQBA 5B31A 1KX3C 2ZY5A 5BNXB 5GSUD 3AZLD 1S32B 1P34A 1P3KB 1F66A 5CPJD 4KUDA 4JJNB 1TAFB 2BYMA 2F8NH 2JCHA 2ZY4A 3AYWA 5B40D 5B24D 3X1TA 4WU9D 2JSSA 2HIOB 1H3OA 3KWQB 5AV8B 4J8WC 1WWIA 3AV1A 3NQJA 3AZKB 2AROC 1P3GA 5AVBB 5B0ZA 1M1AC 2L5AA 5AV9C 5JRGC 1P3FA 2CWEA 3R45B 3REJB 3LELB 4WV4B 5BS7A 5GSUB 5GT0D 1P3PD 3AZNC 3AN2A 3MGRB 3MNNA 3X1SA 5GT3D 3AZLC 3A1KA 5B2JA 4LD9C 5AV6A 3W98A 3C1CB 5BNVB 1M18A 5AVCA 4Z66A 5B40C 5B24C 3AZFA 2HUEB 2NQBD 4WU9C 1P3IA 3UT9D 4J8UB 1P34D 4H9SA 4KUDD 3AZMB 4J8XC 5AY8D 4AWLB 5DNNA 3WAAB 5KDMA 2ZY2A 1U35C 3H0MC 1TZYB 5B1LB 1M19B 1P3LA 4KGCD 5CPID 1EQZB 3LZ1D 3MGSB 4H9OB 5GT0C 3AZGA 1AOIA 3MGQD 2FFFB 4KHAB 3EPLA 5CHLB 4NE5A 1P3MD 3TU4B 4EO5C 1KX4D 4YS3B 4UUZA 5B2IA 3WKJA 2YFVA 3WTPA 3VH5T 2NQBC 3X1SD 3UT9C 1P34C 2IO5C 1F66C 4KUDC 4G91B 5BO0B 2Y2HA 5F99A 3AFAB 3EPHA 3EG5B 5DNMD 5AY8C 2Y2LA 3AZHA 4R8PA 4H9QB 3VH6W 3AZFD 3X1TC 3A1IA 1P3ID 3W97A 5CPIB 3B6GD 4KGCC 2CV5A 1P3OB 3MGQB 3LZ1C 1P3GC 3UTAD 1P3MB 5CP6A 5B1MD 1BH9B 4HGAC 3C1BA 1KX4B 3LZ0B 3AZJB 3MVDB 1P3LD 5E5AA 2NZDB 3UTBA 4XUJA 3WTPE 3WA9D 4E44A 5BS7C 3EPJA 3AN2C 3LJAB 3AZED 3X1SC 1HQ3B 2W8SA 5DNMB 4H9NA 5AV6C 4CAYB 2Y2KA 4ZUXB 4JJNA 4Z66C 3X1VA 3AZFC 4J8VB 1P3IC 2YFWA 3X1UA 2Y2OA 1KX5A 1N1JB 3B6GC 3W96D 1WWSA 1KX3D 3RELA 5AV5B 3AZKA 5B1MC 2VQRA 3B0BA 5GXQD 2ZM5A 3MGPA 1ID3D 1P3LC 4WZSB 3WA9C 3H0RC 5CP6D 3R45A 3C1BD 3LELA 1Z2CB 3AZEC 1M1AD 3MGRA 3UTBD 4XZQA 5B32B 5JRGD 3WKJC 3REIB 3WTPC 5C3IC 3C1CA 4WU8B 5BNVA 4X23B 3W96B 3KUYD 1KX3B 4H9PB 3V9RB 3AZND 4DRAA 4J8UA 5F99C 3O62A 3AZHC 3AZMA 4LD9D 5GXQC 3B0CW 3WAAA 3VH5A 3VH6T 1KX5D 1P3AD 1ID3C 4QLCD 1TZYA 5B1LA 3KXBA 4J8WB 1M19A 3RELD 2CV5C 2AROB 3KSYA 5CP6C 1M1AB 1EQZA 3C1BC 3MGSA 2G5IC 5BT1D 4J8XD 5AV9B 5JRGB 1Q9CA 3AZIA 1U35D 3UTBC 4KHAA 1JFIB 2F8NG 2F8NA 2PYOA 3A6NA 3KUYC 3AV2A 4NE6A 3AZLB 2DF4C 2BYKB 1ULYA 4XZQD 5CPJB 4LD9B 5BO0A 3X1VC 5B40B 3AFAA 5B24B 4WU9B 4H9QA 1ZLAD 3F6TA 3X1UC 1KX5C 1P3AC 4QLCC 5B31D 3RELC 4J8XB 1F66D 1BFMA 5JA4A 1P3OA 5B0YA 1U35B 5BT1C 3AYWD 3MGPC 3X1TD 4ZBJC 3LZ0A 3AZJA 3MVDA 3NQUA 3B6FA 5GT0B 1P3PB 3AV1D 4YM6A 4Z5TA 2FJ7A 1P3BA 1P3GD 5B0ZD 3LJAA 5GT3B 4EO5B 3REHA 4XZQC 5FUGB 1P3FD 1B6WA 4WNNB 4CAYA 4ZUXA 3C1CC 2NQBB 3W99A 3AV2D 3UT9B 1ZLAC 1P34B 2Y2IA 2IO5B 3AN2D 4KUDB 5CPKA 5B31C 3MNND 1N1JA 5AY8B 3O62C 5B2JD 5AV6D 5AV5A 3X1TB 3W98D 3WAAC 4H9RA 5AVCD 3AYWC 4Z66D 1H3OB 1M18D 1P3BC 3KXBC 1B67A 3NQJB 4KGCB 2Y2GA 3LZ1B 1R4VA 1PZRA 3AV1C 4HGAB 5B0ZC 3AZIC 5DNND 5B32G 5B33A 1P3FC 5B32A 3B6FD 4Z5TD 2PYOC 3A6NC 1P3BD 3REIA 3AV2C 2ZY3A 3X1SB 4WU8A 4X23A 3AZGD 1AOID 3MNNC 3REKA 4Z66B 3AFAC 5BNXA 5B2JC 1S32A 3AZFB 3W99D 1P3KA 1P3IB 3W98C 5B2ID 3WKJD 1M18C 1TAFA 5AVCC 3B0DC 3WTPD 3B6GB 3UTAB 4H9SC 2HIOA 2AROA 5B1MB 5KDMB 5B0YC 5F99D 3KWQA 5AV8A 3AZHD 4R8PD 5DNNC 1P3LB 5AVBA 4G92C 3MVDC 3W97D 3WA9B 2Y2JA 3B6FC 4YM6C 4Z5TC 1JFIA 2FJ7C 2CV5D 5G49B 1BH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE B;  3REJ A;  3REH C;  3AZG C;  1AOI C;  5GSU A;  2BYK A;  5B33 D;  4UUZ B;  5CPJ A;  3WKJ B;  5E5A D;  2YFV B;  4XUJ D;  5C3I B;  3W99 C;  5B2I C;  4DRB A;  5CPK C;  3REK D;  4CSR B;  3AZH B;  5AV5 C;  4Z2M H;  5GXQ B;  4JJN D;  3X1V D;  4R8P C;  1ID3 B;  3W97 C;  3X1U D;  5CP6 B;  3C1B B;  3KWQ D;  5AV8 D;  1P3P A;  3AZK D;  3UTB B;  2RVQ D;  4H9O A;  5GT3 A;  4Z2M G;  5B33 C;  3MGP D;  5FUG A;  5B32 C;  5E5A C;  3VH5 W;  4XUJ C;  3TU4 A;  4NFT A;  3KUY B;  4YS3 A;  3REJ D;  3LEL D;  3AZN B;  4H9N B;  3UT9 A;  3REK C;  3MGR D;  3X1V B;  1S32 C;  2F8N K;  5AY8 A;  1P3K C;  4JJN C;  2YFW B;  3X1U B;  1KX5 B;  1P3A B;  3C1C D;  4QLC B;  3REL B;  1F1E A;  2HIO C;  4J8U D;  5CPI A;  3LZ1 A;  4KGC A;  3KWQ C;  5AV8 C;  3O62 D;  3MGP B;  3AZK C;  3AZM D;  3MGQ A;  5AVB C;  2RVQ C;  4ZBJ B;  1P3M A;  3WAA D;  1BH9 A;  1KX4 A;  1TZY D;  5B1L D;  3KXB D;  1M19 D;  2NZD A;  1EQZ D;  3REJ C;  3LEL C;  3MGS D;  5GSU C;  4XZQ B;  3AZI D;  5CPJ C;  3MGR C;  1HQ3 A;  5DNM A;  3TU4 D;  1ZLA B;  4YS3 D;  2F8N D;  2PYO D;  3A6N D;  5B31 B;  2HUE C;  3B6G A;  4J8V A;  2LY8 A;  3O62 B;  1F66 B;  4J8U C;  2BYM B;  3UTA A;  5B1M A;  3AYW B;  3AFA D;  3AZM C;  3KXB B;  4AWL C;  3WA9 A;  1TZY C;  3B0C T;  5B1L C;  3AV1 B;  1M19 C;  1P3P C;  1P3G B;  5B0Z B;  3AZI B;  1P3O D;  1EQZ C;  5G49 A;  5B0Y D;  1BH8 A;  3AZE A;  3MGS C;  5GT3 C;  1P3F B;  3VH6 A;  2F8N B;  3LZ0 D;  3AZJ D;  3MVD D;  2PYO B;  3A6N B;  3TU4 C;  2NZD D;  3AV2 B;  4YS3 C;  4YM6 D;  3AN2 B;  2FJ7 D;  3MNN B;  3LJA D;  3W96 A;  3REH D;  1KX3 A;  1HQ3 D;  4H9P A;  4NE3 A;  3V9R A;  5B2J B;  5AV6 B;  4CSR A;  3W98 B;  4G91 C;  1M18 B;  5AVC B;  4ZUX D;  3B0D B;  5GXQ A;  1HTA A;  1ID3 A;  4J8V D;  5JA4 B;  5CPI C;  5CPK D;  5B0Y B;  4J8W A;  1P3O C;  5DNN B;  3MGQ C;  5AV5 D;  1P3M C;  4G92 B;  1M1A A;  1A7W A;  3NQU B;  1KX4 C;  3B6F B;  5AV9 A;  5JRG A;  4YM6 B;  4Z5T B;  3LZ0 C;  3AZJ C;  2FJ7 B;  1P3B B;  2NZD C;  3KUY A;  3REH B;  3AZG B;  1AOI B;  4M6B A;  3AZN A;  3LJA C;  1HQ3 C;  5DNM C;  3AZL A;  3W99 B;  5B2I B;  5B32 D;  4LD9 A;  4ZUX C;  3WTP B;  5CPK B;  3REI D;  5B40 A;  1P3A A;  5B24 A;  4WU8 D;  4X23 D;  4QLC A;  4J8V C;  4WU9 A;  3UTA C;  5F99 B;  4H9R B;  4R8P B;  1S32 D;  4J8X A;  1P3K D;  3W97 B;  1U35 A;  4E45 A;  2CV5 B;  4J8W D;  2HIO D;  2ARO D;  5GT0 A;  5B33 B;  5AV9 D;  5E5A B;  5AVB D;  4XUJ B;  1ZLA A;  4WNN A;  3REI C;  5B31 G;  1KU5 A;  4WU8 C;  4X23 C;  3W96 C;  3REK B;  2NQB A;  5B31 A;  1KX3 C;  5BNX B;  5GSU D;  3AZL D;  1S32 B;  1P34 A;  1P3K B;  1F66 A;  5CPJ D;  4KUD A;  4JJN B;  1TAF B;  2BYM A;  2F8N H;  3AYW A;  5B40 D;  5B24 D;  3X1T A;  4WU9 D;  2JSS A;  2HIO B;  1H3O A;  3KWQ B;  5AV8 B;  4J8W C;  1WWI A;  3AV1 A;  3NQJ A;  3AZK B;  2ARO C;  1P3G A;  5AVB B;  5B0Z A;  1M1A C;  2L5A A;  5AV9 C;  5JRG C;  1P3F A;  2CWE A;  3R45 B;  3REJ B;  3LEL B;  4WV4 B;  5BS7 A;  5GSU B;  5GT0 D;  1P3P D;  3AZN C;  3AN2 A;  3MGR B;  3MNN A;  3X1S A;  5GT3 D;  3AZL C;  5B2J A;  4LD9 C;  5AV6 A;  3W98 A;  3C1C B;  5BNV B;  1M18 A;  5AVC A;  4Z66 A;  5B40 C;  5B24 C;  3AZF A;  2HUE B;  2NQB D;  4WU9 C;  1P3I A;  3UT9 D;  4J8U B;  1P34 D;  4H9S A;  4KUD D;  3AZM B;  4J8X C;  5AY8 D;  4AWL B;  5DNN A;  3WAA B;  5KDM A;  1U35 C;  1TZY B;  5B1L B;  1M19 B;  1P3L A;  4KGC D;  5CPI D;  1EQZ B;  3LZ1 D;  3MGS B;  4H9O B;  5GT0 C;  3AZG A;  1AOI A;  3MGQ D;  4KHA B;  1P3M D;  5CHL B;  4NE5 A;  3TU4 B;  4EO5 C;  1KX4 D;  4YS3 B;  4UUZ A;  5B2I A;  3WKJ A;  2YFV A;  3WTP A;  3VH5 T;  2NQB C;  3X1S D;  3UT9 C;  1P34 C;  2IO5 C;  1F66 C;  4KUD C;  4G91 B;  5BO0 B;  5F99 A;  3AFA B;  5DNM D;  5AY8 C;  3AZH A;  4R8P A;  4H9Q B;  3VH6 W;  3AZF D;  3X1T C;  1P3I D;  3W97 A;  5CPI B;  3B6G D;  4KGC C;  2CV5 A;  1P3O B;  3MGQ B;  3LZ1 C;  1P3G C;  3UTA D;  1P3M B;  5CP6 A;  5B1M D;  1BH9 B;  4HGA C;  3C1B A;  1KX4 B;  3LZ0 B;  3AZJ B;  3MVD B;  1P3L D;  5E5A A;  2NZD B;  3UTB A;  4XUJ A;  3WTP E;  3WA9 D;  4E44 A;  5BS7 C;  3AN2 C;  3LJA B;  3AZE D;  3X1S C;  1HQ3 B;  5DNM B;  4H9N A;  5AV6 C;  4CAY B;  4ZUX B;  4JJN A;  4Z66 C;  3X1V A;  3AZF C;  4J8V B;  1P3I C;  2YFW A;  3X1U A;  1KX5 A;  1N1J B;  3B6G C;  3W96 D;  1WWS A;  1KX3 D;  3REL A;  5AV5 B;  3AZK A;  5B1M C;  3B0B A;  5GXQ D;  3MGP A;  1ID3 D;  1P3L C;  4WZS B;  3WA9 C;  5CP6 D;  3R45 A;  3C1B D;  3LEL A;  3AZE C;  1M1A D;  3MGR A;  3UTB D;  4XZQ A;  5B32 B;  5JRG D;  3WKJ C;  3REI B;  3WTP C;  5C3I C;  3C1C A;  4WU8 B;  5BNV A;  4X23 B;  3W96 B;  3KUY D;  1KX3 B;  4H9P B;  3V9R B;  3AZN D;  4DRA A;  4J8U A;  5F99 C;  3O62 A;  3AZH C;  3AZM A;  4LD9 D;  5GXQ C;  3B0C W;  3WAA A;  3VH5 A;  3VH6 T;  1KX5 D;  1P3A D;  1ID3 C;  4QLC D;  1TZY A;  5B1L A;  3KXB A;  4J8W B;  1M19 A;  3REL D;  2CV5 C;  2ARO B;  3KSY A;  5CP6 C;  1M1A B;  1EQZ A;  3C1B C;  3MGS A;  5BT1 D;  4J8X D;  5AV9 B;  5JRG B;  1Q9C A;  3AZI A;  1U35 D;  3UTB C;  4KHA A;  1JFI B;  2F8N G;  2F8N A;  2PYO A;  3A6N A;  3KUY C;  3AV2 A;  4NE6 A;  3AZL B;  2BYK B;  1ULY A;  4XZQ D;  5CPJ B;  4LD9 B;  5BO0 A;  3X1V C;  5B40 B;  3AFA A;  5B24 B;  4WU9 B;  4H9Q A;  1ZLA D;  3X1U C;  1KX5 C;  1P3A C;  4QLC C;  5B31 D;  3REL C;  4J8X B;  1F66 D;  1BFM A;  5JA4 A;  1P3O A;  5B0Y A;  1U35 B;  5BT1 C;  3AYW D;  3MGP C;  3X1T D;  4ZBJ C;  3LZ0 A;  3AZJ A;  3MVD A;  3NQU A;  3B6F A;  5GT0 B;  1P3P B;  3AV1 D;  4YM6 A;  4Z5T A;  2FJ7 A;  1P3B A;  1P3G D;  5B0Z D;  3LJA A;  5GT3 B;  4EO5 B;  3REH A;  4XZQ C;  5FUG B;  1P3F D;  1B6W A;  4WNN B;  4CAY A;  4ZUX A;  3C1C C;  2NQB B;  3W99 A;  3AV2 D;  3UT9 B;  1ZLA C;  1P34 B;  2IO5 B;  3AN2 D;  4KUD B;  5CPK A;  5B31 C;  3MNN D;  1N1J A;  5AY8 B;  3O62 C;  5B2J D;  5AV6 D;  5AV5 A;  3X1T B;  3W98 D;  3WAA C;  4H9R A;  5AVC D;  3AYW C;  4Z66 D;  1H3O B;  1M18 D;  1P3B C;  3KXB C;  1B67 A;  3NQJ B;  4KGC B;  3LZ1 B;  1R4V A;  3AV1 C;  4HGA B;  5B0Z C;  3AZI C;  5DNN D;  5B32 G;  5B33 A;  1P3F C;  5B32 A;  3B6F D;  4Z5T D;  2PYO C;  3A6N C;  1P3B D;  3REI A;  3AV2 C;  3X1S B;  4WU8 A;  4X23 A;  3AZG D;  1AOI D;  3MNN C;  3REK A;  4Z66 B;  3AFA C;  5BNX A;  5B2J C;  1S32 A;  3AZF B;  3W99 D;  1P3K A;  1P3I B;  3W98 C;  5B2I D;  3WKJ D;  1M18 C;  1TAF A;  5AVC C;  3B0D C;  3WTP D;  3B6G B;  3UTA B;  4H9S C;  2HIO A;  2ARO A;  5B1M B;  5KDM B;  5B0Y C;  5F99 D;  3KWQ A;  5AV8 A;  3AZH D;  4R8P D;  5DNN C;  1P3L B;  5AVB A;  4G92 C;  3MVD C;  3W97 D;  3WA9 B;  3B6F C;  4YM6 C;  4Z5T C;  1JFI A;  2FJ7 C;  2CV5 D;  5G49 B;  1BH8 B; 
#chains in the Genus database with same CATH topology
 2BG1 A;  3AZE B;  3REJ A;  3REH C;  3AZG C;  1AOI C;  5GSU A;  2BYK A;  5B33 D;  4UUZ B;  2JE5 A;  5CPJ A;  3WKJ B;  5E5A D;  2YFV B;  4XUJ D;  5C3I B;  3W99 C;  5B2I C;  4DRB A;  5CPK C;  3REK D;  4CSR B;  3AZH B;  4DQY B;  5AV5 C;  4Z2M H;  5GXQ B;  4JJN D;  3X1V D;  4R8P C;  1ID3 B;  3W97 C;  3X1U D;  5CP6 B;  3C1B B;  3KWQ D;  5AV8 D;  1P3P A;  3AZK D;  3UTB B;  2RVQ D;  4H9O A;  5GT3 A;  4Z2M G;  5B33 C;  3MGP D;  5FUG A;  5B32 C;  5E5A C;  3VH5 W;  4XUJ C;  3TU4 A;  4NFT A;  3KUY B;  4YS3 A;  2Y2P A;  3LEL D;  3REJ D;  3AZN B;  4H9N B;  3UT9 A;  2DQN C;  3REK C;  3MGR D;  3X1V B;  1S32 C;  2F8N K;  5AY8 A;  1P3K C;  4JJN C;  2YFW B;  3X1U B;  1KX5 B;  1P3A B;  3C1C D;  4QLC B;  3REL B;  1T3U A;  1F1E A;  2HIO C;  4J8U D;  5CPI A;  3LZ1 A;  4KGC A;  3KWQ C;  5AV8 C;  3O62 D;  3MGP B;  3AZK C;  3AZM D;  3MGQ A;  5AVB C;  2RVQ C;  4ZBJ B;  1P3M A;  3WAA D;  1BH9 A;  1KX4 A;  3AL0 C;  1TZY D;  5B1L D;  3KXB D;  1M19 D;  3P5J B;  2NZD A;  1EQZ D;  3REJ C;  3LEL C;  3MGS D;  5GSU C;  4XZQ B;  3AZI D;  5CPJ C;  3MGR C;  1HQ3 A;  5DNM A;  3TU4 D;  1ZLA B;  4YS3 D;  2F8N D;  2PYO D;  3A6N D;  2RIQ A;  5B31 B;  2HUE C;  2F2A C;  3B6G A;  4J8V A;  2LY8 A;  3O62 B;  1F66 B;  2UWX A;  4J8U C;  3H0L C;  3IP4 C;  2BYM B;  3UTA A;  5B1M A;  3AYW B;  3AFA D;  3AZM C;  3KXB B;  4AWL C;  2J8P A;  2XD5 A;  3WA9 A;  1TZY C;  3B0C T;  5B1L C;  3AV1 B;  1M19 C;  1P3P C;  1P3G B;  5B0Z B;  3AZI B;  1P3O D;  1EQZ C;  5G49 A;  5B0Y D;  1BH8 A;  3AZE A;  3MGS C;  5GT3 C;  1P3F B;  3VH6 A;  2F8N B;  3FDD A;  3LZ0 D;  3MVD D;  3AZJ D;  3A6N B;  3TU4 C;  2PYO B;  2NZD D;  3AV2 B;  4YS3 C;  4YM6 D;  3AN2 B;  2FJ7 D;  3MNN B;  2G5H C;  3LJA D;  3W96 A;  3REH D;  1KX3 A;  1HQ3 D;  4H9P A;  4NE3 A;  4UPK A;  3V9R A;  5B2J B;  4CSR A;  5AV6 B;  3W98 B;  4G91 C;  1M18 B;  5AVC B;  4ZUX D;  3B0D B;  5GXQ A;  1HTA A;  1ID3 A;  2Y2Q A;  4J8V D;  5JA4 B;  5CPI C;  5CPK D;  5B0Y B;  2Y2M A;  4J8W A;  1P3O C;  5DNN B;  3MGQ C;  5AV5 D;  1P3M C;  4G92 B;  1M1A A;  1A7W A;  3NQU B;  1KX4 C;  3B6F B;  5AV9 A;  5JRG A;  4YM6 B;  4Z5T B;  3LZ0 C;  3AZJ C;  2FJ7 B;  1P3B B;  2NZD C;  3KFU G;  3KUY A;  3REH B;  3AZG B;  1AOI B;  2Y2N A;  4M6B A;  3AZN A;  3LJA C;  1HQ3 C;  5DNM C;  3AZL A;  3W99 B;  5B2I B;  5B32 D;  4LD9 A;  4ZUX C;  3WTP B;  5CPK B;  3REI D;  5B40 A;  1P3A A;  5B24 A;  4WU8 D;  4X23 D;  4QLC A;  4J8V C;  4WU9 A;  1W2E A;  3UTA C;  5F99 B;  4H9R B;  4R8P B;  1S32 D;  4J8X A;  1P3K D;  3W97 B;  4WJ3 C;  1U35 A;  4E45 A;  2CV5 B;  4J8W D;  3EPK A;  2HIO D;  2ARO D;  5GT0 A;  5B33 B;  5E5A B;  5AVB D;  5AV9 D;  4XUJ B;  2XD1 A;  1ZLA A;  4WNN A;  3REI C;  5B31 G;  1KU5 A;  4WU8 C;  4X23 C;  3W96 C;  3REK B;  2NQB A;  5B31 A;  1KX3 C;  2ZY5 A;  5BNX B;  5GSU D;  3AZL D;  1S32 B;  1P34 A;  1P3K B;  1F66 A;  5CPJ D;  4KUD A;  4JJN B;  1TAF B;  2BYM A;  2F8N H;  2JCH A;  2ZY4 A;  3AYW A;  5B40 D;  5B24 D;  3X1T A;  4WU9 D;  2JSS A;  2HIO B;  1H3O A;  3KWQ B;  5AV8 B;  4J8W C;  1WWI A;  3AV1 A;  3NQJ A;  3AZK B;  2ARO C;  1P3G A;  5AVB B;  5B0Z A;  1M1A C;  2L5A A;  5AV9 C;  5JRG C;  1P3F A;  2CWE A;  3R45 B;  3REJ B;  3LEL B;  4WV4 B;  5BS7 A;  5GSU B;  5GT0 D;  1P3P D;  3AZN C;  3AN2 A;  3MGR B;  3MNN A;  3X1S A;  5GT3 D;  3AZL C;  3A1K A;  5B2J A;  4LD9 C;  5AV6 A;  3W98 A;  3C1C B;  5BNV B;  1M18 A;  5AVC A;  4Z66 A;  5B40 C;  5B24 C;  3AZF A;  2HUE B;  2NQB D;  4WU9 C;  1P3I A;  3UT9 D;  4J8U B;  1P34 D;  4H9S A;  4KUD D;  3AZM B;  4J8X C;  5AY8 D;  4AWL B;  5DNN A;  3WAA B;  5KDM A;  2ZY2 A;  1U35 C;  3H0M C;  1TZY B;  5B1L B;  1M19 B;  1P3L A;  4KGC D;  5CPI D;  1EQZ B;  3LZ1 D;  3MGS B;  4H9O B;  5GT0 C;  3AZG A;  1AOI A;  3MGQ D;  2FFF B;  4KHA B;  3EPL A;  5CHL B;  4NE5 A;  1P3M D;  3TU4 B;  4EO5 C;  1KX4 D;  4YS3 B;  4UUZ A;  5B2I A;  3WKJ A;  2YFV A;  3WTP A;  3VH5 T;  2NQB C;  3X1S D;  3UT9 C;  1P34 C;  2IO5 C;  1F66 C;  4KUD C;  4G91 B;  5BO0 B;  2Y2H A;  5F99 A;  3AFA B;  3EPH A;  3EG5 B;  5DNM D;  5AY8 C;  2Y2L A;  3AZH A;  4R8P A;  4H9Q B;  3VH6 W;  3AZF D;  3X1T C;  3A1I A;  1P3I D;  3W97 A;  5CPI B;  3B6G D;  4KGC C;  2CV5 A;  1P3O B;  3MGQ B;  3LZ1 C;  1P3G C;  3UTA D;  1P3M B;  5CP6 A;  5B1M D;  1BH9 B;  4HGA C;  3C1B A;  1KX4 B;  3LZ0 B;  3AZJ B;  3MVD B;  1P3L D;  5E5A A;  2NZD B;  3UTB A;  4XUJ A;  3WTP E;  3WA9 D;  4E44 A;  5BS7 C;  3EPJ A;  3AN2 C;  3LJA B;  3AZE D;  3X1S C;  1HQ3 B;  2W8S A;  5DNM B;  4H9N A;  5AV6 C;  4CAY B;  2Y2K A;  4ZUX B;  4JJN A;  4Z66 C;  3X1V A;  3AZF C;  4J8V B;  1P3I C;  2YFW A;  3X1U A;  2Y2O A;  1KX5 A;  1N1J B;  3B6G C;  3W96 D;  1WWS A;  1KX3 D;  3REL A;  5AV5 B;  3AZK A;  5B1M C;  2VQR A;  3B0B A;  5GXQ D;  2ZM5 A;  3MGP A;  1ID3 D;  1P3L C;  4WZS B;  3WA9 C;  3H0R C;  5CP6 D;  3R45 A;  3C1B D;  3LEL A;  1Z2C B;  3AZE C;  1M1A D;  3MGR A;  3UTB D;  4XZQ A;  5B32 B;  5JRG D;  3WKJ C;  3REI B;  3WTP C;  5C3I C;  3C1C A;  4WU8 B;  5BNV A;  4X23 B;  3W96 B;  3KUY D;  1KX3 B;  4H9P B;  3V9R B;  3AZN D;  4DRA A;  4J8U A;  5F99 C;  3O62 A;  3AZH C;  3AZM A;  4LD9 D;  5GXQ C;  3B0C W;  3WAA A;  3VH5 A;  3VH6 T;  1KX5 D;  1P3A D;  1ID3 C;  4QLC D;  1TZY A;  5B1L A;  3KXB A;  4J8W B;  1M19 A;  3REL D;  2CV5 C;  2ARO B;  3KSY A;  5CP6 C;  1M1A B;  1EQZ A;  3C1B C;  3MGS A;  2G5I C;  5BT1 D;  4J8X D;  5AV9 B;  5JRG B;  1Q9C A;  3AZI A;  1U35 D;  3UTB C;  4KHA A;  1JFI B;  2F8N G;  2F8N A;  2PYO A;  3A6N A;  3KUY C;  3AV2 A;  4NE6 A;  3AZL B;  2DF4 C;  2BYK B;  1ULY A;  4XZQ D;  5CPJ B;  4LD9 B;  5BO0 A;  3X1V C;  5B40 B;  3AFA A;  5B24 B;  4WU9 B;  4H9Q A;  1ZLA D;  3F6T A;  3X1U C;  1KX5 C;  1P3A C;  4QLC C;  5B31 D;  3REL C;  4J8X B;  1F66 D;  1BFM A;  5JA4 A;  1P3O A;  5B0Y A;  1U35 B;  5BT1 C;  3AYW D;  3MGP C;  3X1T D;  4ZBJ C;  3LZ0 A;  3AZJ A;  3MVD A;  3NQU A;  3B6F A;  5GT0 B;  1P3P B;  3AV1 D;  4YM6 A;  4Z5T A;  2FJ7 A;  1P3B A;  1P3G D;  5B0Z D;  3LJA A;  5GT3 B;  4EO5 B;  3REH A;  4XZQ C;  5FUG B;  1P3F D;  1B6W A;  4WNN B;  4CAY A;  4ZUX A;  3C1C C;  2NQB B;  3W99 A;  3AV2 D;  3UT9 B;  1ZLA C;  1P34 B;  2Y2I A;  2IO5 B;  3AN2 D;  4KUD B;  5CPK A;  5B31 C;  3MNN D;  1N1J A;  5AY8 B;  3O62 C;  5B2J D;  5AV6 D;  5AV5 A;  3X1T B;  3W98 D;  3WAA C;  4H9R A;  5AVC D;  3AYW C;  4Z66 D;  1H3O B;  1M18 D;  1P3B C;  3KXB C;  1B67 A;  3NQJ B;  4KGC B;  2Y2G A;  3LZ1 B;  1R4V A;  1PZR A;  3AV1 C;  4HGA B;  5B0Z C;  3AZI C;  5DNN D;  5B32 G;  5B33 A;  1P3F C;  5B32 A;  3B6F D;  4Z5T D;  2PYO C;  3A6N C;  1P3B D;  3REI A;  3AV2 C;  2ZY3 A;  3X1S B;  4WU8 A;  4X23 A;  3AZG D;  1AOI D;  3MNN C;  3REK A;  4Z66 B;  3AFA C;  5BNX A;  5B2J C;  1S32 A;  3AZF B;  3W99 D;  1P3K A;  1P3I B;  3W98 C;  5B2I D;  3WKJ D;  1M18 C;  1TAF A;  5AVC C;  3B0D C;  3WTP D;  3B6G B;  3UTA B;  4H9S C;  2HIO A;  2ARO A;  5B1M B;  5KDM B;  5B0Y C;  5F99 D;  3KWQ A;  5AV8 A;  3AZH D;  4R8P D;  5DNN C;  1P3L B;  5AVB A;  4G92 C;  3MVD C;  3W97 D;  3WA9 B;  2Y2J A;  3B6F C;  4YM6 C;  4Z5T C;  1JFI A;  2FJ7 C;  2CV5 D;  5G49 B;  1BH8 B; 
#chains in the Genus database with same CATH homology
 2BG1 A;  3AZE B;  3REJ A;  3REH C;  3AZG C;  1AOI C;  5GSU A;  2BYK A;  5B33 D;  4UUZ B;  2JE5 A;  5CPJ A;  3WKJ B;  5E5A D;  2YFV B;  4XUJ D;  5C3I B;  3W99 C;  5B2I C;  4DRB A;  5CPK C;  3REK D;  4CSR B;  3AZH B;  4DQY B;  5AV5 C;  4Z2M H;  5GXQ B;  4JJN D;  3X1V D;  4R8P C;  1ID3 B;  3W97 C;  3X1U D;  5CP6 B;  3C1B B;  3KWQ D;  5AV8 D;  1P3P A;  3AZK D;  3UTB B;  2RVQ D;  4H9O A;  5GT3 A;  4Z2M G;  5B33 C;  3MGP D;  5FUG A;  5B32 C;  5E5A C;  3VH5 W;  4XUJ C;  3TU4 A;  4NFT A;  3KUY B;  4YS3 A;  2Y2P A;  3LEL D;  3REJ D;  3AZN B;  4H9N B;  3UT9 A;  2DQN C;  3REK C;  3MGR D;  3X1V B;  1S32 C;  2F8N K;  5AY8 A;  1P3K C;  4JJN C;  2YFW B;  3X1U B;  1KX5 B;  1P3A B;  3C1C D;  4QLC B;  3REL B;  1T3U A;  1F1E A;  2HIO C;  4J8U D;  5CPI A;  3LZ1 A;  4KGC A;  3KWQ C;  5AV8 C;  3O62 D;  3MGP B;  3AZK C;  3AZM D;  3MGQ A;  5AVB C;  2RVQ C;  4ZBJ B;  1P3M A;  3WAA D;  1BH9 A;  1KX4 A;  3AL0 C;  1TZY D;  5B1L D;  3KXB D;  1M19 D;  3P5J B;  2NZD A;  1EQZ D;  3REJ C;  3LEL C;  3MGS D;  5GSU C;  4XZQ B;  3AZI D;  5CPJ C;  3MGR C;  1HQ3 A;  5DNM A;  3TU4 D;  1ZLA B;  4YS3 D;  2F8N D;  2PYO D;  3A6N D;  2RIQ A;  5B31 B;  2HUE C;  2F2A C;  3B6G A;  4J8V A;  2LY8 A;  3O62 B;  1F66 B;  2UWX A;  4J8U C;  3H0L C;  3IP4 C;  2BYM B;  3UTA A;  5B1M A;  3AYW B;  3AFA D;  3AZM C;  3KXB B;  4AWL C;  2J8P A;  2XD5 A;  3WA9 A;  1TZY C;  3B0C T;  5B1L C;  3AV1 B;  1M19 C;  1P3P C;  1P3G B;  5B0Z B;  3AZI B;  1P3O D;  1EQZ C;  5G49 A;  5B0Y D;  1BH8 A;  3AZE A;  3MGS C;  5GT3 C;  1P3F B;  3VH6 A;  2F8N B;  3FDD A;  3LZ0 D;  3MVD D;  3AZJ D;  3A6N B;  3TU4 C;  2PYO B;  2NZD D;  3AV2 B;  4YS3 C;  4YM6 D;  3AN2 B;  2FJ7 D;  3MNN B;  2G5H C;  3LJA D;  3W96 A;  3REH D;  1KX3 A;  1HQ3 D;  4H9P A;  4NE3 A;  4UPK A;  3V9R A;  5B2J B;  4CSR A;  5AV6 B;  3W98 B;  4G91 C;  1M18 B;  5AVC B;  4ZUX D;  3B0D B;  5GXQ A;  1HTA A;  1ID3 A;  2Y2Q A;  4J8V D;  5JA4 B;  5CPI C;  5CPK D;  5B0Y B;  2Y2M A;  4J8W A;  1P3O C;  5DNN B;  3MGQ C;  5AV5 D;  1P3M C;  4G92 B;  1M1A A;  1A7W A;  3NQU B;  1KX4 C;  3B6F B;  5AV9 A;  5JRG A;  4YM6 B;  4Z5T B;  3LZ0 C;  3AZJ C;  2FJ7 B;  1P3B B;  2NZD C;  3KFU G;  3KUY A;  3REH B;  3AZG B;  1AOI B;  2Y2N A;  4M6B A;  3AZN A;  3LJA C;  1HQ3 C;  5DNM C;  3AZL A;  3W99 B;  5B2I B;  5B32 D;  4LD9 A;  4ZUX C;  3WTP B;  5CPK B;  3REI D;  5B40 A;  1P3A A;  5B24 A;  4WU8 D;  4X23 D;  4QLC A;  4J8V C;  4WU9 A;  1W2E A;  3UTA C;  5F99 B;  4H9R B;  4R8P B;  1S32 D;  4J8X A;  1P3K D;  3W97 B;  4WJ3 C;  1U35 A;  4E45 A;  2CV5 B;  4J8W D;  3EPK A;  2HIO D;  2ARO D;  5GT0 A;  5B33 B;  5E5A B;  5AVB D;  5AV9 D;  4XUJ B;  2XD1 A;  1ZLA A;  4WNN A;  3REI C;  5B31 G;  1KU5 A;  4WU8 C;  4X23 C;  3W96 C;  3REK B;  2NQB A;  5B31 A;  1KX3 C;  2ZY5 A;  5BNX B;  5GSU D;  3AZL D;  1S32 B;  1P34 A;  1P3K B;  1F66 A;  5CPJ D;  4KUD A;  4JJN B;  1TAF B;  2BYM A;  2F8N H;  2JCH A;  2ZY4 A;  3AYW A;  5B40 D;  5B24 D;  3X1T A;  4WU9 D;  2JSS A;  2HIO B;  1H3O A;  3KWQ B;  5AV8 B;  4J8W C;  1WWI A;  3AV1 A;  3NQJ A;  3AZK B;  2ARO C;  1P3G A;  5AVB B;  5B0Z A;  1M1A C;  2L5A A;  5AV9 C;  5JRG C;  1P3F A;  2CWE A;  3R45 B;  3REJ B;  3LEL B;  4WV4 B;  5BS7 A;  5GSU B;  5GT0 D;  1P3P D;  3AZN C;  3AN2 A;  3MGR B;  3MNN A;  3X1S A;  5GT3 D;  3AZL C;  3A1K A;  5B2J A;  4LD9 C;  5AV6 A;  3W98 A;  3C1C B;  5BNV B;  1M18 A;  5AVC A;  4Z66 A;  5B40 C;  5B24 C;  3AZF A;  2HUE B;  2NQB D;  4WU9 C;  1P3I A;  3UT9 D;  4J8U B;  1P34 D;  4H9S A;  4KUD D;  3AZM B;  4J8X C;  5AY8 D;  4AWL B;  5DNN A;  3WAA B;  5KDM A;  2ZY2 A;  1U35 C;  3H0M C;  1TZY B;  5B1L B;  1M19 B;  1P3L A;  4KGC D;  5CPI D;  1EQZ B;  3LZ1 D;  3MGS B;  4H9O B;  5GT0 C;  3AZG A;  1AOI A;  3MGQ D;  2FFF B;  4KHA B;  3EPL A;  5CHL B;  4NE5 A;  1P3M D;  3TU4 B;  4EO5 C;  1KX4 D;  4YS3 B;  4UUZ A;  5B2I A;  3WKJ A;  2YFV A;  3WTP A;  3VH5 T;  2NQB C;  3X1S D;  3UT9 C;  1P34 C;  2IO5 C;  1F66 C;  4KUD C;  4G91 B;  5BO0 B;  2Y2H A;  5F99 A;  3AFA B;  3EPH A;  3EG5 B;  5DNM D;  5AY8 C;  2Y2L A;  3AZH A;  4R8P A;  4H9Q B;  3VH6 W;  3AZF D;  3X1T C;  3A1I A;  1P3I D;  3W97 A;  5CPI B;  3B6G D;  4KGC C;  2CV5 A;  1P3O B;  3MGQ B;  3LZ1 C;  1P3G C;  3UTA D;  1P3M B;  5CP6 A;  5B1M D;  1BH9 B;  4HGA C;  3C1B A;  1KX4 B;  3LZ0 B;  3AZJ B;  3MVD B;  1P3L D;  5E5A A;  2NZD B;  3UTB A;  4XUJ A;  3WTP E;  3WA9 D;  4E44 A;  5BS7 C;  3EPJ A;  3AN2 C;  3LJA B;  3AZE D;  3X1S C;  1HQ3 B;  2W8S A;  5DNM B;  4H9N A;  5AV6 C;  4CAY B;  2Y2K A;  4ZUX B;  4JJN A;  4Z66 C;  3X1V A;  3AZF C;  4J8V B;  1P3I C;  2YFW A;  3X1U A;  2Y2O A;  1KX5 A;  1N1J B;  3B6G C;  3W96 D;  1WWS A;  1KX3 D;  3REL A;  5AV5 B;  3AZK A;  5B1M C;  2VQR A;  3B0B A;  5GXQ D;  2ZM5 A;  3MGP A;  1ID3 D;  1P3L C;  4WZS B;  3WA9 C;  3H0R C;  5CP6 D;  3R45 A;  3C1B D;  3LEL A;  1Z2C B;  3AZE C;  1M1A D;  3MGR A;  3UTB D;  4XZQ A;  5B32 B;  5JRG D;  3WKJ C;  3REI B;  3WTP C;  5C3I C;  3C1C A;  4WU8 B;  5BNV A;  4X23 B;  3W96 B;  3KUY D;  1KX3 B;  4H9P B;  3V9R B;  3AZN D;  4DRA A;  4J8U A;  5F99 C;  3O62 A;  3AZH C;  3AZM A;  4LD9 D;  5GXQ C;  3B0C W;  3WAA A;  3VH5 A;  3VH6 T;  1KX5 D;  1P3A D;  1ID3 C;  4QLC D;  1TZY A;  5B1L A;  3KXB A;  4J8W B;  1M19 A;  3REL D;  2CV5 C;  2ARO B;  3KSY A;  5CP6 C;  1M1A B;  1EQZ A;  3C1B C;  3MGS A;  2G5I C;  5BT1 D;  4J8X D;  5AV9 B;  5JRG B;  1Q9C A;  3AZI A;  1U35 D;  3UTB C;  4KHA A;  1JFI B;  2F8N G;  2F8N A;  2PYO A;  3A6N A;  3KUY C;  3AV2 A;  4NE6 A;  3AZL B;  2DF4 C;  2BYK B;  1ULY A;  4XZQ D;  5CPJ B;  4LD9 B;  5BO0 A;  3X1V C;  5B40 B;  3AFA A;  5B24 B;  4WU9 B;  4H9Q A;  1ZLA D;  3F6T A;  3X1U C;  1KX5 C;  1P3A C;  4QLC C;  5B31 D;  3REL C;  4J8X B;  1F66 D;  1BFM A;  5JA4 A;  1P3O A;  5B0Y A;  1U35 B;  5BT1 C;  3AYW D;  3MGP C;  3X1T D;  4ZBJ C;  3LZ0 A;  3AZJ A;  3MVD A;  3NQU A;  3B6F A;  5GT0 B;  1P3P B;  3AV1 D;  4YM6 A;  4Z5T A;  2FJ7 A;  1P3B A;  1P3G D;  5B0Z D;  3LJA A;  5GT3 B;  4EO5 B;  3REH A;  4XZQ C;  5FUG B;  1P3F D;  1B6W A;  4WNN B;  4CAY A;  4ZUX A;  3C1C C;  2NQB B;  3W99 A;  3AV2 D;  3UT9 B;  1ZLA C;  1P34 B;  2Y2I A;  2IO5 B;  3AN2 D;  4KUD B;  5CPK A;  5B31 C;  3MNN D;  1N1J A;  5AY8 B;  3O62 C;  5B2J D;  5AV6 D;  5AV5 A;  3X1T B;  3W98 D;  3WAA C;  4H9R A;  5AVC D;  3AYW C;  4Z66 D;  1H3O B;  1M18 D;  1P3B C;  3KXB C;  1B67 A;  3NQJ B;  4KGC B;  2Y2G A;  3LZ1 B;  1R4V A;  1PZR A;  3AV1 C;  4HGA B;  5B0Z C;  3AZI C;  5DNN D;  5B32 G;  5B33 A;  1P3F C;  5B32 A;  3B6F D;  4Z5T D;  2PYO C;  3A6N C;  1P3B D;  3REI A;  3AV2 C;  2ZY3 A;  3X1S B;  4WU8 A;  4X23 A;  3AZG D;  1AOI D;  3MNN C;  3REK A;  4Z66 B;  3AFA C;  5BNX A;  5B2J C;  1S32 A;  3AZF B;  3W99 D;  1P3K A;  1P3I B;  3W98 C;  5B2I D;  3WKJ D;  1M18 C;  1TAF A;  5AVC C;  3B0D C;  3WTP D;  3B6G B;  3UTA B;  4H9S C;  2HIO A;  2ARO A;  5B1M B;  5KDM B;  5B0Y C;  5F99 D;  3KWQ A;  5AV8 A;  3AZH D;  4R8P D;  5DNN C;  1P3L B;  5AVB A;  4G92 C;  3MVD C;  3W97 D;  3WA9 B;  2Y2J A;  3B6F C;  4YM6 C;  4Z5T C;  1JFI A;  2FJ7 C;  2CV5 D;  5G49 B;  1BH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...