4QLCB

Crystal structure of chromatosome at 3.5 angstrom resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (167-mer)
publication title Structural Mechanisms of Nucleosome Recognition by Linker Histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chromatin binding protein/dna
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4qlcB00
3AZLB 3W96C 3LELB 1P3LC 3C1CD 3W99C 3AN2D 3REHD 4J8VC 4XUJD 4HGAC 4CSRB 3MGPC 3B6GB 1P3BD 1P3KC 1P3AA 3KXBC 3UTAB 3AV2D 3TU4C 3AZHC 5GT0A 4UUZB 4KHAA 4R8PD 3A6NA 1A7WA 1BH8A 5CPJB 3B0BA 1P3OA 5AV6A 3W98D 5B32B 5B24A 2BYKB 4EO5B 5AVBC 5CPIA 3NQJB 5BNVB 3X1TA 2YFWA 4ZUXB 4KUDA 4E44A 1P3AD 5JRGA 4LD9C 5GT0D 4YS3C 3AZNB 1P3FB 3MGRA 5F99A 3X1UA 3A6ND 1P3OD 3UT9A 5AV6D 3X1VC 5B2IC 5B24D 3W97C 3AZMA 2NQBA 2YFVB 3AFAA 1F1EA 3X1TD 5B1MC 5B0ZD 4Z66A 2FJ7A 3MGSB 4KUDD 4WU8C 5JRGD 5JA4B 3AZKC 3LZ0C 1P3MA 3C1CC 5BNXA 3MGRD 5AV9A 5F99D 3REHC 3X1UD 1P3GA 3AZJC 5B33A 4QLCB 5B2JA 3UT9D 3REKB 1P3BC 1AOIB 3AZMD 2NQBD 5CPJC 4CAYB 3AFAD 4Z66D 2FJ7D 4X23A 3KUYA 5B32C 4EO5C 3MGQA 1ID3A 1P3MD 3W98C 5CP6C 5DNMA 5AV9D 1JFIB 4J8UA 4YM6B 1P3GD 2F8NB 3R45A 3AZFB 1P3PA 4WU9B 5B2JD 3REJB 3W96A 5BT1D 5C3IC 1M19B 3W99A 4J8VA 1ZLAB 5GT0C 1WWIA 1N1JB 2BYMB 4X23D 3KUYD 3MVDB 3A6NC 1P3KA 4Z5TB 3WKJC 5AVCB 3KXBA 1HQ3A 5FUGB 3AZHA 3MGQD 5AV6C 1ID3D 5DNMD 3MGSC 4J8UD 3AZEB 1P3PD 5B0ZC 3AYWC 3W96D 3W99D 4J8VD 5AVBA 2CV5B 4QLCC 5AY8B 5E5AB 3RELB 3WAAB 1P3KD 3KXBD 1AOIC 1HQ3D 4H9OA 3AZGC 3AZHD 4J8WA 4YS3A 4H9PA 1KX4A 3UTBB 3AZMC 2NQBC 1KX5B 3B6FA 5B1LC 2FJ7C 4NE6A 4YM6C 3W97A 5AVBD 1P3MC 4WU9C 5B1MA 3LELA 4M6BA 1KX3B 4WU8A 3AZKA 4CSRA 1ZLAC 3LZ0A 5AV5B 4J8WD 4YS3D 4Z2MH 1KX4D 4Z5TC 3AZJA 3UTAA 3B6FD 1BH9A 4X23C 1U35C 4E45A 1H3OB 3W97D 5CPJA 1F66B 5DNMC 1EQZB 5B1MD 3LELD 5B32A 4WU8D 2BYKA 3AZKD 2CV5C 3LZ0D 5BNVA 1M18B 3W98A 5CP6A 5AY8C 1P3IB 5E5AC 3LZ1B 3AZJD 3UTAD 3KSYA 5B31B 3AZNA 3VH6T 1P3FA 1TZYB 5AV8B 1HQ3C 1KX5C 5CPJD 1P34C 5B32D 3WKJA 2F8NH 5BO0B 2YFVA 4H9NB 5B0YB 3O62B 5CP6D 2HUEC 3MGSA 4ZUXD 3C1BB 4J8XB 5BS7C 5JA4A 3AZIC 3B0CT 5B0ZA 3AYWA 3AZND 1P3FD 3X1SB 1BFMA 3KWQB 1WWSA 4QLCA 2HIOB 4J8WC 1KX4C 4XUJB 3REKA 3WTPB 4G91C 5CPKB 3WKJD 1AOIA 3B6FC 3AZGA 4CAYA 1F66C 1EQZC 3VH5T 3AV2B 3MGSD 3AV1C 3V9RB 5GSUB 5B1LA 1M18C 4R8PB 3LELC 3AZLC 3AYWD 1JFIA 4YM6A 5DNNB 4AWLB 2F8NA 4XZQB 4QLCD 4WU9A 3B6GC 3REJA 5B31C 3REKD 5B40B 1M19A 3UTAC 1AOID 1ZLAA 3AZGD 1N1JA 2BYMA 3MVDA 4Z5TA 5AVCA 5FUGA 5B1LD 3LJAB 3WA9B 1Q9CA 1U35A 3C1BC 4J8XC 4YM6D 2F8ND 1M1AB 4WU9D 3REJD 4ZUXC 5CPIB 1M19D 3X1TB 2JSSA 2CV5A 1ZLAD 3AZNC 1P3FC 4H9RB 5AY8A 3REIB 4KGCB 3WTPC 2IO5B 5E5AA 4H9SC 3MVDD 3RELA 4Z5TD 5AVCD 5F99B 3X1UB 1U35D 3UT9B 5GSUC 1KX5A 5GXQB 1P34A 4ZBJB 2L5AA 4AWLC 2CV5D 2LY8A 5AY8D 1KX3A 5E5AD 5BS7A 3RELD 3WAAD 4DRBA 3AZIA 3REKC 1TAFB 5B33B 5GT3B 5B2JB 3MNNB 2PYOB 1KX5D 4H9QA 3LJAC 3WA9C 5B32G 1P34D 4NE5A 3VH6A 3KUYB 1F66A 2RVQC 1EQZA 2NZDB 2AROB 3AV1A 1KX3D 3AZFC 5KDMA 3AZID 3REJC 1M18A 3AZLA 2F8NK 4KGCC 3REIC 3R45B 1M19C 3VH6W 2IO5C 3LZ1A 3W96B 1P3LB 4G92B 3B6GA 4WV4B 3W99B 5B31A 4JJNB 4HGAB 1TZYA 4Z2MG 3MVDC 3MGPB 5AVCC 1S32B 5CHLB 1P3KB 1F66D 4UUZA 1EQZD 3TU4B 5GXQC 3AV1D 5BO0A 3AZEC 4H9NA 1M18D 3AZLD 3C1BA 4J8XA 3LZ1D 4NFTA 3NQJA 3VH5A 3B6GD 5B31D 4ZUXA 5AVBB 3WAAC 3RELC 5GT3C 1TZYD 3X1SA 3KWQA 5AV8D 3MNNC 2PYOC 2HIOA 3NQUB 3WTPA 3UTBC 4LD9B 4H9SA 4YS3B 3VH5W 5CPKA 4H9PB 2AROC 3C1BD 4J8XD 3V9RA 5GSUA 2F8NG 3X1VB 5B2IB 1KX3C 3X1SD 3KWQD 5DNNA 5B1MB 5AV5C 4G92C 4XZQA 2HIOD 4WU8B 4JJNC 3AZKB 4WNNB 5B40A 3WTPD 3LZ0B 5CPKD 1S32C 3C1CB 3AN2B 3REHB 3AZJB 1BH9B 5GSUD 1P3BB 3LJAA 3WA9A 5DNND 1M1AA 5G49B 4XZQD 1P3IC 5B40D 3LZ1C 3W98B 5CP6B 3AZFA 4H9RA 3REIA 4KGCA 1TZYC 5AV8C 5C3IB 1KU5A 3LJAD 1P3AB 3WA9D 5GT0B 4KHAB 5B0YC 3O62C 1M1AD 3A6NB 3WKJB 1BH8B 2RVQD 1P3OB 5GXQA 5CPID 4NE3A 5AV6B 3AZFD 3AZEA 5B24B 4KGCD 3REID 3X1SC 3KWQC 5B0ZB 2YFWB 3AYWB 2HIOC 4KUDB 3AN2C 4XUJC 5JRGB 1TAFA 3WAAA 5GT3A 5CPKC 3B0DB 3MNNA 3MGRB 2PYOA 3AV2C 3AZGB 5GXQD 4WZSB 3UTBA 3AZED 4R8PC 3AZMB 2NQBB 2NZDA 3AFAB 5B1LB 2AROA 4Z66B 5DNNC 2FJ7B 4XZQC 1HTAA 5B31G 5B33D 5B40C 1P3MB 5GT3D 5BNXB 3MNND 5AV9B 1P3LA 5AV5A 2PYOD 1P3GB 1B67A 1P3AC 4JJNA 3MGPA 3UTBD 1S32A 3TU4A 1P3OC 2NZDD 1H3OA 2AROD 4X23B 1U35B 1M1AC 5B24C 5CPIC 3MGQB 1ID3B 5DNMB 3X1TC 1P3LD 5AV5D 4J8UB 4KUDC 4JJND 5JRGC 1P3IA 1P3PB 3MGPD 3B0DC 3MGRC 1S32D 5F99C 3X1UC 3NQUA 1ULYA 4J8VB 5AV8A 3TU4D 3UT9C 4LD9A 3KXBB 1HQ3B 3AZHB 3AFAC 4ZBJC 4Z66C 3X1VA 5B2IA 5B0YA 3O62A 1P34B 3B0CW 1P3ID 5AV9C 2HUEB 1P3GC 5B33C 3AZIB 5B2JC 4WNNA 4LD9D 5BT1C 3C1CA 1B6WA 3AN2A 3REHA 3WTPE 4XUJA 4DRAA 4H9OB 4J8WB 4H9QB 1R4VA 1KX4B 3X1VD 5B2ID 5B0YD 3O62D 4G91B 3KUYC 1P3BA 3AV2A 3B6FB 2NZDC 3MGQC 1ID3C 4J8UC 5G49A 4R8PA 3AV1B 3W97B 5KDMB 1P3PC 2CWEA
chains in the Genus database with same CATH superfamily
3AZLB 3W96C 3LELB 1P3LC 3C1CD 3W99C 3AN2D 3REHD 4J8VC 4XUJD 4HGAC 4CSRB 3MGPC 3B6GB 1P3BD 1P3KC 1P3AA 2DF4C 3KXBC 3UTAB 3AV2D 3TU4C 3AZHC 4WJ3C 5GT0A 4UUZB 4KHAA 2DQNC 4R8PD 3A6NA 1A7WA 1BH8A 1W2EA 5CPJB 3B0BA 1P3OA 5AV6A 3W98D 3P5JB 5B32B 5B24A 2BYKB 4EO5B 5AVBC 5CPIA 3NQJB 5BNVB 3X1TA 2YFWA 4ZUXB 4KUDA 4E44A 1P3AD 5JRGA 4LD9C 5GT0D 2ZY4A 4YS3C 4DQYB 3AZNB 1P3FB 3MGRA 5F99A 2Y2MA 3X1UA 3A6ND 1P3OD 3UT9A 5AV6D 3X1VC 5B2IC 5B24D 3W97C 3AZMA 2NQBA 2YFVB 3AFAA 1F1EA 3X1TD 5B1MC 5B0ZD 4Z66A 2FJ7A 3MGSB 4KUDD 4WU8C 5JRGD 5JA4B 3AZKC 3LZ0C 1P3MA 3C1CC 5BNXA 3MGRD 5AV9A 5F99D 3REHC 3X1UD 1P3GA 3AZJC 5B33A 4QLCB 5B2JA 3UT9D 3REKB 1P3BC 1AOIB 3AZMD 2NQBD 5CPJC 4CAYB 3AFAD 4Z66D 2FJ7D 4X23A 3KUYA 5B32C 4EO5C 3KFUG 3MGQA 1ID3A 1P3MD 3W98C 5CP6C 5DNMA 5AV9D 1JFIB 4J8UA 4YM6B 1P3GD 2F8NB 3R45A 3AZFB 1P3PA 4WU9B 5B2JD 3REJB 3W96A 5BT1D 5C3IC 1M19B 3W99A 4J8VA 1ZLAB 5GT0C 1WWIA 1N1JB 2BYMB 3A1IA 4X23D 3KUYD 3MVDB 3A6NC 1P3KA 4Z5TB 3WKJC 5AVCB 3KXBA 1HQ3A 5FUGB 3AZHA 3MGQD 5AV6C 1ID3D 5DNMD 3MGSC 4J8UD 3AZEB 1P3PD 5B0ZC 3AYWC 3W96D 3W99D 4J8VD 5AVBA 2CV5B 4QLCC 5AY8B 5E5AB 3RELB 3WAAB 1P3KD 3KXBD 1AOIC 1HQ3D 4H9OA 3AZGC 3AZHD 4J8WA 4YS3A 4H9PA 1KX4A 3UTBB 3AZMC 2FFFB 2NQBC 1KX5B 3B6FA 5B1LC 2FJ7C 4NE6A 4YM6C 3W97A 2Y2LA 5AVBD 1P3MC 4WU9C 5B1MA 3LELA 4M6BA 1KX3B 4WU8A 3AZKA 4CSRA 1ZLAC 3LZ0A 5AV5B 4J8WD 4YS3D 4Z2MH 1KX4D 4UPKA 4Z5TC 3AZJA 3UTAA 3B6FD 1BH9A 4X23C 1U35C 4E45A 1H3OB 3W97D 5CPJA 1F66B 5DNMC 1EQZB 5B1MD 3LELD 5B32A 4WU8D 2BYKA 3AZKD 2CV5C 3LZ0D 2Y2NA 5BNVA 1M18B 5CP6A 3W98A 5AY8C 1P3IB 5E5AC 2J8PA 3LZ1B 3AZJD 3UTAD 3EPKA 3KSYA 5B31B 3AZNA 3VH6T 1P3FA 1TZYB 5AV8B 1HQ3C 3IP4C 1KX5C 5CPJD 1P34C 5B32D 3WKJA 2F8NH 5BO0B 2YFVA 4H9NB 5B0YB 3O62B 5CP6D 2HUEC 3MGSA 4ZUXD 3C1BB 3FDDA 5BS7C 4J8XB 5JA4A 3AZIC 3B0CT 5B0ZA 3AYWA 3AZND 1P3FD 3X1SB 1BFMA 3KWQB 1WWSA 4QLCA 2HIOB 3EPLA 4J8WC 1KX4C 4XUJB 3REKA 3F6TA 3WTPB 3EPJA 4G91C 5CPKB 3WKJD 1AOIA 3B6FC 3AZGA 4CAYA 1F66C 1EQZC 3VH5T 3AV2B 3MGSD 3AV1C 3V9RB 5GSUB 5B1LA 1M18C 4R8PB 3LELC 3AZLC 3AYWD 1JFIA 4YM6A 5DNNB 4AWLB 2F8NA 4XZQB 4QLCD 2Y2GA 4WU9A 3REJA 3B6GC 5B31C 3REKD 5B40B 1M19A 3UTAC 1AOID 1ZLAA 3AZGD 1N1JA 2BYMA 3MVDA 4Z5TA 5AVCA 5FUGA 5B1LD 3LJAB 3WA9B 1Q9CA 1U35A 3C1BC 4J8XC 4YM6D 2F8ND 1M1AB 4WU9D 3REJD 4ZUXC 5CPIB 1M19D 3X1TB 2JSSA 2CV5A 1ZLAD 3AZNC 1P3FC 3EPHA 4H9RB 5AY8A 3REIB 4KGCB 3WTPC 2IO5B 5E5AA 4H9SC 3MVDD 3RELA 4Z5TD 5AVCD 5F99B 3X1UB 1U35D 3UT9B 5GSUC 2ZY5A 2ZY3A 1KX5A 5GXQB 1P34A 4ZBJB 2L5AA 4AWLC 2JCHA 2Y2KA 2CV5D 2LY8A 5AY8D 1KX3A 5E5AD 5BS7A 3RELD 3WAAD 4DRBA 3AZIA 3REKC 1TAFB 5B33B 5GT3B 5B2JB 3MNNB 2PYOB 1KX5D 4H9QA 3LJAC 3WA9C 5B32G 1P34D 4NE5A 3VH6A 3KUYB 1F66A 2RVQC 2JE5A 1EQZA 2NZDB 2AROB 3AV1A 1KX3D 3AZFC 5KDMA 3AZID 3REJC 1M18A 3AZLA 2Y2HA 2F8NK 4KGCC 3REIC 3R45B 1M19C 3VH6W 2IO5C 3LZ1A 3W96B 1P3LB 4G92B 3B6GA 4WV4B 3W99B 5B31A 4JJNB 4HGAB 1TZYA 4Z2MG 3MVDC 3MGPB 5AVCC 1S32B 5CHLB 1P3KB 1F66D 4UUZA 1EQZD 3TU4B 5GXQC 3AV1D 5BO0A 3AZEC 4H9NA 1M18D 3AZLD 3C1BA 4J8XA 3LZ1D 4NFTA 3NQJA 3VH5A 3B6GD 5B31D 4ZUXA 5AVBB 3WAAC 3RELC 5GT3C 1TZYD 3X1SA 3KWQA 5AV8D 3MNNC 1T3UA 2PYOC 2HIOA 3NQUB 3WTPA 3UTBC 4LD9B 4H9SA 4YS3B 3VH5W 5CPKA 4H9PB 2Y2IA 2AROC 3C1BD 4J8XD 3V9RA 5GSUA 2F8NG 3X1VB 5B2IB 3H0RC 1KX3C 3X1SD 3KWQD 2ZM5A 5DNNA 5B1MB 5AV5C 4G92C 4XZQA 2HIOD 4WU8B 4JJNC 3AZKB 4WNNB 5B40A 3WTPD 3LZ0B 5CPKD 1S32C 3C1CB 3H0MC 3AN2B 3REHB 3AZJB 2RIQA 2XD5A 1BH9B 5GSUD 1P3BB 3LJAA 3WA9A 5DNND 2UWXA 5G49B 4XZQD 1M1AA 1P3IC 5B40D 3LZ1C 3W98B 5CP6B 3AZFA 2ZY2A 4H9RA 3REIA 4KGCA 1TZYC 5AV8C 5C3IB 1KU5A 3LJAD 1P3AB 3WA9D 5GT0B 4KHAB 5B0YC 3O62C 1M1AD 3A6NB 3WKJB 1BH8B 2RVQD 1P3OB 5GXQA 5CPID 4NE3A 5AV6B 2Y2QA 3AZFD 3AZEA 5B24B 4KGCD 3REID 3X1SC 2Y2JA 3KWQC 5B0ZB 2YFWB 3AYWB 2HIOC 2W8SA 4KUDB 3AN2C 4XUJC 3A1KA 5JRGB 1TAFA 1Z2CB 3WAAA 5GT3A 5CPKC 3B0DB 3MNNA 3MGRB 2PYOA 3AV2C 3AZGB 5GXQD 4WZSB 3UTBA 3AZED 4R8PC 3AZMB 2NQBB 2NZDA 3AFAB 5B1LB 2AROA 4Z66B 5DNNC 2FJ7B 4XZQC 1HTAA 5B31G 2Y2PA 5B33D 5B40C 1P3MB 5GT3D 5BNXB 3MNND 5AV9B 1P3LA 5AV5A 2PYOD 1P3GB 1B67A 3H0LC 4JJNA 1P3AC 3MGPA 3UTBD 1S32A 3TU4A 1P3OC 2NZDD 1H3OA 2AROD 4X23B 1U35B 1M1AC 5B24C 5CPIC 3MGQB 1ID3B 5DNMB 3X1TC 3AL0C 2BG1A 1P3LD 5AV5D 4J8UB 4KUDC 2Y2OA 4JJND 5JRGC 1P3IA 1P3PB 3MGPD 3B0DC 3MGRC 1S32D 5F99C 3X1UC 3NQUA 1ULYA 4J8VB 5AV8A 3TU4D 3UT9C 4LD9A 2F2AC 2G5HC 3KXBB 1HQ3B 3AZHB 1PZRA 3AFAC 4ZBJC 4Z66C 3EG5B 3X1VA 5B2IA 5B0YA 3O62A 1P34B 3B0CW 1P3ID 5AV9C 2HUEB 1P3GC 5B33C 2XD1A 3AZIB 5B2JC 4WNNA 4LD9D 5BT1C 3C1CA 1B6WA 3AN2A 3REHA 3WTPE 4XUJA 2VQRA 4DRAA 4H9OB 4J8WB 4H9QB 1R4VA 1KX4B 3X1VD 5B2ID 5B0YD 3O62D 4G91B 3KUYC 1P3BA 2G5IC 3AV2A 3B6FB 2NZDC 3MGQC 1ID3C 4J8UC 5G49A 4R8PA 3AV1B 3W97B 5KDMB 1P3PC 2CWEA
chains in the Genus database with same CATH topology
3AZLB 3W96C 3LELB 1P3LC 3C1CD 3W99C 3AN2D 3REHD 4J8VC 4XUJD 4HGAC 4CSRB 3MGPC 3B6GB 1P3BD 1P3KC 1P3AA 2DF4C 3KXBC 3UTAB 3AV2D 3TU4C 3AZHC 4WJ3C 5GT0A 4UUZB 4KHAA 2DQNC 4R8PD 3A6NA 1A7WA 1BH8A 1W2EA 5CPJB 3B0BA 1P3OA 5AV6A 3W98D 3P5JB 5B32B 5B24A 2BYKB 4EO5B 5AVBC 5CPIA 3NQJB 5BNVB 3X1TA 2YFWA 4ZUXB 4KUDA 4E44A 1P3AD 5JRGA 4LD9C 5GT0D 2ZY4A 4YS3C 4DQYB 3AZNB 1P3FB 3MGRA 5F99A 2Y2MA 3X1UA 3A6ND 1P3OD 3UT9A 5AV6D 3X1VC 5B2IC 5B24D 3W97C 3AZMA 2NQBA 2YFVB 3AFAA 1F1EA 3X1TD 5B1MC 5B0ZD 4Z66A 2FJ7A 3MGSB 4KUDD 4WU8C 5JRGD 5JA4B 3AZKC 3LZ0C 1P3MA 3C1CC 5BNXA 3MGRD 5AV9A 5F99D 3REHC 3X1UD 1P3GA 3AZJC 5B33A 4QLCB 5B2JA 3UT9D 3REKB 1P3BC 1AOIB 3AZMD 2NQBD 5CPJC 4CAYB 3AFAD 4Z66D 2FJ7D 4X23A 3KUYA 5B32C 4EO5C 3KFUG 3MGQA 1ID3A 1P3MD 3W98C 5CP6C 5DNMA 5AV9D 1JFIB 4J8UA 4YM6B 1P3GD 2F8NB 3R45A 3AZFB 1P3PA 4WU9B 5B2JD 3REJB 3W96A 5BT1D 5C3IC 1M19B 3W99A 4J8VA 1ZLAB 5GT0C 1WWIA 1N1JB 2BYMB 3A1IA 4X23D 3KUYD 3MVDB 3A6NC 1P3KA 4Z5TB 3WKJC 5AVCB 3KXBA 1HQ3A 5FUGB 3AZHA 3MGQD 5AV6C 1ID3D 5DNMD 3MGSC 4J8UD 3AZEB 1P3PD 5B0ZC 3AYWC 3W96D 3W99D 4J8VD 5AVBA 2CV5B 4QLCC 5AY8B 5E5AB 3RELB 3WAAB 1P3KD 3KXBD 1AOIC 1HQ3D 4H9OA 3AZGC 3AZHD 4J8WA 4YS3A 4H9PA 1KX4A 3UTBB 3AZMC 2FFFB 2NQBC 1KX5B 3B6FA 5B1LC 2FJ7C 4NE6A 4YM6C 3W97A 2Y2LA 5AVBD 1P3MC 4WU9C 5B1MA 3LELA 4M6BA 1KX3B 4WU8A 3AZKA 4CSRA 1ZLAC 3LZ0A 5AV5B 4J8WD 4YS3D 4Z2MH 1KX4D 4UPKA 4Z5TC 3AZJA 3UTAA 3B6FD 1BH9A 4X23C 1U35C 4E45A 1H3OB 3W97D 5CPJA 1F66B 5DNMC 1EQZB 5B1MD 3LELD 5B32A 4WU8D 2BYKA 3AZKD 2CV5C 3LZ0D 2Y2NA 5BNVA 1M18B 5CP6A 3W98A 5AY8C 1P3IB 5E5AC 2J8PA 3LZ1B 3AZJD 3UTAD 3EPKA 3KSYA 5B31B 3AZNA 3VH6T 1P3FA 1TZYB 5AV8B 1HQ3C 3IP4C 1KX5C 5CPJD 1P34C 5B32D 3WKJA 2F8NH 5BO0B 2YFVA 4H9NB 5B0YB 3O62B 5CP6D 2HUEC 3MGSA 4ZUXD 3C1BB 3FDDA 5BS7C 4J8XB 5JA4A 3AZIC 3B0CT 5B0ZA 3AYWA 3AZND 1P3FD 3X1SB 1BFMA 3KWQB 1WWSA 4QLCA 2HIOB 3EPLA 4J8WC 1KX4C 4XUJB 3REKA 3F6TA 3WTPB 3EPJA 4G91C 5CPKB 3WKJD 1AOIA 3B6FC 3AZGA 4CAYA 1F66C 1EQZC 3VH5T 3AV2B 3MGSD 3AV1C 3V9RB 5GSUB 5B1LA 1M18C 4R8PB 3LELC 3AZLC 3AYWD 1JFIA 4YM6A 5DNNB 4AWLB 2F8NA 4XZQB 4QLCD 2Y2GA 4WU9A 3REJA 3B6GC 5B31C 3REKD 5B40B 1M19A 3UTAC 1AOID 1ZLAA 3AZGD 1N1JA 2BYMA 3MVDA 4Z5TA 5AVCA 5FUGA 5B1LD 3LJAB 3WA9B 1Q9CA 1U35A 3C1BC 4J8XC 4YM6D 2F8ND 1M1AB 4WU9D 3REJD 4ZUXC 5CPIB 1M19D 3X1TB 2JSSA 2CV5A 1ZLAD 3AZNC 1P3FC 3EPHA 4H9RB 5AY8A 3REIB 4KGCB 3WTPC 2IO5B 5E5AA 4H9SC 3MVDD 3RELA 4Z5TD 5AVCD 5F99B 3X1UB 1U35D 3UT9B 5GSUC 2ZY5A 2ZY3A 1KX5A 5GXQB 1P34A 4ZBJB 2L5AA 4AWLC 2JCHA 2Y2KA 2CV5D 2LY8A 5AY8D 1KX3A 5E5AD 5BS7A 3RELD 3WAAD 4DRBA 3AZIA 3REKC 1TAFB 5B33B 5GT3B 5B2JB 3MNNB 2PYOB 1KX5D 4H9QA 3LJAC 3WA9C 5B32G 1P34D 4NE5A 3VH6A 3KUYB 1F66A 2RVQC 2JE5A 1EQZA 2NZDB 2AROB 3AV1A 1KX3D 3AZFC 5KDMA 3AZID 3REJC 1M18A 3AZLA 2Y2HA 2F8NK 4KGCC 3REIC 3R45B 1M19C 3VH6W 2IO5C 3LZ1A 3W96B 1P3LB 4G92B 3B6GA 4WV4B 3W99B 5B31A 4JJNB 4HGAB 1TZYA 4Z2MG 3MVDC 3MGPB 5AVCC 1S32B 5CHLB 1P3KB 1F66D 4UUZA 1EQZD 3TU4B 5GXQC 3AV1D 5BO0A 3AZEC 4H9NA 1M18D 3AZLD 3C1BA 4J8XA 3LZ1D 4NFTA 3NQJA 3VH5A 3B6GD 5B31D 4ZUXA 5AVBB 3WAAC 3RELC 5GT3C 1TZYD 3X1SA 3KWQA 5AV8D 3MNNC 1T3UA 2PYOC 2HIOA 3NQUB 3WTPA 3UTBC 4LD9B 4H9SA 4YS3B 3VH5W 5CPKA 4H9PB 2Y2IA 2AROC 3C1BD 4J8XD 3V9RA 5GSUA 2F8NG 3X1VB 5B2IB 3H0RC 1KX3C 3X1SD 3KWQD 2ZM5A 5DNNA 5B1MB 5AV5C 4G92C 4XZQA 2HIOD 4WU8B 4JJNC 3AZKB 4WNNB 5B40A 3WTPD 3LZ0B 5CPKD 1S32C 3C1CB 3H0MC 3AN2B 3REHB 3AZJB 2RIQA 2XD5A 1BH9B 5GSUD 1P3BB 3LJAA 3WA9A 5DNND 2UWXA 5G49B 4XZQD 1M1AA 1P3IC 5B40D 3LZ1C 3W98B 5CP6B 3AZFA 2ZY2A 4H9RA 3REIA 4KGCA 1TZYC 5AV8C 5C3IB 1KU5A 3LJAD 1P3AB 3WA9D 5GT0B 4KHAB 5B0YC 3O62C 1M1AD 3A6NB 3WKJB 1BH8B 2RVQD 1P3OB 5GXQA 5CPID 4NE3A 5AV6B 2Y2QA 3AZFD 3AZEA 5B24B 4KGCD 3REID 3X1SC 2Y2JA 3KWQC 5B0ZB 2YFWB 3AYWB 2HIOC 2W8SA 4KUDB 3AN2C 4XUJC 3A1KA 5JRGB 1TAFA 1Z2CB 3WAAA 5GT3A 5CPKC 3B0DB 3MNNA 3MGRB 2PYOA 3AV2C 3AZGB 5GXQD 4WZSB 3UTBA 3AZED 4R8PC 3AZMB 2NQBB 2NZDA 3AFAB 5B1LB 2AROA 4Z66B 5DNNC 2FJ7B 4XZQC 1HTAA 5B31G 2Y2PA 5B33D 5B40C 1P3MB 5GT3D 5BNXB 3MNND 5AV9B 1P3LA 5AV5A 2PYOD 1P3GB 1B67A 3H0LC 4JJNA 1P3AC 3MGPA 3UTBD 1S32A 3TU4A 1P3OC 2NZDD 1H3OA 2AROD 4X23B 1U35B 1M1AC 5B24C 5CPIC 3MGQB 1ID3B 5DNMB 3X1TC 3AL0C 2BG1A 1P3LD 5AV5D 4J8UB 4KUDC 2Y2OA 4JJND 5JRGC 1P3IA 1P3PB 3MGPD 3B0DC 3MGRC 1S32D 5F99C 3X1UC 3NQUA 1ULYA 4J8VB 5AV8A 3TU4D 3UT9C 4LD9A 2F2AC 2G5HC 3KXBB 1HQ3B 3AZHB 1PZRA 3AFAC 4ZBJC 4Z66C 3EG5B 3X1VA 5B2IA 5B0YA 3O62A 1P34B 3B0CW 1P3ID 5AV9C 2HUEB 1P3GC 5B33C 2XD1A 3AZIB 5B2JC 4WNNA 4LD9D 5BT1C 3C1CA 1B6WA 3AN2A 3REHA 3WTPE 4XUJA 2VQRA 4DRAA 4H9OB 4J8WB 4H9QB 1R4VA 1KX4B 3X1VD 5B2ID 5B0YD 3O62D 4G91B 3KUYC 1P3BA 2G5IC 3AV2A 3B6FB 2NZDC 3MGQC 1ID3C 4J8UC 5G49A 4R8PA 3AV1B 3W97B 5KDMB 1P3PC 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  3W96 C;  3LEL B;  1P3L C;  3C1C D;  3W99 C;  3AN2 D;  3REH D;  4J8V C;  4XUJ D;  4HGA C;  4CSR B;  3MGP C;  3B6G B;  1P3B D;  1P3K C;  1P3A A;  3KXB C;  3UTA B;  3AV2 D;  3TU4 C;  3AZH C;  5GT0 A;  4UUZ B;  4KHA A;  4R8P D;  3A6N A;  1A7W A;  1BH8 A;  5CPJ B;  3B0B A;  1P3O A;  5AV6 A;  3W98 D;  5B32 B;  5B24 A;  2BYK B;  4EO5 B;  5AVB C;  5CPI A;  3NQJ B;  5BNV B;  3X1T A;  2YFW A;  4ZUX B;  4KUD A;  4E44 A;  1P3A D;  5JRG A;  4LD9 C;  5GT0 D;  4YS3 C;  3AZN B;  1P3F B;  3MGR A;  5F99 A;  3X1U A;  3A6N D;  1P3O D;  3UT9 A;  5AV6 D;  3X1V C;  5B2I C;  5B24 D;  3W97 C;  3AZM A;  2NQB A;  2YFV B;  3AFA A;  1F1E A;  3X1T D;  5B1M C;  5B0Z D;  4Z66 A;  2FJ7 A;  3MGS B;  4KUD D;  4WU8 C;  5JRG D;  5JA4 B;  3AZK C;  3LZ0 C;  1P3M A;  3C1C C;  5BNX A;  3MGR D;  5AV9 A;  5F99 D;  3REH C;  3X1U D;  1P3G A;  3AZJ C;  5B33 A;  4QLC B;  5B2J A;  3UT9 D;  3REK B;  1P3B C;  1AOI B;  3AZM D;  2NQB D;  5CPJ C;  4CAY B;  3AFA D;  4Z66 D;  2FJ7 D;  4X23 A;  3KUY A;  5B32 C;  4EO5 C;  3MGQ A;  1ID3 A;  1P3M D;  3W98 C;  5CP6 C;  5DNM A;  5AV9 D;  1JFI B;  4J8U A;  4YM6 B;  1P3G D;  2F8N B;  3R45 A;  3AZF B;  1P3P A;  4WU9 B;  5B2J D;  3REJ B;  3W96 A;  5BT1 D;  5C3I C;  1M19 B;  3W99 A;  4J8V A;  1ZLA B;  5GT0 C;  1WWI A;  1N1J B;  2BYM B;  4X23 D;  3KUY D;  3MVD B;  3A6N C;  1P3K A;  4Z5T B;  3WKJ C;  5AVC B;  3KXB A;  1HQ3 A;  5FUG B;  3AZH A;  3MGQ D;  5AV6 C;  1ID3 D;  5DNM D;  3MGS C;  4J8U D;  3AZE B;  1P3P D;  5B0Z C;  3AYW C;  3W96 D;  3W99 D;  4J8V D;  5AVB A;  2CV5 B;  4QLC C;  5AY8 B;  5E5A B;  3REL B;  3WAA B;  1P3K D;  3KXB D;  1AOI C;  1HQ3 D;  4H9O A;  3AZG C;  3AZH D;  4J8W A;  4YS3 A;  4H9P A;  1KX4 A;  3UTB B;  3AZM C;  2NQB C;  1KX5 B;  3B6F A;  5B1L C;  2FJ7 C;  4NE6 A;  4YM6 C;  3W97 A;  5AVB D;  1P3M C;  4WU9 C;  5B1M A;  3LEL A;  4M6B A;  1KX3 B;  4WU8 A;  3AZK A;  4CSR A;  1ZLA C;  3LZ0 A;  5AV5 B;  4J8W D;  4YS3 D;  4Z2M H;  1KX4 D;  4Z5T C;  3AZJ A;  3UTA A;  3B6F D;  1BH9 A;  4X23 C;  1U35 C;  4E45 A;  1H3O B;  3W97 D;  5CPJ A;  1F66 B;  5DNM C;  1EQZ B;  5B1M D;  3LEL D;  5B32 A;  4WU8 D;  2BYK A;  3AZK D;  2CV5 C;  3LZ0 D;  5BNV A;  1M18 B;  3W98 A;  5CP6 A;  5AY8 C;  1P3I B;  5E5A C;  3LZ1 B;  3AZJ D;  3UTA D;  3KSY A;  5B31 B;  3AZN A;  3VH6 T;  1P3F A;  1TZY B;  5AV8 B;  1HQ3 C;  1KX5 C;  5CPJ D;  1P34 C;  5B32 D;  3WKJ A;  2F8N H;  5BO0 B;  2YFV A;  4H9N B;  5B0Y B;  3O62 B;  5CP6 D;  2HUE C;  3MGS A;  4ZUX D;  3C1B B;  4J8X B;  5BS7 C;  5JA4 A;  3AZI C;  3B0C T;  5B0Z A;  3AYW A;  3AZN D;  1P3F D;  3X1S B;  1BFM A;  3KWQ B;  1WWS A;  4QLC A;  2HIO B;  4J8W C;  1KX4 C;  4XUJ B;  3REK A;  3WTP B;  4G91 C;  5CPK B;  3WKJ D;  1AOI A;  3B6F C;  3AZG A;  4CAY A;  1F66 C;  1EQZ C;  3VH5 T;  3AV2 B;  3MGS D;  3AV1 C;  3V9R B;  5GSU B;  5B1L A;  1M18 C;  4R8P B;  3LEL C;  3AZL C;  3AYW D;  1JFI A;  4YM6 A;  5DNN B;  4AWL B;  2F8N A;  4XZQ B;  4QLC D;  4WU9 A;  3B6G C;  3REJ A;  5B31 C;  3REK D;  5B40 B;  1M19 A;  3UTA C;  1AOI D;  1ZLA A;  3AZG D;  1N1J A;  2BYM A;  3MVD A;  4Z5T A;  5AVC A;  5FUG A;  5B1L D;  3LJA B;  3WA9 B;  1Q9C A;  1U35 A;  3C1B C;  4J8X C;  4YM6 D;  2F8N D;  1M1A B;  4WU9 D;  3REJ D;  4ZUX C;  5CPI B;  1M19 D;  3X1T B;  2JSS A;  2CV5 A;  1ZLA D;  3AZN C;  1P3F C;  4H9R B;  5AY8 A;  3REI B;  4KGC B;  3WTP C;  2IO5 B;  5E5A A;  4H9S C;  3MVD D;  3REL A;  4Z5T D;  5AVC D;  5F99 B;  3X1U B;  1U35 D;  3UT9 B;  5GSU C;  1KX5 A;  5GXQ B;  1P34 A;  4ZBJ B;  2L5A A;  4AWL C;  2CV5 D;  2LY8 A;  5AY8 D;  1KX3 A;  5E5A D;  5BS7 A;  3REL D;  3WAA D;  4DRB A;  3AZI A;  3REK C;  1TAF B;  5B33 B;  5GT3 B;  5B2J B;  3MNN B;  2PYO B;  1KX5 D;  4H9Q A;  3LJA C;  3WA9 C;  5B32 G;  1P34 D;  4NE5 A;  3VH6 A;  3KUY B;  1F66 A;  2RVQ C;  1EQZ A;  2NZD B;  2ARO B;  3AV1 A;  1KX3 D;  3AZF C;  5KDM A;  3AZI D;  3REJ C;  1M18 A;  3AZL A;  2F8N K;  4KGC C;  3REI C;  3R45 B;  1M19 C;  3VH6 W;  2IO5 C;  3LZ1 A;  3W96 B;  1P3L B;  4G92 B;  3B6G A;  4WV4 B;  3W99 B;  5B31 A;  4JJN B;  4HGA B;  1TZY A;  4Z2M G;  3MVD C;  3MGP B;  5AVC C;  1S32 B;  5CHL B;  1P3K B;  1F66 D;  4UUZ A;  1EQZ D;  3TU4 B;  5GXQ C;  3AV1 D;  5BO0 A;  3AZE C;  4H9N A;  1M18 D;  3AZL D;  3C1B A;  4J8X A;  3LZ1 D;  4NFT A;  3NQJ A;  3VH5 A;  3B6G D;  5B31 D;  4ZUX A;  5AVB B;  3WAA C;  3REL C;  5GT3 C;  1TZY D;  3X1S A;  3KWQ A;  5AV8 D;  3MNN C;  2PYO C;  2HIO A;  3NQU B;  3WTP A;  3UTB C;  4LD9 B;  4H9S A;  4YS3 B;  3VH5 W;  5CPK A;  4H9P B;  2ARO C;  3C1B D;  4J8X D;  3V9R A;  5GSU A;  2F8N G;  3X1V B;  5B2I B;  1KX3 C;  3X1S D;  3KWQ D;  5DNN A;  5B1M B;  5AV5 C;  4G92 C;  4XZQ A;  2HIO D;  4WU8 B;  4JJN C;  3AZK B;  4WNN B;  5B40 A;  3WTP D;  3LZ0 B;  5CPK D;  1S32 C;  3C1C B;  3AN2 B;  3REH B;  3AZJ B;  1BH9 B;  5GSU D;  1P3B B;  3LJA A;  3WA9 A;  5DNN D;  1M1A A;  5G49 B;  4XZQ D;  1P3I C;  5B40 D;  3LZ1 C;  3W98 B;  5CP6 B;  3AZF A;  4H9R A;  3REI A;  4KGC A;  1TZY C;  5AV8 C;  5C3I B;  1KU5 A;  3LJA D;  1P3A B;  3WA9 D;  5GT0 B;  4KHA B;  5B0Y C;  3O62 C;  1M1A D;  3A6N B;  3WKJ B;  1BH8 B;  2RVQ D;  1P3O B;  5GXQ A;  5CPI D;  4NE3 A;  5AV6 B;  3AZF D;  3AZE A;  5B24 B;  4KGC D;  3REI D;  3X1S C;  3KWQ C;  5B0Z B;  2YFW B;  3AYW B;  2HIO C;  4KUD B;  3AN2 C;  4XUJ C;  5JRG B;  1TAF A;  3WAA A;  5GT3 A;  5CPK C;  3B0D B;  3MNN A;  3MGR B;  2PYO A;  3AV2 C;  3AZG B;  5GXQ D;  4WZS B;  3UTB A;  3AZE D;  4R8P C;  3AZM B;  2NQB B;  2NZD A;  3AFA B;  5B1L B;  2ARO A;  4Z66 B;  5DNN C;  2FJ7 B;  4XZQ C;  1HTA A;  5B31 G;  5B33 D;  5B40 C;  1P3M B;  5GT3 D;  5BNX B;  3MNN D;  5AV9 B;  1P3L A;  5AV5 A;  2PYO D;  1P3G B;  1B67 A;  1P3A C;  4JJN A;  3MGP A;  3UTB D;  1S32 A;  3TU4 A;  1P3O C;  2NZD D;  1H3O A;  2ARO D;  4X23 B;  1U35 B;  1M1A C;  5B24 C;  5CPI C;  3MGQ B;  1ID3 B;  5DNM B;  3X1T C;  1P3L D;  5AV5 D;  4J8U B;  4KUD C;  4JJN D;  5JRG C;  1P3I A;  1P3P B;  3MGP D;  3B0D C;  3MGR C;  1S32 D;  5F99 C;  3X1U C;  3NQU A;  1ULY A;  4J8V B;  5AV8 A;  3TU4 D;  3UT9 C;  4LD9 A;  3KXB B;  1HQ3 B;  3AZH B;  3AFA C;  4ZBJ C;  4Z66 C;  3X1V A;  5B2I A;  5B0Y A;  3O62 A;  1P34 B;  3B0C W;  1P3I D;  5AV9 C;  2HUE B;  1P3G C;  5B33 C;  3AZI B;  5B2J C;  4WNN A;  4LD9 D;  5BT1 C;  3C1C A;  1B6W A;  3AN2 A;  3REH A;  3WTP E;  4XUJ A;  4DRA A;  4H9O B;  4J8W B;  4H9Q B;  1R4V A;  1KX4 B;  3X1V D;  5B2I D;  5B0Y D;  3O62 D;  4G91 B;  3KUY C;  1P3B A;  3AV2 A;  3B6F B;  2NZD C;  3MGQ C;  1ID3 C;  4J8U C;  5G49 A;  4R8P A;  3AV1 B;  3W97 B;  5KDM B;  1P3P C;  2CWE A; 
#chains in the Genus database with same CATH topology
 3AZL B;  3W96 C;  3LEL B;  1P3L C;  3C1C D;  3W99 C;  3AN2 D;  3REH D;  4J8V C;  4XUJ D;  4HGA C;  4CSR B;  3MGP C;  3B6G B;  1P3B D;  1P3K C;  1P3A A;  2DF4 C;  3KXB C;  3UTA B;  3AV2 D;  3TU4 C;  3AZH C;  4WJ3 C;  5GT0 A;  4UUZ B;  4KHA A;  2DQN C;  4R8P D;  3A6N A;  1A7W A;  1BH8 A;  1W2E A;  5CPJ B;  3B0B A;  1P3O A;  5AV6 A;  3W98 D;  3P5J B;  5B32 B;  5B24 A;  2BYK B;  4EO5 B;  5AVB C;  5CPI A;  3NQJ B;  5BNV B;  3X1T A;  2YFW A;  4ZUX B;  4KUD A;  4E44 A;  1P3A D;  5JRG A;  4LD9 C;  5GT0 D;  2ZY4 A;  4YS3 C;  4DQY B;  3AZN B;  1P3F B;  3MGR A;  5F99 A;  2Y2M A;  3X1U A;  3A6N D;  1P3O D;  3UT9 A;  5AV6 D;  3X1V C;  5B2I C;  5B24 D;  3W97 C;  3AZM A;  2NQB A;  2YFV B;  3AFA A;  1F1E A;  3X1T D;  5B1M C;  5B0Z D;  4Z66 A;  2FJ7 A;  3MGS B;  4KUD D;  4WU8 C;  5JRG D;  5JA4 B;  3AZK C;  3LZ0 C;  1P3M A;  3C1C C;  5BNX A;  3MGR D;  5AV9 A;  5F99 D;  3REH C;  3X1U D;  1P3G A;  3AZJ C;  5B33 A;  4QLC B;  5B2J A;  3UT9 D;  3REK B;  1P3B C;  1AOI B;  3AZM D;  2NQB D;  5CPJ C;  4CAY B;  3AFA D;  4Z66 D;  2FJ7 D;  4X23 A;  3KUY A;  5B32 C;  4EO5 C;  3KFU G;  3MGQ A;  1ID3 A;  1P3M D;  3W98 C;  5CP6 C;  5DNM A;  5AV9 D;  1JFI B;  4J8U A;  4YM6 B;  1P3G D;  2F8N B;  3R45 A;  3AZF B;  1P3P A;  4WU9 B;  5B2J D;  3REJ B;  3W96 A;  5BT1 D;  5C3I C;  1M19 B;  3W99 A;  4J8V A;  1ZLA B;  5GT0 C;  1WWI A;  1N1J B;  2BYM B;  3A1I A;  4X23 D;  3KUY D;  3MVD B;  3A6N C;  1P3K A;  4Z5T B;  3WKJ C;  5AVC B;  3KXB A;  1HQ3 A;  5FUG B;  3AZH A;  3MGQ D;  5AV6 C;  1ID3 D;  5DNM D;  3MGS C;  4J8U D;  3AZE B;  1P3P D;  5B0Z C;  3AYW C;  3W96 D;  3W99 D;  4J8V D;  5AVB A;  2CV5 B;  4QLC C;  5AY8 B;  5E5A B;  3REL B;  3WAA B;  1P3K D;  3KXB D;  1AOI C;  1HQ3 D;  4H9O A;  3AZG C;  3AZH D;  4J8W A;  4YS3 A;  4H9P A;  1KX4 A;  3UTB B;  3AZM C;  2FFF B;  2NQB C;  1KX5 B;  3B6F A;  5B1L C;  2FJ7 C;  4NE6 A;  4YM6 C;  3W97 A;  2Y2L A;  5AVB D;  1P3M C;  4WU9 C;  5B1M A;  3LEL A;  4M6B A;  1KX3 B;  4WU8 A;  3AZK A;  4CSR A;  1ZLA C;  3LZ0 A;  5AV5 B;  4J8W D;  4YS3 D;  4Z2M H;  1KX4 D;  4UPK A;  4Z5T C;  3AZJ A;  3UTA A;  3B6F D;  1BH9 A;  4X23 C;  1U35 C;  4E45 A;  1H3O B;  3W97 D;  5CPJ A;  1F66 B;  5DNM C;  1EQZ B;  5B1M D;  3LEL D;  5B32 A;  4WU8 D;  2BYK A;  3AZK D;  2CV5 C;  3LZ0 D;  2Y2N A;  5BNV A;  1M18 B;  5CP6 A;  3W98 A;  5AY8 C;  1P3I B;  5E5A C;  2J8P A;  3LZ1 B;  3AZJ D;  3UTA D;  3EPK A;  3KSY A;  5B31 B;  3AZN A;  3VH6 T;  1P3F A;  1TZY B;  5AV8 B;  1HQ3 C;  3IP4 C;  1KX5 C;  5CPJ D;  1P34 C;  5B32 D;  3WKJ A;  2F8N H;  5BO0 B;  2YFV A;  4H9N B;  5B0Y B;  3O62 B;  5CP6 D;  2HUE C;  3MGS A;  4ZUX D;  3C1B B;  3FDD A;  5BS7 C;  4J8X B;  5JA4 A;  3AZI C;  3B0C T;  5B0Z A;  3AYW A;  3AZN D;  1P3F D;  3X1S B;  1BFM A;  3KWQ B;  1WWS A;  4QLC A;  2HIO B;  3EPL A;  4J8W C;  1KX4 C;  4XUJ B;  3REK A;  3F6T A;  3WTP B;  3EPJ A;  4G91 C;  5CPK B;  3WKJ D;  1AOI A;  3B6F C;  3AZG A;  4CAY A;  1F66 C;  1EQZ C;  3VH5 T;  3AV2 B;  3MGS D;  3AV1 C;  3V9R B;  5GSU B;  5B1L A;  1M18 C;  4R8P B;  3LEL C;  3AZL C;  3AYW D;  1JFI A;  4YM6 A;  5DNN B;  4AWL B;  2F8N A;  4XZQ B;  4QLC D;  2Y2G A;  4WU9 A;  3REJ A;  3B6G C;  5B31 C;  3REK D;  5B40 B;  1M19 A;  3UTA C;  1AOI D;  1ZLA A;  3AZG D;  1N1J A;  2BYM A;  3MVD A;  4Z5T A;  5AVC A;  5FUG A;  5B1L D;  3LJA B;  3WA9 B;  1Q9C A;  1U35 A;  3C1B C;  4J8X C;  4YM6 D;  2F8N D;  1M1A B;  4WU9 D;  3REJ D;  4ZUX C;  5CPI B;  1M19 D;  3X1T B;  2JSS A;  2CV5 A;  1ZLA D;  3AZN C;  1P3F C;  3EPH A;  4H9R B;  5AY8 A;  3REI B;  4KGC B;  3WTP C;  2IO5 B;  5E5A A;  4H9S C;  3MVD D;  3REL A;  4Z5T D;  5AVC D;  5F99 B;  3X1U B;  1U35 D;  3UT9 B;  5GSU C;  2ZY5 A;  2ZY3 A;  1KX5 A;  5GXQ B;  1P34 A;  4ZBJ B;  2L5A A;  4AWL C;  2JCH A;  2Y2K A;  2CV5 D;  2LY8 A;  5AY8 D;  1KX3 A;  5E5A D;  5BS7 A;  3REL D;  3WAA D;  4DRB A;  3AZI A;  3REK C;  1TAF B;  5B33 B;  5GT3 B;  5B2J B;  3MNN B;  2PYO B;  1KX5 D;  4H9Q A;  3LJA C;  3WA9 C;  5B32 G;  1P34 D;  4NE5 A;  3VH6 A;  3KUY B;  1F66 A;  2RVQ C;  2JE5 A;  1EQZ A;  2NZD B;  2ARO B;  3AV1 A;  1KX3 D;  3AZF C;  5KDM A;  3AZI D;  3REJ C;  1M18 A;  3AZL A;  2Y2H A;  2F8N K;  4KGC C;  3REI C;  3R45 B;  1M19 C;  3VH6 W;  2IO5 C;  3LZ1 A;  3W96 B;  1P3L B;  4G92 B;  3B6G A;  4WV4 B;  3W99 B;  5B31 A;  4JJN B;  4HGA B;  1TZY A;  4Z2M G;  3MVD C;  3MGP B;  5AVC C;  1S32 B;  5CHL B;  1P3K B;  1F66 D;  4UUZ A;  1EQZ D;  3TU4 B;  5GXQ C;  3AV1 D;  5BO0 A;  3AZE C;  4H9N A;  1M18 D;  3AZL D;  3C1B A;  4J8X A;  3LZ1 D;  4NFT A;  3NQJ A;  3VH5 A;  3B6G D;  5B31 D;  4ZUX A;  5AVB B;  3WAA C;  3REL C;  5GT3 C;  1TZY D;  3X1S A;  3KWQ A;  5AV8 D;  3MNN C;  1T3U A;  2PYO C;  2HIO A;  3NQU B;  3WTP A;  3UTB C;  4LD9 B;  4H9S A;  4YS3 B;  3VH5 W;  5CPK A;  4H9P B;  2Y2I A;  2ARO C;  3C1B D;  4J8X D;  3V9R A;  5GSU A;  2F8N G;  3X1V B;  5B2I B;  3H0R C;  1KX3 C;  3X1S D;  3KWQ D;  2ZM5 A;  5DNN A;  5B1M B;  5AV5 C;  4G92 C;  4XZQ A;  2HIO D;  4WU8 B;  4JJN C;  3AZK B;  4WNN B;  5B40 A;  3WTP D;  3LZ0 B;  5CPK D;  1S32 C;  3C1C B;  3H0M C;  3AN2 B;  3REH B;  3AZJ B;  2RIQ A;  2XD5 A;  1BH9 B;  5GSU D;  1P3B B;  3LJA A;  3WA9 A;  5DNN D;  2UWX A;  5G49 B;  4XZQ D;  1M1A A;  1P3I C;  5B40 D;  3LZ1 C;  3W98 B;  5CP6 B;  3AZF A;  2ZY2 A;  4H9R A;  3REI A;  4KGC A;  1TZY C;  5AV8 C;  5C3I B;  1KU5 A;  3LJA D;  1P3A B;  3WA9 D;  5GT0 B;  4KHA B;  5B0Y C;  3O62 C;  1M1A D;  3A6N B;  3WKJ B;  1BH8 B;  2RVQ D;  1P3O B;  5GXQ A;  5CPI D;  4NE3 A;  5AV6 B;  2Y2Q A;  3AZF D;  3AZE A;  5B24 B;  4KGC D;  3REI D;  3X1S C;  2Y2J A;  3KWQ C;  5B0Z B;  2YFW B;  3AYW B;  2HIO C;  2W8S A;  4KUD B;  3AN2 C;  4XUJ C;  3A1K A;  5JRG B;  1TAF A;  1Z2C B;  3WAA A;  5GT3 A;  5CPK C;  3B0D B;  3MNN A;  3MGR B;  2PYO A;  3AV2 C;  3AZG B;  5GXQ D;  4WZS B;  3UTB A;  3AZE D;  4R8P C;  3AZM B;  2NQB B;  2NZD A;  3AFA B;  5B1L B;  2ARO A;  4Z66 B;  5DNN C;  2FJ7 B;  4XZQ C;  1HTA A;  5B31 G;  2Y2P A;  5B33 D;  5B40 C;  1P3M B;  5GT3 D;  5BNX B;  3MNN D;  5AV9 B;  1P3L A;  5AV5 A;  2PYO D;  1P3G B;  1B67 A;  3H0L C;  4JJN A;  1P3A C;  3MGP A;  3UTB D;  1S32 A;  3TU4 A;  1P3O C;  2NZD D;  1H3O A;  2ARO D;  4X23 B;  1U35 B;  1M1A C;  5B24 C;  5CPI C;  3MGQ B;  1ID3 B;  5DNM B;  3X1T C;  3AL0 C;  2BG1 A;  1P3L D;  5AV5 D;  4J8U B;  4KUD C;  2Y2O A;  4JJN D;  5JRG C;  1P3I A;  1P3P B;  3MGP D;  3B0D C;  3MGR C;  1S32 D;  5F99 C;  3X1U C;  3NQU A;  1ULY A;  4J8V B;  5AV8 A;  3TU4 D;  3UT9 C;  4LD9 A;  2F2A C;  2G5H C;  3KXB B;  1HQ3 B;  3AZH B;  1PZR A;  3AFA C;  4ZBJ C;  4Z66 C;  3EG5 B;  3X1V A;  5B2I A;  5B0Y A;  3O62 A;  1P34 B;  3B0C W;  1P3I D;  5AV9 C;  2HUE B;  1P3G C;  5B33 C;  2XD1 A;  3AZI B;  5B2J C;  4WNN A;  4LD9 D;  5BT1 C;  3C1C A;  1B6W A;  3AN2 A;  3REH A;  3WTP E;  4XUJ A;  2VQR A;  4DRA A;  4H9O B;  4J8W B;  4H9Q B;  1R4V A;  1KX4 B;  3X1V D;  5B2I D;  5B0Y D;  3O62 D;  4G91 B;  3KUY C;  1P3B A;  2G5I C;  3AV2 A;  3B6F B;  2NZD C;  3MGQ C;  1ID3 C;  4J8U C;  5G49 A;  4R8P A;  3AV1 B;  3W97 B;  5KDM B;  1P3P C;  2CWE A; 
#chains in the Genus database with same CATH homology
 3AZL B;  3W96 C;  3LEL B;  1P3L C;  3C1C D;  3W99 C;  3AN2 D;  3REH D;  4J8V C;  4XUJ D;  4HGA C;  4CSR B;  3MGP C;  3B6G B;  1P3B D;  1P3K C;  1P3A A;  2DF4 C;  3KXB C;  3UTA B;  3AV2 D;  3TU4 C;  3AZH C;  4WJ3 C;  5GT0 A;  4UUZ B;  4KHA A;  2DQN C;  4R8P D;  3A6N A;  1A7W A;  1BH8 A;  1W2E A;  5CPJ B;  3B0B A;  1P3O A;  5AV6 A;  3W98 D;  3P5J B;  5B32 B;  5B24 A;  2BYK B;  4EO5 B;  5AVB C;  5CPI A;  3NQJ B;  5BNV B;  3X1T A;  2YFW A;  4ZUX B;  4KUD A;  4E44 A;  1P3A D;  5JRG A;  4LD9 C;  5GT0 D;  2ZY4 A;  4YS3 C;  4DQY B;  3AZN B;  1P3F B;  3MGR A;  5F99 A;  2Y2M A;  3X1U A;  3A6N D;  1P3O D;  3UT9 A;  5AV6 D;  3X1V C;  5B2I C;  5B24 D;  3W97 C;  3AZM A;  2NQB A;  2YFV B;  3AFA A;  1F1E A;  3X1T D;  5B1M C;  5B0Z D;  4Z66 A;  2FJ7 A;  3MGS B;  4KUD D;  4WU8 C;  5JRG D;  5JA4 B;  3AZK C;  3LZ0 C;  1P3M A;  3C1C C;  5BNX A;  3MGR D;  5AV9 A;  5F99 D;  3REH C;  3X1U D;  1P3G A;  3AZJ C;  5B33 A;  4QLC B;  5B2J A;  3UT9 D;  3REK B;  1P3B C;  1AOI B;  3AZM D;  2NQB D;  5CPJ C;  4CAY B;  3AFA D;  4Z66 D;  2FJ7 D;  4X23 A;  3KUY A;  5B32 C;  4EO5 C;  3KFU G;  3MGQ A;  1ID3 A;  1P3M D;  3W98 C;  5CP6 C;  5DNM A;  5AV9 D;  1JFI B;  4J8U A;  4YM6 B;  1P3G D;  2F8N B;  3R45 A;  3AZF B;  1P3P A;  4WU9 B;  5B2J D;  3REJ B;  3W96 A;  5BT1 D;  5C3I C;  1M19 B;  3W99 A;  4J8V A;  1ZLA B;  5GT0 C;  1WWI A;  1N1J B;  2BYM B;  3A1I A;  4X23 D;  3KUY D;  3MVD B;  3A6N C;  1P3K A;  4Z5T B;  3WKJ C;  5AVC B;  3KXB A;  1HQ3 A;  5FUG B;  3AZH A;  3MGQ D;  5AV6 C;  1ID3 D;  5DNM D;  3MGS C;  4J8U D;  3AZE B;  1P3P D;  5B0Z C;  3AYW C;  3W96 D;  3W99 D;  4J8V D;  5AVB A;  2CV5 B;  4QLC C;  5AY8 B;  5E5A B;  3REL B;  3WAA B;  1P3K D;  3KXB D;  1AOI C;  1HQ3 D;  4H9O A;  3AZG C;  3AZH D;  4J8W A;  4YS3 A;  4H9P A;  1KX4 A;  3UTB B;  3AZM C;  2FFF B;  2NQB C;  1KX5 B;  3B6F A;  5B1L C;  2FJ7 C;  4NE6 A;  4YM6 C;  3W97 A;  2Y2L A;  5AVB D;  1P3M C;  4WU9 C;  5B1M A;  3LEL A;  4M6B A;  1KX3 B;  4WU8 A;  3AZK A;  4CSR A;  1ZLA C;  3LZ0 A;  5AV5 B;  4J8W D;  4YS3 D;  4Z2M H;  1KX4 D;  4UPK A;  4Z5T C;  3AZJ A;  3UTA A;  3B6F D;  1BH9 A;  4X23 C;  1U35 C;  4E45 A;  1H3O B;  3W97 D;  5CPJ A;  1F66 B;  5DNM C;  1EQZ B;  5B1M D;  3LEL D;  5B32 A;  4WU8 D;  2BYK A;  3AZK D;  2CV5 C;  3LZ0 D;  2Y2N A;  5BNV A;  1M18 B;  5CP6 A;  3W98 A;  5AY8 C;  1P3I B;  5E5A C;  2J8P A;  3LZ1 B;  3AZJ D;  3UTA D;  3EPK A;  3KSY A;  5B31 B;  3AZN A;  3VH6 T;  1P3F A;  1TZY B;  5AV8 B;  1HQ3 C;  3IP4 C;  1KX5 C;  5CPJ D;  1P34 C;  5B32 D;  3WKJ A;  2F8N H;  5BO0 B;  2YFV A;  4H9N B;  5B0Y B;  3O62 B;  5CP6 D;  2HUE C;  3MGS A;  4ZUX D;  3C1B B;  3FDD A;  5BS7 C;  4J8X B;  5JA4 A;  3AZI C;  3B0C T;  5B0Z A;  3AYW A;  3AZN D;  1P3F D;  3X1S B;  1BFM A;  3KWQ B;  1WWS A;  4QLC A;  2HIO B;  3EPL A;  4J8W C;  1KX4 C;  4XUJ B;  3REK A;  3F6T A;  3WTP B;  3EPJ A;  4G91 C;  5CPK B;  3WKJ D;  1AOI A;  3B6F C;  3AZG A;  4CAY A;  1F66 C;  1EQZ C;  3VH5 T;  3AV2 B;  3MGS D;  3AV1 C;  3V9R B;  5GSU B;  5B1L A;  1M18 C;  4R8P B;  3LEL C;  3AZL C;  3AYW D;  1JFI A;  4YM6 A;  5DNN B;  4AWL B;  2F8N A;  4XZQ B;  4QLC D;  2Y2G A;  4WU9 A;  3REJ A;  3B6G C;  5B31 C;  3REK D;  5B40 B;  1M19 A;  3UTA C;  1AOI D;  1ZLA A;  3AZG D;  1N1J A;  2BYM A;  3MVD A;  4Z5T A;  5AVC A;  5FUG A;  5B1L D;  3LJA B;  3WA9 B;  1Q9C A;  1U35 A;  3C1B C;  4J8X C;  4YM6 D;  2F8N D;  1M1A B;  4WU9 D;  3REJ D;  4ZUX C;  5CPI B;  1M19 D;  3X1T B;  2JSS A;  2CV5 A;  1ZLA D;  3AZN C;  1P3F C;  3EPH A;  4H9R B;  5AY8 A;  3REI B;  4KGC B;  3WTP C;  2IO5 B;  5E5A A;  4H9S C;  3MVD D;  3REL A;  4Z5T D;  5AVC D;  5F99 B;  3X1U B;  1U35 D;  3UT9 B;  5GSU C;  2ZY5 A;  2ZY3 A;  1KX5 A;  5GXQ B;  1P34 A;  4ZBJ B;  2L5A A;  4AWL C;  2JCH A;  2Y2K A;  2CV5 D;  2LY8 A;  5AY8 D;  1KX3 A;  5E5A D;  5BS7 A;  3REL D;  3WAA D;  4DRB A;  3AZI A;  3REK C;  1TAF B;  5B33 B;  5GT3 B;  5B2J B;  3MNN B;  2PYO B;  1KX5 D;  4H9Q A;  3LJA C;  3WA9 C;  5B32 G;  1P34 D;  4NE5 A;  3VH6 A;  3KUY B;  1F66 A;  2RVQ C;  2JE5 A;  1EQZ A;  2NZD B;  2ARO B;  3AV1 A;  1KX3 D;  3AZF C;  5KDM A;  3AZI D;  3REJ C;  1M18 A;  3AZL A;  2Y2H A;  2F8N K;  4KGC C;  3REI C;  3R45 B;  1M19 C;  3VH6 W;  2IO5 C;  3LZ1 A;  3W96 B;  1P3L B;  4G92 B;  3B6G A;  4WV4 B;  3W99 B;  5B31 A;  4JJN B;  4HGA B;  1TZY A;  4Z2M G;  3MVD C;  3MGP B;  5AVC C;  1S32 B;  5CHL B;  1P3K B;  1F66 D;  4UUZ A;  1EQZ D;  3TU4 B;  5GXQ C;  3AV1 D;  5BO0 A;  3AZE C;  4H9N A;  1M18 D;  3AZL D;  3C1B A;  4J8X A;  3LZ1 D;  4NFT A;  3NQJ A;  3VH5 A;  3B6G D;  5B31 D;  4ZUX A;  5AVB B;  3WAA C;  3REL C;  5GT3 C;  1TZY D;  3X1S A;  3KWQ A;  5AV8 D;  3MNN C;  1T3U A;  2PYO C;  2HIO A;  3NQU B;  3WTP A;  3UTB C;  4LD9 B;  4H9S A;  4YS3 B;  3VH5 W;  5CPK A;  4H9P B;  2Y2I A;  2ARO C;  3C1B D;  4J8X D;  3V9R A;  5GSU A;  2F8N G;  3X1V B;  5B2I B;  3H0R C;  1KX3 C;  3X1S D;  3KWQ D;  2ZM5 A;  5DNN A;  5B1M B;  5AV5 C;  4G92 C;  4XZQ A;  2HIO D;  4WU8 B;  4JJN C;  3AZK B;  4WNN B;  5B40 A;  3WTP D;  3LZ0 B;  5CPK D;  1S32 C;  3C1C B;  3H0M C;  3AN2 B;  3REH B;  3AZJ B;  2RIQ A;  2XD5 A;  1BH9 B;  5GSU D;  1P3B B;  3LJA A;  3WA9 A;  5DNN D;  2UWX A;  5G49 B;  4XZQ D;  1M1A A;  1P3I C;  5B40 D;  3LZ1 C;  3W98 B;  5CP6 B;  3AZF A;  2ZY2 A;  4H9R A;  3REI A;  4KGC A;  1TZY C;  5AV8 C;  5C3I B;  1KU5 A;  3LJA D;  1P3A B;  3WA9 D;  5GT0 B;  4KHA B;  5B0Y C;  3O62 C;  1M1A D;  3A6N B;  3WKJ B;  1BH8 B;  2RVQ D;  1P3O B;  5GXQ A;  5CPI D;  4NE3 A;  5AV6 B;  2Y2Q A;  3AZF D;  3AZE A;  5B24 B;  4KGC D;  3REI D;  3X1S C;  2Y2J A;  3KWQ C;  5B0Z B;  2YFW B;  3AYW B;  2HIO C;  2W8S A;  4KUD B;  3AN2 C;  4XUJ C;  3A1K A;  5JRG B;  1TAF A;  1Z2C B;  3WAA A;  5GT3 A;  5CPK C;  3B0D B;  3MNN A;  3MGR B;  2PYO A;  3AV2 C;  3AZG B;  5GXQ D;  4WZS B;  3UTB A;  3AZE D;  4R8P C;  3AZM B;  2NQB B;  2NZD A;  3AFA B;  5B1L B;  2ARO A;  4Z66 B;  5DNN C;  2FJ7 B;  4XZQ C;  1HTA A;  5B31 G;  2Y2P A;  5B33 D;  5B40 C;  1P3M B;  5GT3 D;  5BNX B;  3MNN D;  5AV9 B;  1P3L A;  5AV5 A;  2PYO D;  1P3G B;  1B67 A;  3H0L C;  4JJN A;  1P3A C;  3MGP A;  3UTB D;  1S32 A;  3TU4 A;  1P3O C;  2NZD D;  1H3O A;  2ARO D;  4X23 B;  1U35 B;  1M1A C;  5B24 C;  5CPI C;  3MGQ B;  1ID3 B;  5DNM B;  3X1T C;  3AL0 C;  2BG1 A;  1P3L D;  5AV5 D;  4J8U B;  4KUD C;  2Y2O A;  4JJN D;  5JRG C;  1P3I A;  1P3P B;  3MGP D;  3B0D C;  3MGR C;  1S32 D;  5F99 C;  3X1U C;  3NQU A;  1ULY A;  4J8V B;  5AV8 A;  3TU4 D;  3UT9 C;  4LD9 A;  2F2A C;  2G5H C;  3KXB B;  1HQ3 B;  3AZH B;  1PZR A;  3AFA C;  4ZBJ C;  4Z66 C;  3EG5 B;  3X1V A;  5B2I A;  5B0Y A;  3O62 A;  1P34 B;  3B0C W;  1P3I D;  5AV9 C;  2HUE B;  1P3G C;  5B33 C;  2XD1 A;  3AZI B;  5B2J C;  4WNN A;  4LD9 D;  5BT1 C;  3C1C A;  1B6W A;  3AN2 A;  3REH A;  3WTP E;  4XUJ A;  2VQR A;  4DRA A;  4H9O B;  4J8W B;  4H9Q B;  1R4V A;  1KX4 B;  3X1V D;  5B2I D;  5B0Y D;  3O62 D;  4G91 B;  3KUY C;  1P3B A;  2G5I C;  3AV2 A;  3B6F B;  2NZD C;  3MGQ C;  1ID3 C;  4J8U C;  5G49 A;  4R8P A;  3AV1 B;  3W97 B;  5KDM B;  1P3P C;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...