4J8XC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xC00
5AV9C 3KSYA 5AV5B 4Z5TB 3AZLA 4YM6B 1P3AB 5DNND 5B24D 4J8VB 2YFWA 3LZ0C 2BYMB 3WAAD 5GT0B 1U35A 3W97B 5DNMC 3LELB 3C1CB 3AZGB 1ZLAB 4HGAC 1P3KD 5JA4A 3LZ1B 3MGSD 5AVBD 2LY8A 1S32B 4XZQA 3V9RB 3MGQD 4X23D 4Z66A 5BO0A 5AV9D 3B6FD 3LZ1A 3B0BA 3VH6T 3AZJC 1P3GB 3O62C 3VH6W 5B0YA 1WWSA 4ZBJB 4E45A 2NZDB 3KWQB 4AWLB 3WA9B 5CPJB 1P3FB 1AOIA 5DNMD 5GT3C 1TZYC 5B1LD 3WTPE 3LELC 1P3BC 3UT9A 3C1CC 2JSSA 2NQBB 4J8WB 3WA9A 1KX4C 3AZHB 5CP6B 4JJND 1ID3B 2HIOC 4KUDB 1F1EA 3LJAB 1P34C 3X1SB 2FJ7C 4ZUXA 1KX3A 5GSUC 5CPKB 3W96B 3W98C 5B32C 3UTAB 2BYKA 5AY8A 4UUZA 4R8PC 5JRGA 5B1MA 5E5AB 5B0ZA 3WKJB 3REKB 1R4VA 5AV5D 4Z5TD 3AZIA 4YM6D 4XUJA 3REJB 1P3AD 5B40B 1ULYA 4ZBJC 2AROB 5BNXB 3X1VC 1M18B 4J8VD 3KXBB 3WKJA 3B0DC 3REKA 4KGCC 5B31A 5GT0D 5AV6B 3W97D 3UTBA 3LELD 3AZMB 1KX5B 3C1CD 5GXQA 3AZGD 1P3PC 1ZLAD 3A6NA 3KXBA 3AZEA 2NQBC 3AFAC 3MGRB 4J8XA 3B6GB 3TU4B 1BH9B 1P34D 5CPIB 3REHB 4WNNB 2HUEB 5BT1C 4YS3A 3KUYC 1S32D 3MGRA 5CPKC 1P3MA 3AN2B 5AV8B 3AYWB 2YFVB 1M1AA 3AZNA 3AV1A 1P3GD 1B6WA 5E5AC 3RELC 1TAFA 4DRAA 4EO5B 4LD9A 1HQ3A 1P3LA 5B2JB 3REJC 5B2IB 2NZDD 1EQZA 3KWQD 4G92B 1M18C 3AV2A 3AZKA 5CPJD 1P3FD 1F66A 3NQUA 1B67A 3WA9D 5AV6C 5AVCA 5B24C 1H3OA 2NQBD 4J8WD 3MGPA 5F99B 3AZHD 5CP6D 1ID3D 4KUDD 4QLCA 3LJAD 3MVDB 3X1SD 2PYOC 1N1JB 3REIB 3W96D 5CPKD 2F8NB 1M19B 3W99B 3C1BB 3UTAD 3X1UA 5AVBC 4CAYA 5E5AD 4X23C 3AZLB 2CV5A 1M19A 3W99A 5B33A 3REJD 3B6FC 5B40D 5C3IB 5B2JC 2AROD 2YFWB 2F8NG 1M18D 1U35B 3MNNA 4G92C 5AV6D 3LZ0A 4Z2MG 3AZMD 1KX5D 3AZFA 5JA4B 4H9NA 1P3IA 3B6GD 4WU8A 5B1LC 3TU4D 5CPID 2PYOD 1P3OC 3REHD 3VH6A 4XZQB 4Z66B 4E44A 4JJNC 5BO0B 5KDMA 3AN2D 5AV8D 3AYWD 1JFIA 5B0YB 3AZJA 3O62A 5B2JD 5C3IC 5B2ID 1AOIB 5AV5C 4Z5TC 4YM6C 1P3AC 3UT9B 5GT3A 1TZYA 4J8VC 4NE3A 1P3BA 5GT0C 3W97C 5F99D 1P3OD 1KX4A 4ZUXB 3AZGC 1ZLAC 3MVDD 1KX3B 2HIOA 3REID 3WTPA 4H9OA 2FJ7A 2F8ND 1M19D 5GSUA 3C1BD 2BYKB 5AY8B 4UUZB 3W98A 4G91B 5JRGB 3LZ1C 5B1MB 5B32A 5B0ZB 1S32C 4R8PA 3AZIB 5B0YC 3AZLD 4XUJB 1P3GC 5FUGB 5B31B 1U35D 4WZSB 3X1TB 3X1VA 3UTBB 5GXQB 4KGCA 1BH8A 3A6NB 2NZDC 3AZEB 3KWQC 4H9SA 5FUGA 4J8XB 4AWLC 5CPJC 3X1TA 1P3FC 1P3PA 3WA9C 4H9PA 3AFAA 4YS3B 5B31G 4ZUXC 4XZQD 4J8UB 4J8WC 1P3MB 3AZHC 4Z66D 5CP6C 1M1AB 1ID3C 4KUDC 3KUYA 3LJAC 3AZNB 3X1SC 3AV1B 3R45A 3LZ1D 5AY8C 5JRGC 5B1MC 3W96C 4J8UA 1TAFB 5B0YD 4LD9B 1HQ3B 1P3LB 3RELA 3UTAC 1EQZB 4WU9B 5G49A 3AZKB 3AV2B 1AOID 1F66B 3NQUB 3WKJC 3REKC 5B31C 5AVCB 3UTBC 5B40C 3UT9D 2AROC 4KHAA 1H3OB 5DNNA 4WU9A 3KXBC 5BS7C 5B24A 3MGPB 3VH5W 1P3KB 4J8XC 4QLCB 3WAAA 3AZMC 1KX5C 4ZUXD 1KX3D 1P3KA 3MGRC 3B6GC 3TU4C 5BNVA 5CPIC 5AY8D 3X1UB 4CAYB 3REHC 5JRGD 4H9QA 2HUEC 3AV1C 5B1MD 5AV9B 5B0ZD 2CV5B 3MGSA 5AVBA 3AZID 3AN2C 4XUJD 5B33B 5AV8C 3AYWC 4LD9C 3MGQA 1HQ3C 4X23A 5AV9A 3B6FA 2L5AA 1EQZC 3WKJD 3MNNB 3REKD 5B31D 3AV2C 3LZ0B 4EO5C 3UTBD 3NQJA 2F8NH 4NFTA 5GXQD 3AZFB 5DNMB 5B2IC 3A6ND 4M6BA 3KXBD 3AZED 4H9NB 4HGAB 1P3IB 2F8NK 4J8XD 4Z2MH 4WU8B 1BFMA 4CSRA 4QLCC 5DNMA 4YS3D 5B1LA 3MGRD 4J8UD 5KDMB 1P3MD 5F99C 1M1AD 5CHLB 3AZND 4JJNA 3MVDC 3AV1D 1JFIB 3REIC 3AZJB 2CV5C 1KU5A 3W99C 1M19C 3O62B 4LD9D 3C1BC 1HQ3D 1P3LD 5B33C 4H9RA 1Q9CA 1EQZD 4WU9D 3AV2D 3AZKD 3AZLC 1F66D 3MNNC 4NE6A 5AVCD 5AV5A 4Z5TA 5GT3B 1TZYB 4YM6A 1P3AA 3AZFC 1P3BB 1U35C 3MGPD 1P3IC 4J8VA 4WU8C 1KX4B 4QLCD 2BYMA 5GT0A 2HIOB 3W97A 1P34B 3LELA 3WTPB 4H9OB 2FJ7B 3C1CA 3AZGA 1ZLAA 5GSUB 3W98B 3X1UD 5B32B 1P34A 4XZQC 4R8PB 2CV5D 3W99D 4Z66C 3B0CT 5B33D 2IO5B 1S32A 3V9RA 3B0CW 3MNND 3X1VB 1P3GA 3LZ0D 3B0DB 5B32G 4KGCB 1BH8B 1HTAA 3AZFD 1P3PB 1AOIC 1P3ID 4WU8D 2NZDA 3KWQA 4H9PB 3AFAB 5CPJA 1P3FA 3UT9C 3WTPC 3KUYB 2NQBA 4J8WA 3R45B 3AZHA 5CP6A 1KX3C 2RVQC 1ID3A 4KUDA 3LJAA 3X1SA 3AZJD 3O62D 3W96A 3RELB 5CPKA 2IO5C 4G91C 3VH5A 1A7WA 5G49B 5B0ZC 3UTAA 3AZIC 4XUJC 5E5AA 4DRBA 4KHAB 5GT3D 1TZYD 5DNNB 3REJA 5B40A 5B24B 4H9SC 1P3BD 2AROA 3X1TC 5BNXA 1M18A 3WAAB 5BS7A 1KX4D 5GXQC 4NE5A 2HIOD 3VH5T 5AV6A 3A6NC 3AZEC 3WTPD 3AZMA 1KX5A 2FJ7D 2PYOB 5BNVB 5GSUD 3W98D 3B6GA 2RVQD 4H9QB 4YS3C 3TU4A 1BH9A 5B32D 5CPIA 2PYOA 4J8UC 3MGSB 5AVBB 4R8PD 3REHA 4WNNA 1P3MC 1M1AC 3MGQB 2CWEA 4X23B 3AZNC 3AN2A 5AV8A 3AYWA 2YFVA 3B6FB 3X1VD 3NQJB 1P3LC 4KGCD 5DNNC 5B2JA 4WU9C 3AZKC 1P3PD 3X1TD 1F66C 5B2IA 5AVCC 4CSRB 3WAAC 3AFAD 4WV4B 5B1LB 1P3OB 3MGPC 5BT1D 1P3KC 3KUYD 4JJNB 5F99A 1WWIA 1P3OA 3MVDA 1N1JA 3MGSC 3REIA 4H9RB 3MGQC 3RELD 3X1UC 2F8NA 3C1BA
chains in the Genus database with same CATH superfamily
5AV9C 3KSYA 5AV5B 4Z5TB 3AZLA 2ZY3A 4YM6B 1P3AB 5DNND 5B24D 4J8VB 2YFWA 3LZ0C 2BYMB 3WAAD 5GT0B 1U35A 3W97B 5DNMC 3LELB 3C1CB 3AZGB 1ZLAB 4HGAC 1P3KD 5JA4A 3LZ1B 3MGSD 5AVBD 2LY8A 1S32B 4XZQA 3V9RB 3MGQD 3P5JB 4X23D 4Z66A 2W8SA 5BO0A 5AV9D 3B6FD 3LZ1A 3B0BA 3VH6T 3AZJC 1P3GB 3O62C 3VH6W 5B0YA 1WWSA 2Y2GA 4ZBJB 4E45A 2NZDB 3KWQB 1W2EA 4AWLB 3WA9B 5CPJB 1P3FB 1AOIA 5DNMD 5GT3C 1TZYC 5B1LD 3WTPE 3LELC 1P3BC 3UT9A 3C1CC 2JSSA 2NQBB 4J8WB 3WA9A 1KX4C 3AZHB 5CP6B 4JJND 1ID3B 2HIOC 4KUDB 1F1EA 3LJAB 1P34C 3X1SB 2FJ7C 4ZUXA 1KX3A 5GSUC 5CPKB 3W96B 3W98C 2Y2QA 5B32C 3UTAB 2BYKA 5AY8A 4UUZA 4R8PC 5JRGA 5B1MA 5E5AB 5B0ZA 3WKJB 3REKB 1R4VA 5AV5D 4Z5TD 3AZIA 4YM6D 4XUJA 3REJB 1P3AD 5B40B 1ULYA 4ZBJC 2AROB 5BNXB 3X1VC 1M18B 4J8VD 3KXBB 3WKJA 3B0DC 3REKA 4KGCC 5B31A 5GT0D 5AV6B 3W97D 3UTBA 3LELD 3AZMB 1KX5B 1T3UA 3C1CD 5GXQA 3AZGD 1P3PC 1ZLAD 2Y2PA 3A6NA 3KXBA 3AZEA 2NQBC 3AFAC 3MGRB 4J8XA 3B6GB 3TU4B 1BH9B 1P34D 5CPIB 3REHB 4WNNB 2HUEB 5BT1C 4YS3A 3KUYC 4WJ3C 1S32D 3MGRA 5CPKC 1P3MA 2BG1A 3AN2B 5AV8B 3AYWB 2YFVB 1M1AA 3AZNA 3AV1A 1P3GD 3FDDA 1B6WA 5E5AC 3RELC 1TAFA 4DRAA 4EO5B 4LD9A 1HQ3A 1P3LA 5B2JB 3REJC 5B2IB 2NZDD 1EQZA 3KWQD 4G92B 1M18C 3AV2A 3AZKA 5CPJD 1P3FD 1F66A 3NQUA 1B67A 3WA9D 2DF4C 5AV6C 5AVCA 5B24C 1H3OA 2NQBD 4J8WD 3MGPA 2Y2JA 5F99B 3AZHD 5CP6D 1ID3D 4KUDD 4DQYB 4QLCA 3LJAD 3MVDB 3X1SD 2PYOC 3A1IA 1N1JB 3REIB 2Y2HA 3W96D 5CPKD 2F8NB 1M19B 3W99B 3C1BB 3UTAD 3X1UA 5AVBC 4CAYA 5E5AD 4X23C 3AZLB 2CV5A 1M19A 3W99A 5B33A 3REJD 3B6FC 5B40D 5C3IB 2Y2KA 5B2JC 2AROD 2YFWB 2F8NG 1M18D 2ZY4A 1U35B 3MNNA 4G92C 5AV6D 3LZ0A 4Z2MG 3AZMD 1KX5D 3AZFA 5JA4B 4H9NA 1P3IA 3B6GD 4WU8A 2XD5A 5B1LC 3TU4D 5CPID 2PYOD 1P3OC 3REHD 3VH6A 3H0RC 4XZQB 4Z66B 4E44A 4JJNC 5BO0B 5KDMA 3AN2D 5AV8D 3AYWD 2Y2NA 1JFIA 5B0YB 3AZJA 3O62A 5B2JD 5C3IC 5B2ID 2UWXA 1AOIB 5AV5C 4Z5TC 4YM6C 1P3AC 3UT9B 1Z2CB 5GT3A 1TZYA 4J8VC 4NE3A 1P3BA 5GT0C 3W97C 2G5HC 5F99D 1P3OD 1KX4A 4ZUXB 3AZGC 1ZLAC 3MVDD 2XD1A 1KX3B 2HIOA 3REID 3WTPA 4H9OA 2FJ7A 2F8ND 2DQNC 1M19D 5GSUA 3C1BD 2BYKB 5AY8B 4UUZB 3W98A 4G91B 5JRGB 3LZ1C 5B1MB 5B32A 5B0ZB 1S32C 4R8PA 3AZIB 5B0YC 3AZLD 4XUJB 2RIQA 1P3GC 5FUGB 5B31B 1U35D 4WZSB 3X1TB 3X1VA 3UTBB 5GXQB 4KGCA 1BH8A 3A6NB 2NZDC 3AZEB 3KWQC 4H9SA 5FUGA 4J8XB 4AWLC 5CPJC 3X1TA 1P3FC 1P3PA 3WA9C 4H9PA 3AFAA 4YS3B 5B31G 4ZUXC 2J8PA 3AL0C 4XZQD 4J8UB 4J8WC 1P3MB 3AZHC 4Z66D 5CP6C 1M1AB 1ID3C 4KUDC 1PZRA 3KUYA 3LJAC 3AZNB 3EPJA 3X1SC 3AV1B 3R45A 3LZ1D 5AY8C 5JRGC 5B1MC 3W96C 4J8UA 1TAFB 5B0YD 3A1KA 4LD9B 1HQ3B 1P3LB 3RELA 3UTAC 1EQZB 4WU9B 5G49A 3AZKB 3AV2B 1AOID 1F66B 3NQUB 3WKJC 3REKC 5B31C 5AVCB 3EPKA 3UTBC 5B40C 3UT9D 2AROC 4KHAA 1H3OB 5DNNA 4WU9A 3KXBC 5BS7C 5B24A 3MGPB 3VH5W 1P3KB 4J8XC 3EPLA 4QLCB 3WAAA 3AZMC 1KX5C 4ZUXD 1KX3D 1P3KA 3MGRC 3B6GC 3TU4C 5BNVA 5CPIC 5AY8D 3X1UB 4CAYB 3REHC 5JRGD 4H9QA 2HUEC 3AV1C 5B1MD 5AV9B 5B0ZD 2CV5B 3MGSA 5AVBA 3AZID 3AN2C 5AV8C 4XUJD 5B33B 3AYWC 4LD9C 3MGQA 1HQ3C 4X23A 5AV9A 3B6FA 2L5AA 1EQZC 3WKJD 3MNNB 3REKD 5B31D 3AV2C 3LZ0B 4EO5C 3UTBD 3NQJA 2F8NH 4NFTA 5GXQD 3AZFB 5DNMB 5B2IC 3A6ND 4M6BA 3KXBD 3AZED 4H9NB 4HGAB 1P3IB 2F8NK 4J8XD 4Z2MH 4WU8B 1BFMA 2F2AC 4CSRA 4QLCC 5DNMA 4YS3D 5B1LA 3MGRD 4J8UD 5KDMB 1P3MD 5F99C 1M1AD 5CHLB 3AZND 4JJNA 3MVDC 3AV1D 1JFIB 3REIC 3AZJB 2CV5C 2ZY2A 1KU5A 3W99C 1M19C 3O62B 4LD9D 3C1BC 1HQ3D 1P3LD 5B33C 4H9RA 1Q9CA 2ZY5A 1EQZD 4WU9D 3AV2D 3AZKD 3AZLC 1F66D 3MNNC 4NE6A 5AVCD 5AV5A 4Z5TA 5GT3B 1TZYB 4YM6A 1P3AA 3AZFC 1P3BB 1U35C 3H0LC 3MGPD 1P3IC 4J8VA 4WU8C 1KX4B 4QLCD 2BYMA 2FFFB 5GT0A 2HIOB 3W97A 1P34B 3LELA 3WTPB 4H9OB 2FJ7B 3C1CA 3AZGA 1ZLAA 5GSUB 3W98B 2Y2MA 3X1UD 5B32B 1P34A 4XZQC 4R8PB 2CV5D 3W99D 4Z66C 3B0CT 3EG5B 2IO5B 5B33D 3V9RA 1S32A 2JE5A 3B0CW 2Y2LA 3MNND 3X1VB 4UPKA 1P3GA 3LZ0D 3B0DB 5B32G 4KGCB 1BH8B 1HTAA 3AZFD 2JCHA 1P3PB 1AOIC 1P3ID 4WU8D 2NZDA 3KWQA 4H9PB 3AFAB 5CPJA 1P3FA 3UT9C 3WTPC 3KUYB 2NQBA 4J8WA 3R45B 3AZHA 5CP6A 1KX3C 2RVQC 1ID3A 4KUDA 3LJAA 3X1SA 3IP4C 3AZJD 3O62D 3W96A 3RELB 5CPKA 2IO5C 4G91C 3VH5A 1A7WA 5G49B 5B0ZC 3UTAA 3AZIC 4XUJC 5E5AA 4DRBA 2VQRA 4KHAB 5GT3D 1TZYD 5DNNB 3REJA 5B40A 5B24B 4H9SC 1P3BD 2AROA 3X1TC 5BNXA 1M18A 3WAAB 3KFUG 5BS7A 1KX4D 5GXQC 4NE5A 2HIOD 2Y2OA 3VH5T 5AV6A 3A6NC 3AZEC 2Y2IA 3WTPD 3AZMA 1KX5A 2FJ7D 2PYOB 5BNVB 5GSUD 3F6TA 3W98D 3B6GA 2RVQD 4H9QB 4YS3C 3TU4A 2ZM5A 1BH9A 5B32D 5CPIA 2PYOA 4J8UC 3MGSB 5AVBB 4R8PD 3REHA 4WNNA 1P3MC 1M1AC 3MGQB 2CWEA 4X23B 3AZNC 2G5IC 3AN2A 5AV8A 3AYWA 2YFVA 3B6FB 3X1VD 3NQJB 1P3LC 4KGCD 5DNNC 5B2JA 4WU9C 3AZKC 1P3PD 3X1TD 1F66C 3H0MC 5B2IA 5AVCC 4CSRB 3WAAC 3AFAD 4WV4B 5B1LB 1P3OB 3MGPC 3EPHA 5BT1D 1P3KC 3KUYD 4JJNB 5F99A 1WWIA 1P3OA 3MVDA 1N1JA 3MGSC 3REIA 4H9RB 3MGQC 3RELD 3X1UC 2F8NA 3C1BA
chains in the Genus database with same CATH topology
5AV9C 3KSYA 5AV5B 4Z5TB 3AZLA 2ZY3A 4YM6B 1P3AB 5DNND 5B24D 4J8VB 2YFWA 3LZ0C 2BYMB 3WAAD 5GT0B 1U35A 3W97B 5DNMC 3LELB 3C1CB 3AZGB 1ZLAB 4HGAC 1P3KD 5JA4A 3LZ1B 3MGSD 5AVBD 2LY8A 1S32B 4XZQA 3V9RB 3MGQD 3P5JB 4X23D 4Z66A 2W8SA 5BO0A 5AV9D 3B6FD 3LZ1A 3B0BA 3VH6T 3AZJC 1P3GB 3O62C 3VH6W 5B0YA 1WWSA 2Y2GA 4ZBJB 4E45A 2NZDB 3KWQB 1W2EA 4AWLB 3WA9B 5CPJB 1P3FB 1AOIA 5DNMD 5GT3C 1TZYC 5B1LD 3WTPE 3LELC 1P3BC 3UT9A 3C1CC 2JSSA 2NQBB 4J8WB 3WA9A 1KX4C 3AZHB 5CP6B 4JJND 1ID3B 2HIOC 4KUDB 1F1EA 3LJAB 1P34C 3X1SB 2FJ7C 4ZUXA 1KX3A 5GSUC 5CPKB 3W96B 3W98C 2Y2QA 5B32C 3UTAB 2BYKA 5AY8A 4UUZA 4R8PC 5JRGA 5B1MA 5E5AB 5B0ZA 3WKJB 3REKB 1R4VA 5AV5D 4Z5TD 3AZIA 4YM6D 4XUJA 3REJB 1P3AD 5B40B 1ULYA 4ZBJC 2AROB 5BNXB 3X1VC 1M18B 4J8VD 3KXBB 3WKJA 3B0DC 3REKA 4KGCC 5B31A 5GT0D 5AV6B 3W97D 3UTBA 3LELD 3AZMB 1KX5B 1T3UA 3C1CD 5GXQA 3AZGD 1P3PC 1ZLAD 2Y2PA 3A6NA 3KXBA 3AZEA 2NQBC 3AFAC 3MGRB 4J8XA 3B6GB 3TU4B 1BH9B 1P34D 5CPIB 3REHB 4WNNB 2HUEB 5BT1C 4YS3A 3KUYC 4WJ3C 1S32D 3MGRA 5CPKC 1P3MA 2BG1A 3AN2B 5AV8B 3AYWB 2YFVB 1M1AA 3AZNA 3AV1A 1P3GD 3FDDA 1B6WA 5E5AC 3RELC 1TAFA 4DRAA 4EO5B 4LD9A 1HQ3A 1P3LA 5B2JB 3REJC 5B2IB 2NZDD 1EQZA 3KWQD 4G92B 1M18C 3AV2A 3AZKA 5CPJD 1P3FD 1F66A 3NQUA 1B67A 3WA9D 2DF4C 5AV6C 5AVCA 5B24C 1H3OA 2NQBD 4J8WD 3MGPA 2Y2JA 5F99B 3AZHD 5CP6D 1ID3D 4KUDD 4DQYB 4QLCA 3LJAD 3MVDB 3X1SD 2PYOC 3A1IA 1N1JB 3REIB 2Y2HA 3W96D 5CPKD 2F8NB 1M19B 3W99B 3C1BB 3UTAD 3X1UA 5AVBC 4CAYA 5E5AD 4X23C 3AZLB 2CV5A 1M19A 3W99A 5B33A 3REJD 3B6FC 5B40D 5C3IB 2Y2KA 5B2JC 2AROD 2YFWB 2F8NG 1M18D 2ZY4A 1U35B 3MNNA 4G92C 5AV6D 3LZ0A 4Z2MG 3AZMD 1KX5D 3AZFA 5JA4B 4H9NA 1P3IA 3B6GD 4WU8A 2XD5A 5B1LC 3TU4D 5CPID 2PYOD 1P3OC 3REHD 3VH6A 3H0RC 4XZQB 4Z66B 4E44A 4JJNC 5BO0B 5KDMA 3AN2D 5AV8D 3AYWD 2Y2NA 1JFIA 5B0YB 3AZJA 3O62A 5B2JD 5C3IC 5B2ID 2UWXA 1AOIB 5AV5C 4Z5TC 4YM6C 1P3AC 3UT9B 1Z2CB 5GT3A 1TZYA 4J8VC 4NE3A 1P3BA 5GT0C 3W97C 2G5HC 5F99D 1P3OD 1KX4A 4ZUXB 3AZGC 1ZLAC 3MVDD 2XD1A 1KX3B 2HIOA 3REID 3WTPA 4H9OA 2FJ7A 2F8ND 2DQNC 1M19D 5GSUA 3C1BD 2BYKB 5AY8B 4UUZB 3W98A 4G91B 5JRGB 3LZ1C 5B1MB 5B32A 5B0ZB 1S32C 4R8PA 3AZIB 5B0YC 3AZLD 4XUJB 2RIQA 1P3GC 5FUGB 5B31B 1U35D 4WZSB 3X1TB 3X1VA 3UTBB 5GXQB 4KGCA 1BH8A 3A6NB 2NZDC 3AZEB 3KWQC 4H9SA 5FUGA 4J8XB 4AWLC 5CPJC 3X1TA 1P3FC 1P3PA 3WA9C 4H9PA 3AFAA 4YS3B 5B31G 4ZUXC 2J8PA 3AL0C 4XZQD 4J8UB 4J8WC 1P3MB 3AZHC 4Z66D 5CP6C 1M1AB 1ID3C 4KUDC 1PZRA 3KUYA 3LJAC 3AZNB 3EPJA 3X1SC 3AV1B 3R45A 3LZ1D 5AY8C 5JRGC 5B1MC 3W96C 4J8UA 1TAFB 5B0YD 3A1KA 4LD9B 1HQ3B 1P3LB 3RELA 3UTAC 1EQZB 4WU9B 5G49A 3AZKB 3AV2B 1AOID 1F66B 3NQUB 3WKJC 3REKC 5B31C 5AVCB 3EPKA 3UTBC 5B40C 3UT9D 2AROC 4KHAA 1H3OB 5DNNA 4WU9A 3KXBC 5BS7C 5B24A 3MGPB 3VH5W 1P3KB 4J8XC 3EPLA 4QLCB 3WAAA 3AZMC 1KX5C 4ZUXD 1KX3D 1P3KA 3MGRC 3B6GC 3TU4C 5BNVA 5CPIC 5AY8D 3X1UB 4CAYB 3REHC 5JRGD 4H9QA 2HUEC 3AV1C 5B1MD 5AV9B 5B0ZD 2CV5B 3MGSA 5AVBA 3AZID 3AN2C 5AV8C 4XUJD 5B33B 3AYWC 4LD9C 3MGQA 1HQ3C 4X23A 5AV9A 3B6FA 2L5AA 1EQZC 3WKJD 3MNNB 3REKD 5B31D 3AV2C 3LZ0B 4EO5C 3UTBD 3NQJA 2F8NH 4NFTA 5GXQD 3AZFB 5DNMB 5B2IC 3A6ND 4M6BA 3KXBD 3AZED 4H9NB 4HGAB 1P3IB 2F8NK 4J8XD 4Z2MH 4WU8B 1BFMA 2F2AC 4CSRA 4QLCC 5DNMA 4YS3D 5B1LA 3MGRD 4J8UD 5KDMB 1P3MD 5F99C 1M1AD 5CHLB 3AZND 4JJNA 3MVDC 3AV1D 1JFIB 3REIC 3AZJB 2CV5C 2ZY2A 1KU5A 3W99C 1M19C 3O62B 4LD9D 3C1BC 1HQ3D 1P3LD 5B33C 4H9RA 1Q9CA 2ZY5A 1EQZD 4WU9D 3AV2D 3AZKD 3AZLC 1F66D 3MNNC 4NE6A 5AVCD 5AV5A 4Z5TA 5GT3B 1TZYB 4YM6A 1P3AA 3AZFC 1P3BB 1U35C 3H0LC 3MGPD 1P3IC 4J8VA 4WU8C 1KX4B 4QLCD 2BYMA 2FFFB 5GT0A 2HIOB 3W97A 1P34B 3LELA 3WTPB 4H9OB 2FJ7B 3C1CA 3AZGA 1ZLAA 5GSUB 3W98B 2Y2MA 3X1UD 5B32B 1P34A 4XZQC 4R8PB 2CV5D 3W99D 4Z66C 3B0CT 3EG5B 2IO5B 5B33D 3V9RA 1S32A 2JE5A 3B0CW 2Y2LA 3MNND 3X1VB 4UPKA 1P3GA 3LZ0D 3B0DB 5B32G 4KGCB 1BH8B 1HTAA 3AZFD 2JCHA 1P3PB 1AOIC 1P3ID 4WU8D 2NZDA 3KWQA 4H9PB 3AFAB 5CPJA 1P3FA 3UT9C 3WTPC 3KUYB 2NQBA 4J8WA 3R45B 3AZHA 5CP6A 1KX3C 2RVQC 1ID3A 4KUDA 3LJAA 3X1SA 3IP4C 3AZJD 3O62D 3W96A 3RELB 5CPKA 2IO5C 4G91C 3VH5A 1A7WA 5G49B 5B0ZC 3UTAA 3AZIC 4XUJC 5E5AA 4DRBA 2VQRA 4KHAB 5GT3D 1TZYD 5DNNB 3REJA 5B40A 5B24B 4H9SC 1P3BD 2AROA 3X1TC 5BNXA 1M18A 3WAAB 3KFUG 5BS7A 1KX4D 5GXQC 4NE5A 2HIOD 2Y2OA 3VH5T 5AV6A 3A6NC 3AZEC 2Y2IA 3WTPD 3AZMA 1KX5A 2FJ7D 2PYOB 5BNVB 5GSUD 3F6TA 3W98D 3B6GA 2RVQD 4H9QB 4YS3C 3TU4A 2ZM5A 1BH9A 5B32D 5CPIA 2PYOA 4J8UC 3MGSB 5AVBB 4R8PD 3REHA 4WNNA 1P3MC 1M1AC 3MGQB 2CWEA 4X23B 3AZNC 2G5IC 3AN2A 5AV8A 3AYWA 2YFVA 3B6FB 3X1VD 3NQJB 1P3LC 4KGCD 5DNNC 5B2JA 4WU9C 3AZKC 1P3PD 3X1TD 1F66C 3H0MC 5B2IA 5AVCC 4CSRB 3WAAC 3AFAD 4WV4B 5B1LB 1P3OB 3MGPC 3EPHA 5BT1D 1P3KC 3KUYD 4JJNB 5F99A 1WWIA 1P3OA 3MVDA 1N1JA 3MGSC 3REIA 4H9RB 3MGQC 3RELD 3X1UC 2F8NA 3C1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 C;  3KSY A;  5AV5 B;  4Z5T B;  3AZL A;  4YM6 B;  1P3A B;  5DNN D;  5B24 D;  4J8V B;  2YFW A;  3LZ0 C;  2BYM B;  3WAA D;  5GT0 B;  1U35 A;  3W97 B;  5DNM C;  3LEL B;  3C1C B;  3AZG B;  1ZLA B;  4HGA C;  1P3K D;  5JA4 A;  3LZ1 B;  3MGS D;  5AVB D;  2LY8 A;  1S32 B;  4XZQ A;  3V9R B;  3MGQ D;  4X23 D;  4Z66 A;  5BO0 A;  5AV9 D;  3B6F D;  3LZ1 A;  3B0B A;  3VH6 T;  3AZJ C;  1P3G B;  3O62 C;  3VH6 W;  5B0Y A;  1WWS A;  4ZBJ B;  4E45 A;  2NZD B;  3KWQ B;  4AWL B;  3WA9 B;  5CPJ B;  1P3F B;  1AOI A;  5DNM D;  5GT3 C;  1TZY C;  5B1L D;  3WTP E;  3LEL C;  1P3B C;  3UT9 A;  3C1C C;  2JSS A;  2NQB B;  4J8W B;  3WA9 A;  1KX4 C;  3AZH B;  5CP6 B;  4JJN D;  1ID3 B;  2HIO C;  4KUD B;  1F1E A;  3LJA B;  1P34 C;  3X1S B;  2FJ7 C;  4ZUX A;  1KX3 A;  5GSU C;  5CPK B;  3W96 B;  3W98 C;  5B32 C;  3UTA B;  2BYK A;  5AY8 A;  4UUZ A;  4R8P C;  5JRG A;  5B1M A;  5E5A B;  5B0Z A;  3WKJ B;  3REK B;  1R4V A;  5AV5 D;  4Z5T D;  3AZI A;  4YM6 D;  4XUJ A;  3REJ B;  1P3A D;  5B40 B;  1ULY A;  4ZBJ C;  2ARO B;  5BNX B;  3X1V C;  1M18 B;  4J8V D;  3KXB B;  3WKJ A;  3B0D C;  3REK A;  4KGC C;  5B31 A;  5GT0 D;  5AV6 B;  3W97 D;  3UTB A;  3LEL D;  3AZM B;  1KX5 B;  3C1C D;  5GXQ A;  3AZG D;  1P3P C;  1ZLA D;  3A6N A;  3KXB A;  3AZE A;  2NQB C;  3AFA C;  3MGR B;  4J8X A;  3B6G B;  3TU4 B;  1BH9 B;  1P34 D;  5CPI B;  3REH B;  4WNN B;  2HUE B;  5BT1 C;  4YS3 A;  3KUY C;  1S32 D;  3MGR A;  5CPK C;  1P3M A;  3AN2 B;  5AV8 B;  3AYW B;  2YFV B;  1M1A A;  3AZN A;  3AV1 A;  1P3G D;  1B6W A;  5E5A C;  3REL C;  1TAF A;  4DRA A;  4EO5 B;  4LD9 A;  1HQ3 A;  1P3L A;  5B2J B;  3REJ C;  5B2I B;  2NZD D;  1EQZ A;  3KWQ D;  4G92 B;  1M18 C;  3AV2 A;  3AZK A;  5CPJ D;  1P3F D;  1F66 A;  3NQU A;  1B67 A;  3WA9 D;  5AV6 C;  5AVC A;  5B24 C;  1H3O A;  2NQB D;  4J8W D;  3MGP A;  5F99 B;  3AZH D;  5CP6 D;  1ID3 D;  4KUD D;  4QLC A;  3LJA D;  3MVD B;  3X1S D;  2PYO C;  1N1J B;  3REI B;  3W96 D;  5CPK D;  2F8N B;  1M19 B;  3W99 B;  3C1B B;  3UTA D;  3X1U A;  5AVB C;  4CAY A;  5E5A D;  4X23 C;  3AZL B;  2CV5 A;  1M19 A;  3W99 A;  5B33 A;  3REJ D;  3B6F C;  5B40 D;  5C3I B;  5B2J C;  2ARO D;  2YFW B;  2F8N G;  1M18 D;  1U35 B;  3MNN A;  4G92 C;  5AV6 D;  3LZ0 A;  4Z2M G;  3AZM D;  1KX5 D;  3AZF A;  5JA4 B;  4H9N A;  1P3I A;  3B6G D;  4WU8 A;  5B1L C;  3TU4 D;  5CPI D;  2PYO D;  1P3O C;  3REH D;  3VH6 A;  4XZQ B;  4Z66 B;  4E44 A;  4JJN C;  5BO0 B;  5KDM A;  3AN2 D;  5AV8 D;  3AYW D;  1JFI A;  5B0Y B;  3AZJ A;  3O62 A;  5B2J D;  5C3I C;  5B2I D;  1AOI B;  5AV5 C;  4Z5T C;  4YM6 C;  1P3A C;  3UT9 B;  5GT3 A;  1TZY A;  4J8V C;  4NE3 A;  1P3B A;  5GT0 C;  3W97 C;  5F99 D;  1P3O D;  1KX4 A;  4ZUX B;  3AZG C;  1ZLA C;  3MVD D;  1KX3 B;  2HIO A;  3REI D;  3WTP A;  4H9O A;  2FJ7 A;  2F8N D;  1M19 D;  5GSU A;  3C1B D;  2BYK B;  5AY8 B;  4UUZ B;  3W98 A;  4G91 B;  5JRG B;  3LZ1 C;  5B1M B;  5B32 A;  5B0Z B;  1S32 C;  4R8P A;  3AZI B;  5B0Y C;  3AZL D;  4XUJ B;  1P3G C;  5FUG B;  5B31 B;  1U35 D;  4WZS B;  3X1T B;  3X1V A;  3UTB B;  5GXQ B;  4KGC A;  1BH8 A;  3A6N B;  2NZD C;  3AZE B;  3KWQ C;  4H9S A;  5FUG A;  4J8X B;  4AWL C;  5CPJ C;  3X1T A;  1P3F C;  1P3P A;  3WA9 C;  4H9P A;  3AFA A;  4YS3 B;  5B31 G;  4ZUX C;  4XZQ D;  4J8U B;  4J8W C;  1P3M B;  3AZH C;  4Z66 D;  5CP6 C;  1M1A B;  1ID3 C;  4KUD C;  3KUY A;  3LJA C;  3AZN B;  3X1S C;  3AV1 B;  3R45 A;  3LZ1 D;  5AY8 C;  5JRG C;  5B1M C;  3W96 C;  4J8U A;  1TAF B;  5B0Y D;  4LD9 B;  1HQ3 B;  1P3L B;  3REL A;  3UTA C;  1EQZ B;  4WU9 B;  5G49 A;  3AZK B;  3AV2 B;  1AOI D;  1F66 B;  3NQU B;  3WKJ C;  3REK C;  5B31 C;  5AVC B;  3UTB C;  5B40 C;  3UT9 D;  2ARO C;  4KHA A;  1H3O B;  5DNN A;  4WU9 A;  3KXB C;  5BS7 C;  5B24 A;  3MGP B;  3VH5 W;  1P3K B;  4J8X C;  4QLC B;  3WAA A;  3AZM C;  1KX5 C;  4ZUX D;  1KX3 D;  1P3K A;  3MGR C;  3B6G C;  3TU4 C;  5BNV A;  5CPI C;  5AY8 D;  3X1U B;  4CAY B;  3REH C;  5JRG D;  4H9Q A;  2HUE C;  3AV1 C;  5B1M D;  5AV9 B;  5B0Z D;  2CV5 B;  3MGS A;  5AVB A;  3AZI D;  3AN2 C;  4XUJ D;  5B33 B;  5AV8 C;  3AYW C;  4LD9 C;  3MGQ A;  1HQ3 C;  4X23 A;  5AV9 A;  3B6F A;  2L5A A;  1EQZ C;  3WKJ D;  3MNN B;  3REK D;  5B31 D;  3AV2 C;  3LZ0 B;  4EO5 C;  3UTB D;  3NQJ A;  2F8N H;  4NFT A;  5GXQ D;  3AZF B;  5DNM B;  5B2I C;  3A6N D;  4M6B A;  3KXB D;  3AZE D;  4H9N B;  4HGA B;  1P3I B;  2F8N K;  4J8X D;  4Z2M H;  4WU8 B;  1BFM A;  4CSR A;  4QLC C;  5DNM A;  4YS3 D;  5B1L A;  3MGR D;  4J8U D;  5KDM B;  1P3M D;  5F99 C;  1M1A D;  5CHL B;  3AZN D;  4JJN A;  3MVD C;  3AV1 D;  1JFI B;  3REI C;  3AZJ B;  2CV5 C;  1KU5 A;  3W99 C;  1M19 C;  3O62 B;  4LD9 D;  3C1B C;  1HQ3 D;  1P3L D;  5B33 C;  4H9R A;  1Q9C A;  1EQZ D;  4WU9 D;  3AV2 D;  3AZK D;  3AZL C;  1F66 D;  3MNN C;  4NE6 A;  5AVC D;  5AV5 A;  4Z5T A;  5GT3 B;  1TZY B;  4YM6 A;  1P3A A;  3AZF C;  1P3B B;  1U35 C;  3MGP D;  1P3I C;  4J8V A;  4WU8 C;  1KX4 B;  4QLC D;  2BYM A;  5GT0 A;  2HIO B;  3W97 A;  1P34 B;  3LEL A;  3WTP B;  4H9O B;  2FJ7 B;  3C1C A;  3AZG A;  1ZLA A;  5GSU B;  3W98 B;  3X1U D;  5B32 B;  1P34 A;  4XZQ C;  4R8P B;  2CV5 D;  3W99 D;  4Z66 C;  3B0C T;  5B33 D;  2IO5 B;  1S32 A;  3V9R A;  3B0C W;  3MNN D;  3X1V B;  1P3G A;  3LZ0 D;  3B0D B;  5B32 G;  4KGC B;  1BH8 B;  1HTA A;  3AZF D;  1P3P B;  1AOI C;  1P3I D;  4WU8 D;  2NZD A;  3KWQ A;  4H9P B;  3AFA B;  5CPJ A;  1P3F A;  3UT9 C;  3WTP C;  3KUY B;  2NQB A;  4J8W A;  3R45 B;  3AZH A;  5CP6 A;  1KX3 C;  2RVQ C;  1ID3 A;  4KUD A;  3LJA A;  3X1S A;  3AZJ D;  3O62 D;  3W96 A;  3REL B;  5CPK A;  2IO5 C;  4G91 C;  3VH5 A;  1A7W A;  5G49 B;  5B0Z C;  3UTA A;  3AZI C;  4XUJ C;  5E5A A;  4DRB A;  4KHA B;  5GT3 D;  1TZY D;  5DNN B;  3REJ A;  5B40 A;  5B24 B;  4H9S C;  1P3B D;  2ARO A;  3X1T C;  5BNX A;  1M18 A;  3WAA B;  5BS7 A;  1KX4 D;  5GXQ C;  4NE5 A;  2HIO D;  3VH5 T;  5AV6 A;  3A6N C;  3AZE C;  3WTP D;  3AZM A;  1KX5 A;  2FJ7 D;  2PYO B;  5BNV B;  5GSU D;  3W98 D;  3B6G A;  2RVQ D;  4H9Q B;  4YS3 C;  3TU4 A;  1BH9 A;  5B32 D;  5CPI A;  2PYO A;  4J8U C;  3MGS B;  5AVB B;  4R8P D;  3REH A;  4WNN A;  1P3M C;  1M1A C;  3MGQ B;  2CWE A;  4X23 B;  3AZN C;  3AN2 A;  5AV8 A;  3AYW A;  2YFV A;  3B6F B;  3X1V D;  3NQJ B;  1P3L C;  4KGC D;  5DNN C;  5B2J A;  4WU9 C;  3AZK C;  1P3P D;  3X1T D;  1F66 C;  5B2I A;  5AVC C;  4CSR B;  3WAA C;  3AFA D;  4WV4 B;  5B1L B;  1P3O B;  3MGP C;  5BT1 D;  1P3K C;  3KUY D;  4JJN B;  5F99 A;  1WWI A;  1P3O A;  3MVD A;  1N1J A;  3MGS C;  3REI A;  4H9R B;  3MGQ C;  3REL D;  3X1U C;  2F8N A;  3C1B A; 
#chains in the Genus database with same CATH topology
 5AV9 C;  3KSY A;  5AV5 B;  4Z5T B;  3AZL A;  2ZY3 A;  4YM6 B;  1P3A B;  5DNN D;  5B24 D;  4J8V B;  2YFW A;  3LZ0 C;  2BYM B;  3WAA D;  5GT0 B;  1U35 A;  3W97 B;  5DNM C;  3LEL B;  3C1C B;  3AZG B;  1ZLA B;  4HGA C;  1P3K D;  5JA4 A;  3LZ1 B;  3MGS D;  5AVB D;  2LY8 A;  1S32 B;  4XZQ A;  3V9R B;  3MGQ D;  3P5J B;  4X23 D;  4Z66 A;  2W8S A;  5BO0 A;  5AV9 D;  3B6F D;  3LZ1 A;  3B0B A;  3VH6 T;  3AZJ C;  1P3G B;  3O62 C;  3VH6 W;  5B0Y A;  1WWS A;  2Y2G A;  4ZBJ B;  4E45 A;  2NZD B;  3KWQ B;  1W2E A;  4AWL B;  3WA9 B;  5CPJ B;  1P3F B;  1AOI A;  5DNM D;  5GT3 C;  1TZY C;  5B1L D;  3WTP E;  3LEL C;  1P3B C;  3UT9 A;  3C1C C;  2JSS A;  2NQB B;  4J8W B;  3WA9 A;  1KX4 C;  3AZH B;  5CP6 B;  4JJN D;  1ID3 B;  2HIO C;  4KUD B;  1F1E A;  3LJA B;  1P34 C;  3X1S B;  2FJ7 C;  4ZUX A;  1KX3 A;  5GSU C;  5CPK B;  3W96 B;  3W98 C;  2Y2Q A;  5B32 C;  3UTA B;  2BYK A;  5AY8 A;  4UUZ A;  4R8P C;  5JRG A;  5B1M A;  5E5A B;  5B0Z A;  3WKJ B;  3REK B;  1R4V A;  5AV5 D;  4Z5T D;  3AZI A;  4YM6 D;  4XUJ A;  3REJ B;  1P3A D;  5B40 B;  1ULY A;  4ZBJ C;  2ARO B;  5BNX B;  3X1V C;  1M18 B;  4J8V D;  3KXB B;  3WKJ A;  3B0D C;  3REK A;  4KGC C;  5B31 A;  5GT0 D;  5AV6 B;  3W97 D;  3UTB A;  3LEL D;  3AZM B;  1KX5 B;  1T3U A;  3C1C D;  5GXQ A;  3AZG D;  1P3P C;  1ZLA D;  2Y2P A;  3A6N A;  3KXB A;  3AZE A;  2NQB C;  3AFA C;  3MGR B;  4J8X A;  3B6G B;  3TU4 B;  1BH9 B;  1P34 D;  5CPI B;  3REH B;  4WNN B;  2HUE B;  5BT1 C;  4YS3 A;  3KUY C;  4WJ3 C;  1S32 D;  3MGR A;  5CPK C;  1P3M A;  2BG1 A;  3AN2 B;  5AV8 B;  3AYW B;  2YFV B;  1M1A A;  3AZN A;  3AV1 A;  1P3G D;  3FDD A;  1B6W A;  5E5A C;  3REL C;  1TAF A;  4DRA A;  4EO5 B;  4LD9 A;  1HQ3 A;  1P3L A;  5B2J B;  3REJ C;  5B2I B;  2NZD D;  1EQZ A;  3KWQ D;  4G92 B;  1M18 C;  3AV2 A;  3AZK A;  5CPJ D;  1P3F D;  1F66 A;  3NQU A;  1B67 A;  3WA9 D;  2DF4 C;  5AV6 C;  5AVC A;  5B24 C;  1H3O A;  2NQB D;  4J8W D;  3MGP A;  2Y2J A;  5F99 B;  3AZH D;  5CP6 D;  1ID3 D;  4KUD D;  4DQY B;  4QLC A;  3LJA D;  3MVD B;  3X1S D;  2PYO C;  3A1I A;  1N1J B;  3REI B;  2Y2H A;  3W96 D;  5CPK D;  2F8N B;  1M19 B;  3W99 B;  3C1B B;  3UTA D;  3X1U A;  5AVB C;  4CAY A;  5E5A D;  4X23 C;  3AZL B;  2CV5 A;  1M19 A;  3W99 A;  5B33 A;  3REJ D;  3B6F C;  5B40 D;  5C3I B;  2Y2K A;  5B2J C;  2ARO D;  2YFW B;  2F8N G;  1M18 D;  2ZY4 A;  1U35 B;  3MNN A;  4G92 C;  5AV6 D;  3LZ0 A;  4Z2M G;  3AZM D;  1KX5 D;  3AZF A;  5JA4 B;  4H9N A;  1P3I A;  3B6G D;  4WU8 A;  2XD5 A;  5B1L C;  3TU4 D;  5CPI D;  2PYO D;  1P3O C;  3REH D;  3VH6 A;  3H0R C;  4XZQ B;  4Z66 B;  4E44 A;  4JJN C;  5BO0 B;  5KDM A;  3AN2 D;  5AV8 D;  3AYW D;  2Y2N A;  1JFI A;  5B0Y B;  3AZJ A;  3O62 A;  5B2J D;  5C3I C;  5B2I D;  2UWX A;  1AOI B;  5AV5 C;  4Z5T C;  4YM6 C;  1P3A C;  3UT9 B;  1Z2C B;  5GT3 A;  1TZY A;  4J8V C;  4NE3 A;  1P3B A;  5GT0 C;  3W97 C;  2G5H C;  5F99 D;  1P3O D;  1KX4 A;  4ZUX B;  3AZG C;  1ZLA C;  3MVD D;  2XD1 A;  1KX3 B;  2HIO A;  3REI D;  3WTP A;  4H9O A;  2FJ7 A;  2F8N D;  2DQN C;  1M19 D;  5GSU A;  3C1B D;  2BYK B;  5AY8 B;  4UUZ B;  3W98 A;  4G91 B;  5JRG B;  3LZ1 C;  5B1M B;  5B32 A;  5B0Z B;  1S32 C;  4R8P A;  3AZI B;  5B0Y C;  3AZL D;  4XUJ B;  2RIQ A;  1P3G C;  5FUG B;  5B31 B;  1U35 D;  4WZS B;  3X1T B;  3X1V A;  3UTB B;  5GXQ B;  4KGC A;  1BH8 A;  3A6N B;  2NZD C;  3AZE B;  3KWQ C;  4H9S A;  5FUG A;  4J8X B;  4AWL C;  5CPJ C;  3X1T A;  1P3F C;  1P3P A;  3WA9 C;  4H9P A;  3AFA A;  4YS3 B;  5B31 G;  4ZUX C;  2J8P A;  3AL0 C;  4XZQ D;  4J8U B;  4J8W C;  1P3M B;  3AZH C;  4Z66 D;  5CP6 C;  1M1A B;  1ID3 C;  4KUD C;  1PZR A;  3KUY A;  3LJA C;  3AZN B;  3EPJ A;  3X1S C;  3AV1 B;  3R45 A;  3LZ1 D;  5AY8 C;  5JRG C;  5B1M C;  3W96 C;  4J8U A;  1TAF B;  5B0Y D;  3A1K A;  4LD9 B;  1HQ3 B;  1P3L B;  3REL A;  3UTA C;  1EQZ B;  4WU9 B;  5G49 A;  3AZK B;  3AV2 B;  1AOI D;  1F66 B;  3NQU B;  3WKJ C;  3REK C;  5B31 C;  5AVC B;  3EPK A;  3UTB C;  5B40 C;  3UT9 D;  2ARO C;  4KHA A;  1H3O B;  5DNN A;  4WU9 A;  3KXB C;  5BS7 C;  5B24 A;  3MGP B;  3VH5 W;  1P3K B;  4J8X C;  3EPL A;  4QLC B;  3WAA A;  3AZM C;  1KX5 C;  4ZUX D;  1KX3 D;  1P3K A;  3MGR C;  3B6G C;  3TU4 C;  5BNV A;  5CPI C;  5AY8 D;  3X1U B;  4CAY B;  3REH C;  5JRG D;  4H9Q A;  2HUE C;  3AV1 C;  5B1M D;  5AV9 B;  5B0Z D;  2CV5 B;  3MGS A;  5AVB A;  3AZI D;  3AN2 C;  5AV8 C;  4XUJ D;  5B33 B;  3AYW C;  4LD9 C;  3MGQ A;  1HQ3 C;  4X23 A;  5AV9 A;  3B6F A;  2L5A A;  1EQZ C;  3WKJ D;  3MNN B;  3REK D;  5B31 D;  3AV2 C;  3LZ0 B;  4EO5 C;  3UTB D;  3NQJ A;  2F8N H;  4NFT A;  5GXQ D;  3AZF B;  5DNM B;  5B2I C;  3A6N D;  4M6B A;  3KXB D;  3AZE D;  4H9N B;  4HGA B;  1P3I B;  2F8N K;  4J8X D;  4Z2M H;  4WU8 B;  1BFM A;  2F2A C;  4CSR A;  4QLC C;  5DNM A;  4YS3 D;  5B1L A;  3MGR D;  4J8U D;  5KDM B;  1P3M D;  5F99 C;  1M1A D;  5CHL B;  3AZN D;  4JJN A;  3MVD C;  3AV1 D;  1JFI B;  3REI C;  3AZJ B;  2CV5 C;  2ZY2 A;  1KU5 A;  3W99 C;  1M19 C;  3O62 B;  4LD9 D;  3C1B C;  1HQ3 D;  1P3L D;  5B33 C;  4H9R A;  1Q9C A;  2ZY5 A;  1EQZ D;  4WU9 D;  3AV2 D;  3AZK D;  3AZL C;  1F66 D;  3MNN C;  4NE6 A;  5AVC D;  5AV5 A;  4Z5T A;  5GT3 B;  1TZY B;  4YM6 A;  1P3A A;  3AZF C;  1P3B B;  1U35 C;  3H0L C;  3MGP D;  1P3I C;  4J8V A;  4WU8 C;  1KX4 B;  4QLC D;  2BYM A;  2FFF B;  5GT0 A;  2HIO B;  3W97 A;  1P34 B;  3LEL A;  3WTP B;  4H9O B;  2FJ7 B;  3C1C A;  3AZG A;  1ZLA A;  5GSU B;  3W98 B;  2Y2M A;  3X1U D;  5B32 B;  1P34 A;  4XZQ C;  4R8P B;  2CV5 D;  3W99 D;  4Z66 C;  3B0C T;  3EG5 B;  2IO5 B;  5B33 D;  3V9R A;  1S32 A;  2JE5 A;  3B0C W;  2Y2L A;  3MNN D;  3X1V B;  4UPK A;  1P3G A;  3LZ0 D;  3B0D B;  5B32 G;  4KGC B;  1BH8 B;  1HTA A;  3AZF D;  2JCH A;  1P3P B;  1AOI C;  1P3I D;  4WU8 D;  2NZD A;  3KWQ A;  4H9P B;  3AFA B;  5CPJ A;  1P3F A;  3UT9 C;  3WTP C;  3KUY B;  2NQB A;  4J8W A;  3R45 B;  3AZH A;  5CP6 A;  1KX3 C;  2RVQ C;  1ID3 A;  4KUD A;  3LJA A;  3X1S A;  3IP4 C;  3AZJ D;  3O62 D;  3W96 A;  3REL B;  5CPK A;  2IO5 C;  4G91 C;  3VH5 A;  1A7W A;  5G49 B;  5B0Z C;  3UTA A;  3AZI C;  4XUJ C;  5E5A A;  4DRB A;  2VQR A;  4KHA B;  5GT3 D;  1TZY D;  5DNN B;  3REJ A;  5B40 A;  5B24 B;  4H9S C;  1P3B D;  2ARO A;  3X1T C;  5BNX A;  1M18 A;  3WAA B;  3KFU G;  5BS7 A;  1KX4 D;  5GXQ C;  4NE5 A;  2HIO D;  2Y2O A;  3VH5 T;  5AV6 A;  3A6N C;  3AZE C;  2Y2I A;  3WTP D;  3AZM A;  1KX5 A;  2FJ7 D;  2PYO B;  5BNV B;  5GSU D;  3F6T A;  3W98 D;  3B6G A;  2RVQ D;  4H9Q B;  4YS3 C;  3TU4 A;  2ZM5 A;  1BH9 A;  5B32 D;  5CPI A;  2PYO A;  4J8U C;  3MGS B;  5AVB B;  4R8P D;  3REH A;  4WNN A;  1P3M C;  1M1A C;  3MGQ B;  2CWE A;  4X23 B;  3AZN C;  2G5I C;  3AN2 A;  5AV8 A;  3AYW A;  2YFV A;  3B6F B;  3X1V D;  3NQJ B;  1P3L C;  4KGC D;  5DNN C;  5B2J A;  4WU9 C;  3AZK C;  1P3P D;  3X1T D;  1F66 C;  3H0M C;  5B2I A;  5AVC C;  4CSR B;  3WAA C;  3AFA D;  4WV4 B;  5B1L B;  1P3O B;  3MGP C;  3EPH A;  5BT1 D;  1P3K C;  3KUY D;  4JJN B;  5F99 A;  1WWI A;  1P3O A;  3MVD A;  1N1J A;  3MGS C;  3REI A;  4H9R B;  3MGQ C;  3REL D;  3X1U C;  2F8N A;  3C1B A; 
#chains in the Genus database with same CATH homology
 5AV9 C;  3KSY A;  5AV5 B;  4Z5T B;  3AZL A;  2ZY3 A;  4YM6 B;  1P3A B;  5DNN D;  5B24 D;  4J8V B;  2YFW A;  3LZ0 C;  2BYM B;  3WAA D;  5GT0 B;  1U35 A;  3W97 B;  5DNM C;  3LEL B;  3C1C B;  3AZG B;  1ZLA B;  4HGA C;  1P3K D;  5JA4 A;  3LZ1 B;  3MGS D;  5AVB D;  2LY8 A;  1S32 B;  4XZQ A;  3V9R B;  3MGQ D;  3P5J B;  4X23 D;  4Z66 A;  2W8S A;  5BO0 A;  5AV9 D;  3B6F D;  3LZ1 A;  3B0B A;  3VH6 T;  3AZJ C;  1P3G B;  3O62 C;  3VH6 W;  5B0Y A;  1WWS A;  2Y2G A;  4ZBJ B;  4E45 A;  2NZD B;  3KWQ B;  1W2E A;  4AWL B;  3WA9 B;  5CPJ B;  1P3F B;  1AOI A;  5DNM D;  5GT3 C;  1TZY C;  5B1L D;  3WTP E;  3LEL C;  1P3B C;  3UT9 A;  3C1C C;  2JSS A;  2NQB B;  4J8W B;  3WA9 A;  1KX4 C;  3AZH B;  5CP6 B;  4JJN D;  1ID3 B;  2HIO C;  4KUD B;  1F1E A;  3LJA B;  1P34 C;  3X1S B;  2FJ7 C;  4ZUX A;  1KX3 A;  5GSU C;  5CPK B;  3W96 B;  3W98 C;  2Y2Q A;  5B32 C;  3UTA B;  2BYK A;  5AY8 A;  4UUZ A;  4R8P C;  5JRG A;  5B1M A;  5E5A B;  5B0Z A;  3WKJ B;  3REK B;  1R4V A;  5AV5 D;  4Z5T D;  3AZI A;  4YM6 D;  4XUJ A;  3REJ B;  1P3A D;  5B40 B;  1ULY A;  4ZBJ C;  2ARO B;  5BNX B;  3X1V C;  1M18 B;  4J8V D;  3KXB B;  3WKJ A;  3B0D C;  3REK A;  4KGC C;  5B31 A;  5GT0 D;  5AV6 B;  3W97 D;  3UTB A;  3LEL D;  3AZM B;  1KX5 B;  1T3U A;  3C1C D;  5GXQ A;  3AZG D;  1P3P C;  1ZLA D;  2Y2P A;  3A6N A;  3KXB A;  3AZE A;  2NQB C;  3AFA C;  3MGR B;  4J8X A;  3B6G B;  3TU4 B;  1BH9 B;  1P34 D;  5CPI B;  3REH B;  4WNN B;  2HUE B;  5BT1 C;  4YS3 A;  3KUY C;  4WJ3 C;  1S32 D;  3MGR A;  5CPK C;  1P3M A;  2BG1 A;  3AN2 B;  5AV8 B;  3AYW B;  2YFV B;  1M1A A;  3AZN A;  3AV1 A;  1P3G D;  3FDD A;  1B6W A;  5E5A C;  3REL C;  1TAF A;  4DRA A;  4EO5 B;  4LD9 A;  1HQ3 A;  1P3L A;  5B2J B;  3REJ C;  5B2I B;  2NZD D;  1EQZ A;  3KWQ D;  4G92 B;  1M18 C;  3AV2 A;  3AZK A;  5CPJ D;  1P3F D;  1F66 A;  3NQU A;  1B67 A;  3WA9 D;  2DF4 C;  5AV6 C;  5AVC A;  5B24 C;  1H3O A;  2NQB D;  4J8W D;  3MGP A;  2Y2J A;  5F99 B;  3AZH D;  5CP6 D;  1ID3 D;  4KUD D;  4DQY B;  4QLC A;  3LJA D;  3MVD B;  3X1S D;  2PYO C;  3A1I A;  1N1J B;  3REI B;  2Y2H A;  3W96 D;  5CPK D;  2F8N B;  1M19 B;  3W99 B;  3C1B B;  3UTA D;  3X1U A;  5AVB C;  4CAY A;  5E5A D;  4X23 C;  3AZL B;  2CV5 A;  1M19 A;  3W99 A;  5B33 A;  3REJ D;  3B6F C;  5B40 D;  5C3I B;  2Y2K A;  5B2J C;  2ARO D;  2YFW B;  2F8N G;  1M18 D;  2ZY4 A;  1U35 B;  3MNN A;  4G92 C;  5AV6 D;  3LZ0 A;  4Z2M G;  3AZM D;  1KX5 D;  3AZF A;  5JA4 B;  4H9N A;  1P3I A;  3B6G D;  4WU8 A;  2XD5 A;  5B1L C;  3TU4 D;  5CPI D;  2PYO D;  1P3O C;  3REH D;  3VH6 A;  3H0R C;  4XZQ B;  4Z66 B;  4E44 A;  4JJN C;  5BO0 B;  5KDM A;  3AN2 D;  5AV8 D;  3AYW D;  2Y2N A;  1JFI A;  5B0Y B;  3AZJ A;  3O62 A;  5B2J D;  5C3I C;  5B2I D;  2UWX A;  1AOI B;  5AV5 C;  4Z5T C;  4YM6 C;  1P3A C;  3UT9 B;  1Z2C B;  5GT3 A;  1TZY A;  4J8V C;  4NE3 A;  1P3B A;  5GT0 C;  3W97 C;  2G5H C;  5F99 D;  1P3O D;  1KX4 A;  4ZUX B;  3AZG C;  1ZLA C;  3MVD D;  2XD1 A;  1KX3 B;  2HIO A;  3REI D;  3WTP A;  4H9O A;  2FJ7 A;  2F8N D;  2DQN C;  1M19 D;  5GSU A;  3C1B D;  2BYK B;  5AY8 B;  4UUZ B;  3W98 A;  4G91 B;  5JRG B;  3LZ1 C;  5B1M B;  5B32 A;  5B0Z B;  1S32 C;  4R8P A;  3AZI B;  5B0Y C;  3AZL D;  4XUJ B;  2RIQ A;  1P3G C;  5FUG B;  5B31 B;  1U35 D;  4WZS B;  3X1T B;  3X1V A;  3UTB B;  5GXQ B;  4KGC A;  1BH8 A;  3A6N B;  2NZD C;  3AZE B;  3KWQ C;  4H9S A;  5FUG A;  4J8X B;  4AWL C;  5CPJ C;  3X1T A;  1P3F C;  1P3P A;  3WA9 C;  4H9P A;  3AFA A;  4YS3 B;  5B31 G;  4ZUX C;  2J8P A;  3AL0 C;  4XZQ D;  4J8U B;  4J8W C;  1P3M B;  3AZH C;  4Z66 D;  5CP6 C;  1M1A B;  1ID3 C;  4KUD C;  1PZR A;  3KUY A;  3LJA C;  3AZN B;  3EPJ A;  3X1S C;  3AV1 B;  3R45 A;  3LZ1 D;  5AY8 C;  5JRG C;  5B1M C;  3W96 C;  4J8U A;  1TAF B;  5B0Y D;  3A1K A;  4LD9 B;  1HQ3 B;  1P3L B;  3REL A;  3UTA C;  1EQZ B;  4WU9 B;  5G49 A;  3AZK B;  3AV2 B;  1AOI D;  1F66 B;  3NQU B;  3WKJ C;  3REK C;  5B31 C;  5AVC B;  3EPK A;  3UTB C;  5B40 C;  3UT9 D;  2ARO C;  4KHA A;  1H3O B;  5DNN A;  4WU9 A;  3KXB C;  5BS7 C;  5B24 A;  3MGP B;  3VH5 W;  1P3K B;  4J8X C;  3EPL A;  4QLC B;  3WAA A;  3AZM C;  1KX5 C;  4ZUX D;  1KX3 D;  1P3K A;  3MGR C;  3B6G C;  3TU4 C;  5BNV A;  5CPI C;  5AY8 D;  3X1U B;  4CAY B;  3REH C;  5JRG D;  4H9Q A;  2HUE C;  3AV1 C;  5B1M D;  5AV9 B;  5B0Z D;  2CV5 B;  3MGS A;  5AVB A;  3AZI D;  3AN2 C;  5AV8 C;  4XUJ D;  5B33 B;  3AYW C;  4LD9 C;  3MGQ A;  1HQ3 C;  4X23 A;  5AV9 A;  3B6F A;  2L5A A;  1EQZ C;  3WKJ D;  3MNN B;  3REK D;  5B31 D;  3AV2 C;  3LZ0 B;  4EO5 C;  3UTB D;  3NQJ A;  2F8N H;  4NFT A;  5GXQ D;  3AZF B;  5DNM B;  5B2I C;  3A6N D;  4M6B A;  3KXB D;  3AZE D;  4H9N B;  4HGA B;  1P3I B;  2F8N K;  4J8X D;  4Z2M H;  4WU8 B;  1BFM A;  2F2A C;  4CSR A;  4QLC C;  5DNM A;  4YS3 D;  5B1L A;  3MGR D;  4J8U D;  5KDM B;  1P3M D;  5F99 C;  1M1A D;  5CHL B;  3AZN D;  4JJN A;  3MVD C;  3AV1 D;  1JFI B;  3REI C;  3AZJ B;  2CV5 C;  2ZY2 A;  1KU5 A;  3W99 C;  1M19 C;  3O62 B;  4LD9 D;  3C1B C;  1HQ3 D;  1P3L D;  5B33 C;  4H9R A;  1Q9C A;  2ZY5 A;  1EQZ D;  4WU9 D;  3AV2 D;  3AZK D;  3AZL C;  1F66 D;  3MNN C;  4NE6 A;  5AVC D;  5AV5 A;  4Z5T A;  5GT3 B;  1TZY B;  4YM6 A;  1P3A A;  3AZF C;  1P3B B;  1U35 C;  3H0L C;  3MGP D;  1P3I C;  4J8V A;  4WU8 C;  1KX4 B;  4QLC D;  2BYM A;  2FFF B;  5GT0 A;  2HIO B;  3W97 A;  1P34 B;  3LEL A;  3WTP B;  4H9O B;  2FJ7 B;  3C1C A;  3AZG A;  1ZLA A;  5GSU B;  3W98 B;  2Y2M A;  3X1U D;  5B32 B;  1P34 A;  4XZQ C;  4R8P B;  2CV5 D;  3W99 D;  4Z66 C;  3B0C T;  3EG5 B;  2IO5 B;  5B33 D;  3V9R A;  1S32 A;  2JE5 A;  3B0C W;  2Y2L A;  3MNN D;  3X1V B;  4UPK A;  1P3G A;  3LZ0 D;  3B0D B;  5B32 G;  4KGC B;  1BH8 B;  1HTA A;  3AZF D;  2JCH A;  1P3P B;  1AOI C;  1P3I D;  4WU8 D;  2NZD A;  3KWQ A;  4H9P B;  3AFA B;  5CPJ A;  1P3F A;  3UT9 C;  3WTP C;  3KUY B;  2NQB A;  4J8W A;  3R45 B;  3AZH A;  5CP6 A;  1KX3 C;  2RVQ C;  1ID3 A;  4KUD A;  3LJA A;  3X1S A;  3IP4 C;  3AZJ D;  3O62 D;  3W96 A;  3REL B;  5CPK A;  2IO5 C;  4G91 C;  3VH5 A;  1A7W A;  5G49 B;  5B0Z C;  3UTA A;  3AZI C;  4XUJ C;  5E5A A;  4DRB A;  2VQR A;  4KHA B;  5GT3 D;  1TZY D;  5DNN B;  3REJ A;  5B40 A;  5B24 B;  4H9S C;  1P3B D;  2ARO A;  3X1T C;  5BNX A;  1M18 A;  3WAA B;  3KFU G;  5BS7 A;  1KX4 D;  5GXQ C;  4NE5 A;  2HIO D;  2Y2O A;  3VH5 T;  5AV6 A;  3A6N C;  3AZE C;  2Y2I A;  3WTP D;  3AZM A;  1KX5 A;  2FJ7 D;  2PYO B;  5BNV B;  5GSU D;  3F6T A;  3W98 D;  3B6G A;  2RVQ D;  4H9Q B;  4YS3 C;  3TU4 A;  2ZM5 A;  1BH9 A;  5B32 D;  5CPI A;  2PYO A;  4J8U C;  3MGS B;  5AVB B;  4R8P D;  3REH A;  4WNN A;  1P3M C;  1M1A C;  3MGQ B;  2CWE A;  4X23 B;  3AZN C;  2G5I C;  3AN2 A;  5AV8 A;  3AYW A;  2YFV A;  3B6F B;  3X1V D;  3NQJ B;  1P3L C;  4KGC D;  5DNN C;  5B2J A;  4WU9 C;  3AZK C;  1P3P D;  3X1T D;  1F66 C;  3H0M C;  5B2I A;  5AVC C;  4CSR B;  3WAA C;  3AFA D;  4WV4 B;  5B1L B;  1P3O B;  3MGP C;  3EPH A;  5BT1 D;  1P3K C;  3KUY D;  4JJN B;  5F99 A;  1WWI A;  1P3O A;  3MVD A;  1N1J A;  3MGS C;  3REI A;  4H9R B;  3MGQ C;  3REL D;  3X1U C;  2F8N A;  3C1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...