4J8XC

X-ray structure of ncp145 with bound chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)ruthenium(ii)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8xC00
5BNXB 5GXQB 3AZKD 1M19D 2NQBA 3LZ0B 4QLCC 1BH9B 4H9PB 3W99A 4J8XB 3KWQA 3MGPC 5AV8C 4H9OA 2F8NA 3WTPB 4E44A 3AYWC 4WZSB 1P3GB 2NQBC 3REJC 5CHLB 3VH5W 1KX5B 1P3KB 3W99C 3KUYB 3B6GD 4CSRB 4JJNB 5B1MD 3VH6W 3WKJB 4Z5TD 3RELA 3V9RA 1P3LA 5KDMA 5AV9C 5E5AB 1P3FC 5B40A 2BYMB 3AN2A 3MGQC 2F8NK 3KWQD 5B33C 3O62C 3B0BA 3RELC 4AWLB 3AZLB 3X1SB 4NE3A 1P3AA 1AOIA 3C1CD 5B0ZA 4WU8B 1M1AA 4UUZA 5AV5D 5AVCB 4ZUXC 3NQJB 3MNND 3LJAB 2AROC 1P3LD 5BT1C 1P3AC 4KGCB 3LZ0A 4XZQB 3X1UC 2NZDB 2HUEB 3AN2D 4J8XA 3REHA 3AZKB 1H3OB 1M19B 1TZYC 3WKJC 1WWIA 5GXQC 3LZ0C 4H9RB 5AV6A 4J8XC 1AOID 5B0ZD 5CPID 5AY8A 1M1AD 4H9QB 3WTPC 1P3GC 3B6GB 2F8NH 1KX5C 1P3KC 5B1MB 3KUYC 3TU4D 3AZFA 4Z5TB 2BYMA 1EQZA 3REHD 4JJNC 1ID3D 5FUGB 5DNMD 5AVBA 4DRBA 5BS7C 3AZLA 3KWQB 5F99A 5E5AC 4X23A 5AV6D 4R8PD 4WU8A 5AY8D 3AFAA 3AZHA 5AVCA 4AWLC 4LD9D 3AZLC 3AV1A 3X1SC 1HQ3D 4KGCA 4XZQA 5AV5B 3AZFD 2RVQD 2NZDA 3MNNB 1EQZD 3VH5A 4WU8C 1P3LB 5KDMB 1H3OA 1M19A 5AVCC 3C1BA 3LJAC 5AVBD 5B40B 3AN2B 4NE6A 1B6WA 3MGRA 4KUDD 4KGCC 5F99D 4XZQC 4X23D 2NZDC 2HUEC 3X1TD 4H9RA 5CPKD 3W97D 3AZKC 1M19C 2YFVA 3AFAD 3AZHD 1BH8A 4H9QA 1AOIB 3AZID 3AV1D 5B0ZB 3B6GA 5CPIB 1M1AB 4UUZB 1TAFA 1P3OA 4EO5B 3W98A 2YFWA 3AV2D 5FUGA 3C1BD 3TU4B 3B6GC 3REHB 3MGRD 5B1MC 1ID3B 4CAYB 4Z5TC 3LELD 5DNMB 2BYKB 3REID 4H9SA 1P3MD 3UTAD 2IO5B 4NFTA 2FJ7D 3REKD 5AV6B 3C1CA 4R8PB 3KWQC 5AY8B 4H9NB 2PYOA 5AV5A 1P3OD 2CV5A 4H9SC 3W98D 3B6FD 3MNNA 1R4VA 1HQ3B 4YM6D 3AZFB 1KX3A 1EQZB 1M18D 5BNVA 2L5AA 5B32A 5AVBB 1P3LC 1ZLAD 5CP6D 4KUDB 5F99B 4X23B 5B40C 3AN2C 3X1TB 5CPKB 3W97B 2CWEA 1F66D 5GT3D 5CPIA 5B31D 3AFAB 3AZHB 2PYOD 2CV5D 1P34D 3WAAA 3AZIB 3AV1B 3B0CW 1AOIC 3TU4A 3LZ1D 3KXBA 5B0ZC 5CPIC 1KX3D 1M1AC 1ID3A 4CAYA 3UTBA 4EO5C 3AV2B 5DNMA 3C1BB 5B2JA 2BYKA 5B32D 3MGRB 3TU4C 5C3IB 3LELB 3X1VA 5B1LD 3AZJA 3REHC 4R8PA 2HIOA 1P3MB 1ID3C 3UTAB 2YFVB 4ZBJB 5DNMC 1BH8B 4H9NA 2FJ7B 3REKB 4LD9A 3WAAD 1HQ3A 3AZEA 1KU5A 4XUJD 3MVDA 1TAFB 5AV6C 4DRAA 3UT9D 4R8PC 1P3OB 3KXBD 3W98B 3B6FB 5AY8C 4YM6B 2YFWB 3UTBD 4ZUXD 5JRGA 1A7WA 3A6ND 5B2JD 1P3BA 1HQ3C 4KUDA 1M18B 3AZFC 2RVQC 3X1VD 3X1TA 3AZJD 3W97A 3AZGA 5CPKA 1EQZC 4G91B 5DNNA 1ZLAB 2HIOD 5CP6B 4Z66A 4YS3D 5AVBC 3C1CB 3AZIA 4KUDC 1F66B 5F99C 5GT3B 1P3IA 5GSUA 5B31B 4X23C 3AZED 3X1TC 2PYOB 3MVDD 4WU9A 5CPKC 3W97C 2CV5B 1P34B 3VH5T 3AFAC 3AZHC 1BFMA 4E45A 3AV2A 5JRGD 1P3BD 5GT0A 3AZIC 3AV1C 3LZ1B 1KX5D 1KX3B 3VH6A 3WA9A 3B0DB 1N1JB 5B24A 3LELA 5BNVB 5B32G 4J8WD 4G92B 3REIA 5B32B 3WTPE 4J8UA 3AZGD 5DNND 3MGSD 1P3MA 3R45B 3UTAA 4Z66D 3AV2C 3C1BC 3AZMA 2FJ7A 5B1LB 3REKA 3MGRC 1S32D 1P3ID 5GSUD 5C3IC 3LELC 1Q9CA 4WU9D 3WAAB 3B6FA 3UTAC 4ZBJC 5JA4A 1P3PA 2FJ7C 4YM6A 4XUJB 3REKC 3UT9B 5GT0D 3X1SD 3KXBB 3AZNA 3W96A 1M18A 5CPJA 3WA9D 1P3OC 3UTBB 4J8VA 5B24D 4ZUXB 1U35D 3A6NB 3W98C 5B2JB 3B6FC 4J8UD 1ZLAA 5CP6A 4YM6C 1KX4D 3AZMD 3X1VB 3AZJB 1M18C 1F66A 2HIOB 5GT3A 4YS3B 3MGPA 5B31A 5B2ID 4G91C 3AYWA 1P34A 1ZLAC 5CP6C 4LD9B 3REJA 3AZEB 1P3PD 2JSSA 3MVDB 3C1CC 3LZ1A 1F66C 5GT3C 2LY8A 5B31C 3AZND 3W96D 5CPJD 2PYOC 5AV5C 1N1JA 4J8VD 2CV5C 5JRGB 5B0YD 1P34C 1P3BB 3MNNC 5AV9A 3R45A 4QLCD 1P3FA 3LZ1C 5B1LA 3MGQA 5G49A 4J8WB 1KX3C 3AZGB 5DNNB 3MGSB 5B33A 4Z66B 3B0DC 3O62A 3MGPD 5AV8D 4G92C 1HTAA 5B32C 3AYWD 2NQBD 3REJD 1S32B 4HGAB 1P3IB 5GSUB 3W99D 5B1LC 4XUJA 4WU9B 3UT9A 1ULYA 2F8ND 5BO0B 4ZUXA 1JFIB 3WAAC 3A6NA 5GT0B 2AROA 5AV9D 4XUJC 3X1UA 3WA9B 3UT9C 4Z2MH 5B24B 1U35B 1P3FD 3KXBC 3MGQD 3REIB 4J8UB 4WNNA 5B33D 4YS3A 1TZYA 3O62D 3UTBC 1KX4B 3RELD 3A6NC 5BNXA 5B2JC 3WKJA 3AZMB 1WWSA 5GXQA 1BH9A 2IO5C 3NQUB 4H9PA 5B40D 3X1VC 5B2IB 3AZJC 2HIOC 4YS3C 4Z2MG 5JA4B 1B67A 1P3PB 4WV4B 3WTPA 4LD9C 1P3GA 2AROD 1KX5A 1F1EA 1P3KA 5BT1D 3AZEC 3AZNB 3W96B 1P3AD 3KUYA 3X1UD 3MVDC 4NE5A 5CPJB 4KHAB 4J8VB 5B0YB 4CSRA 4J8WA 4JJNA 4M6BA 3MGSA 1TZYD 3WKJD 4QLCB 5JRGC 1P3BC 3KSYA 5BS7A 5GXQD 3LZ0D 5E5AA 5B31G 1S32A 3MGPB 5AV8B 4J8WC 4J8XD 3AZGC 5DNNC 3MGSC 3AYWB 2NQBB 4Z66C 3REJB 1TZYB 3W99B 5BO0A 3WTPD 1JFIA 3X1SA 1P3GD 1S32C 4HGAC 3VH6T 1P3IC 5GSUC 1P3KD 2F8NG 3KUYD 4H9OB 4WU9C 2F8NB 1U35A 4JJND 5AV9B 1KX4A 3NQJA 5GT0C 3LJAA 1P3FB 3MGQB 5G49B 5B33B 5E5AD 3WA9C 3NQUA 5B24C 3O62B 3RELB 1U35C 5B2IA 3V9RB 3REIC 4J8UC 3AZKA 1P3MC 1KX4C 3AZMC 3AZLD 5B2IC 4KHAA 5B0YA 2AROB 4WU8D 3B0CT 1P3PC 5AVCD 1P3AB 4QLCA 3X1UB 3LJAD 3AZNC 3W96C 5B1MA 4KGCD 4XZQD 4WNNB 5CPJC 2NZDD 4Z5TA 4J8VC 5AV8A 5B0YC
chains in the Genus database with same CATH superfamily
5BNXB 5GXQB 3AZKD 1M19D 2NQBA 3LZ0B 3H0LC 4QLCC 1BH9B 4H9PB 3W99A 4J8XB 2Y2QA 3KWQA 3MGPC 5AV8C 4H9OA 2ZY4A 2F8NA 3WTPB 4E44A 3AYWC 4WZSB 1P3GB 2NQBC 3REJC 5CHLB 2UWXA 3VH5W 1KX5B 1P3KB 3W99C 3KUYB 3B6GD 2Y2OA 4CSRB 4JJNB 5B1MD 3VH6W 3WKJB 4Z5TD 3RELA 3V9RA 1P3LA 5KDMA 5AV9C 5E5AB 1P3FC 5B40A 2BYMB 3AN2A 3MGQC 2F8NK 3KWQD 5B33C 3O62C 3B0BA 3RELC 4AWLB 3AZLB 3X1SB 4NE3A 2Y2KA 1P3AA 1AOIA 3AL0C 3C1CD 5B0ZA 4WU8B 1M1AA 4UUZA 1T3UA 5AV5D 5AVCB 4ZUXC 3NQJB 3MNND 3LJAB 2AROC 1P3LD 2Y2LA 5BT1C 1P3AC 4KGCB 3LZ0A 4XZQB 3X1UC 2NZDB 2HUEB 3AN2D 4J8XA 3REHA 3AZKB 1H3OB 3H0RC 1M19B 1TZYC 3WKJC 1WWIA 5GXQC 3LZ0C 4H9RB 5AV6A 4J8XC 1AOID 5B0ZD 5CPID 4WJ3C 5AY8A 1M1AD 4H9QB 3WTPC 1P3GC 3B6GB 2F8NH 1KX5C 1P3KC 3IP4C 2DF4C 5B1MB 3KUYC 3TU4D 3AZFA 4Z5TB 2BYMA 1EQZA 3REHD 4JJNC 1ID3D 3EG5B 5FUGB 5DNMD 5AVBA 4DRBA 5BS7C 3AZLA 3KWQB 2FFFB 5F99A 5E5AC 4X23A 5AV6D 4R8PD 4WU8A 5AY8D 3AFAA 3AZHA 2F2AC 3P5JB 5AVCA 4AWLC 4LD9D 3AZLC 3AV1A 3X1SC 1HQ3D 4KGCA 4XZQA 5AV5B 3AZFD 2RVQD 2NZDA 3MNNB 1EQZD 3VH5A 4WU8C 1P3LB 5KDMB 1H3OA 1M19A 5AVCC 3C1BA 3LJAC 5AVBD 5B40B 3AN2B 2JCHA 2ZY3A 4NE6A 1B6WA 3MGRA 4KUDD 4KGCC 5F99D 4XZQC 4X23D 2NZDC 2HUEC 3X1TD 4H9RA 5CPKD 3W97D 1PZRA 3AZKC 1M19C 2YFVA 3AFAD 3AZHD 1BH8A 4H9QA 2ZM5A 1AOIB 3AZID 3AV1D 5B0ZB 3B6GA 5CPIB 1M1AB 4UUZB 3FDDA 1TAFA 1P3OA 4EO5B 3W98A 2YFWA 3AV2D 5FUGA 3C1BD 3TU4B 3B6GC 3REHB 3MGRD 5B1MC 1ID3B 4CAYB 4Z5TC 3LELD 5DNMB 2BYKB 3REID 4H9SA 1P3MD 3UTAD 2IO5B 4NFTA 2FJ7D 3REKD 5AV6B 3C1CA 4R8PB 3KWQC 5AY8B 4H9NB 2PYOA 5AV5A 1P3OD 2CV5A 4H9SC 3W98D 3B6FD 3MNNA 1R4VA 1HQ3B 4YM6D 3AZFB 1KX3A 1EQZB 2BG1A 1M18D 5BNVA 2L5AA 5B32A 5AVBB 1P3LC 1ZLAD 5CP6D 4KUDB 5F99B 4X23B 5B40C 3AN2C 3X1TB 5CPKB 3W97B 2CWEA 3EPHA 1F66D 5GT3D 5CPIA 5B31D 3AFAB 3AZHB 2PYOD 2CV5D 1P34D 3WAAA 3AZIB 3AV1B 3B0CW 1AOIC 3TU4A 3LZ1D 3KXBA 5B0ZC 5CPIC 1KX3D 1M1AC 3A1KA 1ID3A 4CAYA 3UTBA 4EO5C 3AV2B 5DNMA 3C1BB 5B2JA 2BYKA 5B32D 3MGRB 3EPJA 3TU4C 5C3IB 3LELB 3X1VA 5B1LD 3AZJA 3REHC 4R8PA 2HIOA 1P3MB 1ID3C 3UTAB 2YFVB 4ZBJB 5DNMC 1BH8B 4H9NA 2FJ7B 3REKB 4LD9A 3WAAD 2Y2HA 1HQ3A 3AZEA 1KU5A 4XUJD 3MVDA 1TAFB 5AV6C 4DRAA 4DQYB 4R8PC 3UT9D 1P3OB 3KXBD 3W98B 3B6FB 5AY8C 4YM6B 2YFWB 3UTBD 4ZUXD 5JRGA 1A7WA 3A6ND 5B2JD 1P3BA 1HQ3C 2DQNC 4KUDA 1M18B 3AZFC 2RVQC 3X1VD 3X1TA 3AZJD 3W97A 3AZGA 5CPKA 1EQZC 4G91B 5DNNA 1ZLAB 2HIOD 5CP6B 4Z66A 4YS3D 2ZY5A 5AVBC 4J8VC 2Y2MA 3C1CB 3AZIA 1F66B 4KUDC 5F99C 5GT3B 1P3IA 5GSUA 5B31B 4X23C 3AZED 3X1TC 2PYOB 1Z2CB 3MVDD 4WU9A 5CPKC 2CV5B 3W97C 1P34B 3VH5T 3AFAC 3AZHC 1BFMA 4E45A 3AV2A 5JRGD 1P3BD 5GT0A 3AZIC 3AV1C 3LZ1B 1KX5D 1KX3B 3A1IA 3VH6A 3WA9A 2VQRA 3B0DB 1N1JB 5B24A 3LELA 5BNVB 5B32G 4J8WD 4G92B 3REIA 5B32B 3WTPE 4J8UA 3AZGD 5DNND 3MGSD 1P3MA 2J8PA 3F6TA 3R45B 4Z66D 3UTAA 3AV2C 3C1BC 3AZMA 2FJ7A 5B1LB 3REKA 3MGRC 1S32D 1P3ID 5GSUD 5C3IC 3LELC 1Q9CA 4WU9D 2Y2NA 3WAAB 3B6FA 3UTAC 4ZBJC 5JA4A 1P3PA 2FJ7C 4YM6A 4XUJB 3REKC 3H0MC 3UT9B 5GT0D 3X1SD 3KXBB 3AZNA 3W96A 1M18A 5CPJA 3WA9D 1P3OC 3UTBB 4J8VA 5B24D 4ZUXB 1U35D 3A6NB 3W98C 5B2JB 3B6FC 4J8UD 1ZLAA 5CP6A 2XD1A 4YM6C 2G5HC 2ZY2A 1KX4D 3AZMD 3X1VB 2G5IC 3AZJB 1M18C 1F66A 2HIOB 5GT3A 4YS3B 3MGPA 5B31A 5B2ID 4G91C 3AYWA 1P34A 1ZLAC 5CP6C 4LD9B 3REJA 2W8SA 3AZEB 1P3PD 2JSSA 3MVDB 3C1CC 3LZ1A 1F66C 5GT3C 2LY8A 5B31C 4UPKA 3AZND 3W96D 5CPJD 2PYOC 5AV5C 1N1JA 4J8VD 2CV5C 5JRGB 5B0YD 1P34C 1P3BB 2RIQA 3MNNC 5AV9A 3R45A 4QLCD 1P3FA 3LZ1C 5B1LA 3MGQA 5G49A 2Y2IA 4J8WB 3AZGB 1KX3C 5DNNB 3MGSB 5B33A 4Z66B 3B0DC 3O62A 3MGPD 5AV8D 4G92C 1HTAA 5B32C 3AYWD 2NQBD 3REJD 1S32B 4HGAB 1P3IB 5GSUB 3W99D 5B1LC 4XUJA 4WU9B 3UT9A 1ULYA 2F8ND 5BO0B 4ZUXA 1JFIB 3WAAC 3A6NA 5GT0B 2AROA 5AV9D 4XUJC 3X1UA 3WA9B 3UT9C 4Z2MH 5B24B 1U35B 1P3FD 3KXBC 3MGQD 3REIB 4J8UB 4WNNA 5B33D 4YS3A 3KFUG 1TZYA 3O62D 3UTBC 1KX4B 3RELD 3A6NC 5BNXA 5B2JC 3WKJA 3AZMB 1WWSA 5GXQA 1BH9A 2IO5C 3NQUB 4H9PA 5B40D 3X1VC 5B2IB 3AZJC 2HIOC 4YS3C 4Z2MG 5JA4B 1B67A 1P3PB 4WV4B 3WTPA 4LD9C 1P3GA 2AROD 1KX5A 1F1EA 1P3KA 5BT1D 3AZEC 3AZNB 3W96B 1P3AD 3KUYA 3X1UD 3MVDC 4NE5A 5CPJB 4KHAB 4J8VB 5B0YB 1W2EA 4CSRA 4J8WA 4JJNA 2JE5A 4M6BA 3MGSA 1TZYD 3WKJD 4QLCB 5JRGC 1P3BC 3KSYA 5BS7A 5GXQD 3LZ0D 5E5AA 5B31G 1S32A 3MGPB 5AV8B 4J8WC 4J8XD 3AZGC 2XD5A 5DNNC 3MGSC 3AYWB 2NQBB 4Z66C 3REJB 3W99B 5BO0A 3WTPD 1JFIA 3X1SA 1P3GD 1S32C 4HGAC 3VH6T 1P3IC 5GSUC 1P3KD 2Y2PA 3KUYD 4H9OB 2F8NG 4WU9C 2F8NB 1U35A 4JJND 5AV9B 1KX4A 3NQJA 4Z5TA 5GT0C 3LJAA 1P3FB 3MGQB 5G49B 2Y2JA 5E5AD 5B33B 3EPKA 3WA9C 3NQUA 5B24C 3O62B 3RELB 1U35C 5B2IA 3V9RB 3REIC 4J8UC 3AZKA 1P3MC 1KX4C 3AZMC 2Y2GA 3AZLD 5B2IC 4KHAA 5B0YA 2AROB 4WU8D 3B0CT 1P3PC 5AVCD 1P3AB 4QLCA 3X1UB 3LJAD 3AZNC 3W96C 5B1MA 4KGCD 4XZQD 4WNNB 5CPJC 2NZDD 1TZYB 3EPLA 5AV8A 5B0YC
chains in the Genus database with same CATH topology
5BNXB 5GXQB 3AZKD 1M19D 2NQBA 3LZ0B 3H0LC 4QLCC 1BH9B 4H9PB 3W99A 4J8XB 2Y2QA 3KWQA 3MGPC 5AV8C 4H9OA 2ZY4A 2F8NA 3WTPB 4E44A 3AYWC 4WZSB 1P3GB 2NQBC 3REJC 5CHLB 2UWXA 3VH5W 1KX5B 1P3KB 3W99C 3KUYB 3B6GD 2Y2OA 4CSRB 4JJNB 5B1MD 3VH6W 3WKJB 4Z5TD 3RELA 3V9RA 1P3LA 5KDMA 5AV9C 5E5AB 1P3FC 5B40A 2BYMB 3AN2A 3MGQC 2F8NK 3KWQD 5B33C 3O62C 3B0BA 3RELC 4AWLB 3AZLB 3X1SB 4NE3A 2Y2KA 1P3AA 1AOIA 3AL0C 3C1CD 5B0ZA 4WU8B 1M1AA 4UUZA 1T3UA 5AV5D 5AVCB 4ZUXC 3NQJB 3MNND 3LJAB 2AROC 1P3LD 2Y2LA 5BT1C 1P3AC 4KGCB 3LZ0A 4XZQB 3X1UC 2NZDB 2HUEB 3AN2D 4J8XA 3REHA 3AZKB 1H3OB 3H0RC 1M19B 1TZYC 3WKJC 1WWIA 5GXQC 3LZ0C 4H9RB 5AV6A 4J8XC 1AOID 5B0ZD 5CPID 4WJ3C 5AY8A 1M1AD 4H9QB 3WTPC 1P3GC 3B6GB 2F8NH 1KX5C 1P3KC 3IP4C 2DF4C 5B1MB 3KUYC 3TU4D 3AZFA 4Z5TB 2BYMA 1EQZA 3REHD 4JJNC 1ID3D 3EG5B 5FUGB 5DNMD 5AVBA 4DRBA 5BS7C 3AZLA 3KWQB 2FFFB 5F99A 5E5AC 4X23A 5AV6D 4R8PD 4WU8A 5AY8D 3AFAA 3AZHA 2F2AC 3P5JB 5AVCA 4AWLC 4LD9D 3AZLC 3AV1A 3X1SC 1HQ3D 4KGCA 4XZQA 5AV5B 3AZFD 2RVQD 2NZDA 3MNNB 1EQZD 3VH5A 4WU8C 1P3LB 5KDMB 1H3OA 1M19A 5AVCC 3C1BA 3LJAC 5AVBD 5B40B 3AN2B 2JCHA 2ZY3A 4NE6A 1B6WA 3MGRA 4KUDD 4KGCC 5F99D 4XZQC 4X23D 2NZDC 2HUEC 3X1TD 4H9RA 5CPKD 3W97D 1PZRA 3AZKC 1M19C 2YFVA 3AFAD 3AZHD 1BH8A 4H9QA 2ZM5A 1AOIB 3AZID 3AV1D 5B0ZB 3B6GA 5CPIB 1M1AB 4UUZB 3FDDA 1TAFA 1P3OA 4EO5B 3W98A 2YFWA 3AV2D 5FUGA 3C1BD 3TU4B 3B6GC 3REHB 3MGRD 5B1MC 1ID3B 4CAYB 4Z5TC 3LELD 5DNMB 2BYKB 3REID 4H9SA 1P3MD 3UTAD 2IO5B 4NFTA 2FJ7D 3REKD 5AV6B 3C1CA 4R8PB 3KWQC 5AY8B 4H9NB 2PYOA 5AV5A 1P3OD 2CV5A 4H9SC 3W98D 3B6FD 3MNNA 1R4VA 1HQ3B 4YM6D 3AZFB 1KX3A 1EQZB 2BG1A 1M18D 5BNVA 2L5AA 5B32A 5AVBB 1P3LC 1ZLAD 5CP6D 4KUDB 5F99B 4X23B 5B40C 3AN2C 3X1TB 5CPKB 3W97B 2CWEA 3EPHA 1F66D 5GT3D 5CPIA 5B31D 3AFAB 3AZHB 2PYOD 2CV5D 1P34D 3WAAA 3AZIB 3AV1B 3B0CW 1AOIC 3TU4A 3LZ1D 3KXBA 5B0ZC 5CPIC 1KX3D 1M1AC 3A1KA 1ID3A 4CAYA 3UTBA 4EO5C 3AV2B 5DNMA 3C1BB 5B2JA 2BYKA 5B32D 3MGRB 3EPJA 3TU4C 5C3IB 3LELB 3X1VA 5B1LD 3AZJA 3REHC 4R8PA 2HIOA 1P3MB 1ID3C 3UTAB 2YFVB 4ZBJB 5DNMC 1BH8B 4H9NA 2FJ7B 3REKB 4LD9A 3WAAD 2Y2HA 1HQ3A 3AZEA 1KU5A 4XUJD 3MVDA 1TAFB 5AV6C 4DRAA 4DQYB 4R8PC 3UT9D 1P3OB 3KXBD 3W98B 3B6FB 5AY8C 4YM6B 2YFWB 3UTBD 4ZUXD 5JRGA 1A7WA 3A6ND 5B2JD 1P3BA 1HQ3C 2DQNC 4KUDA 1M18B 3AZFC 2RVQC 3X1VD 3X1TA 3AZJD 3W97A 3AZGA 5CPKA 1EQZC 4G91B 5DNNA 1ZLAB 2HIOD 5CP6B 4Z66A 4YS3D 2ZY5A 5AVBC 4J8VC 2Y2MA 3C1CB 3AZIA 1F66B 4KUDC 5F99C 5GT3B 1P3IA 5GSUA 5B31B 4X23C 3AZED 3X1TC 2PYOB 1Z2CB 3MVDD 4WU9A 5CPKC 2CV5B 3W97C 1P34B 3VH5T 3AFAC 3AZHC 1BFMA 4E45A 3AV2A 5JRGD 1P3BD 5GT0A 3AZIC 3AV1C 3LZ1B 1KX5D 1KX3B 3A1IA 3VH6A 3WA9A 2VQRA 3B0DB 1N1JB 5B24A 3LELA 5BNVB 5B32G 4J8WD 4G92B 3REIA 5B32B 3WTPE 4J8UA 3AZGD 5DNND 3MGSD 1P3MA 2J8PA 3F6TA 3R45B 4Z66D 3UTAA 3AV2C 3C1BC 3AZMA 2FJ7A 5B1LB 3REKA 3MGRC 1S32D 1P3ID 5GSUD 5C3IC 3LELC 1Q9CA 4WU9D 2Y2NA 3WAAB 3B6FA 3UTAC 4ZBJC 5JA4A 1P3PA 2FJ7C 4YM6A 4XUJB 3REKC 3H0MC 3UT9B 5GT0D 3X1SD 3KXBB 3AZNA 3W96A 1M18A 5CPJA 3WA9D 1P3OC 3UTBB 4J8VA 5B24D 4ZUXB 1U35D 3A6NB 3W98C 5B2JB 3B6FC 4J8UD 1ZLAA 5CP6A 2XD1A 4YM6C 2G5HC 2ZY2A 1KX4D 3AZMD 3X1VB 2G5IC 3AZJB 1M18C 1F66A 2HIOB 5GT3A 4YS3B 3MGPA 5B31A 5B2ID 4G91C 3AYWA 1P34A 1ZLAC 5CP6C 4LD9B 3REJA 2W8SA 3AZEB 1P3PD 2JSSA 3MVDB 3C1CC 3LZ1A 1F66C 5GT3C 2LY8A 5B31C 4UPKA 3AZND 3W96D 5CPJD 2PYOC 5AV5C 1N1JA 4J8VD 2CV5C 5JRGB 5B0YD 1P34C 1P3BB 2RIQA 3MNNC 5AV9A 3R45A 4QLCD 1P3FA 3LZ1C 5B1LA 3MGQA 5G49A 2Y2IA 4J8WB 3AZGB 1KX3C 5DNNB 3MGSB 5B33A 4Z66B 3B0DC 3O62A 3MGPD 5AV8D 4G92C 1HTAA 5B32C 3AYWD 2NQBD 3REJD 1S32B 4HGAB 1P3IB 5GSUB 3W99D 5B1LC 4XUJA 4WU9B 3UT9A 1ULYA 2F8ND 5BO0B 4ZUXA 1JFIB 3WAAC 3A6NA 5GT0B 2AROA 5AV9D 4XUJC 3X1UA 3WA9B 3UT9C 4Z2MH 5B24B 1U35B 1P3FD 3KXBC 3MGQD 3REIB 4J8UB 4WNNA 5B33D 4YS3A 3KFUG 1TZYA 3O62D 3UTBC 1KX4B 3RELD 3A6NC 5BNXA 5B2JC 3WKJA 3AZMB 1WWSA 5GXQA 1BH9A 2IO5C 3NQUB 4H9PA 5B40D 3X1VC 5B2IB 3AZJC 2HIOC 4YS3C 4Z2MG 5JA4B 1B67A 1P3PB 4WV4B 3WTPA 4LD9C 1P3GA 2AROD 1KX5A 1F1EA 1P3KA 5BT1D 3AZEC 3AZNB 3W96B 1P3AD 3KUYA 3X1UD 3MVDC 4NE5A 5CPJB 4KHAB 4J8VB 5B0YB 1W2EA 4CSRA 4J8WA 4JJNA 2JE5A 4M6BA 3MGSA 1TZYD 3WKJD 4QLCB 5JRGC 1P3BC 3KSYA 5BS7A 5GXQD 3LZ0D 5E5AA 5B31G 1S32A 3MGPB 5AV8B 4J8WC 4J8XD 3AZGC 2XD5A 5DNNC 3MGSC 3AYWB 2NQBB 4Z66C 3REJB 3W99B 5BO0A 3WTPD 1JFIA 3X1SA 1P3GD 1S32C 4HGAC 3VH6T 1P3IC 5GSUC 1P3KD 2Y2PA 3KUYD 4H9OB 2F8NG 4WU9C 2F8NB 1U35A 4JJND 5AV9B 1KX4A 3NQJA 4Z5TA 5GT0C 3LJAA 1P3FB 3MGQB 5G49B 2Y2JA 5E5AD 5B33B 3EPKA 3WA9C 3NQUA 5B24C 3O62B 3RELB 1U35C 5B2IA 3V9RB 3REIC 4J8UC 3AZKA 1P3MC 1KX4C 3AZMC 2Y2GA 3AZLD 5B2IC 4KHAA 5B0YA 2AROB 4WU8D 3B0CT 1P3PC 5AVCD 1P3AB 4QLCA 3X1UB 3LJAD 3AZNC 3W96C 5B1MA 4KGCD 4XZQD 4WNNB 5CPJC 2NZDD 1TZYB 3EPLA 5AV8A 5B0YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX B;  5GXQ B;  3AZK D;  1M19 D;  2NQB A;  3LZ0 B;  4QLC C;  1BH9 B;  4H9P B;  3W99 A;  4J8X B;  3KWQ A;  3MGP C;  5AV8 C;  4H9O A;  2F8N A;  3WTP B;  4E44 A;  3AYW C;  4WZS B;  1P3G B;  2NQB C;  3REJ C;  5CHL B;  3VH5 W;  1KX5 B;  1P3K B;  3W99 C;  3KUY B;  3B6G D;  4CSR B;  4JJN B;  5B1M D;  3VH6 W;  3WKJ B;  4Z5T D;  3REL A;  3V9R A;  1P3L A;  5KDM A;  5AV9 C;  5E5A B;  1P3F C;  5B40 A;  2BYM B;  3AN2 A;  3MGQ C;  2F8N K;  3KWQ D;  5B33 C;  3O62 C;  3B0B A;  3REL C;  4AWL B;  3AZL B;  3X1S B;  4NE3 A;  1P3A A;  1AOI A;  3C1C D;  5B0Z A;  4WU8 B;  1M1A A;  4UUZ A;  5AV5 D;  5AVC B;  4ZUX C;  3NQJ B;  3MNN D;  3LJA B;  2ARO C;  1P3L D;  5BT1 C;  1P3A C;  4KGC B;  3LZ0 A;  4XZQ B;  3X1U C;  2NZD B;  2HUE B;  3AN2 D;  4J8X A;  3REH A;  3AZK B;  1H3O B;  1M19 B;  1TZY C;  3WKJ C;  1WWI A;  5GXQ C;  3LZ0 C;  4H9R B;  5AV6 A;  4J8X C;  1AOI D;  5B0Z D;  5CPI D;  5AY8 A;  1M1A D;  4H9Q B;  3WTP C;  1P3G C;  3B6G B;  2F8N H;  1KX5 C;  1P3K C;  5B1M B;  3KUY C;  3TU4 D;  3AZF A;  4Z5T B;  2BYM A;  1EQZ A;  3REH D;  4JJN C;  1ID3 D;  5FUG B;  5DNM D;  5AVB A;  4DRB A;  5BS7 C;  3AZL A;  3KWQ B;  5F99 A;  5E5A C;  4X23 A;  5AV6 D;  4R8P D;  4WU8 A;  5AY8 D;  3AFA A;  3AZH A;  5AVC A;  4AWL C;  4LD9 D;  3AZL C;  3AV1 A;  3X1S C;  1HQ3 D;  4KGC A;  4XZQ A;  5AV5 B;  3AZF D;  2RVQ D;  2NZD A;  3MNN B;  1EQZ D;  3VH5 A;  4WU8 C;  1P3L B;  5KDM B;  1H3O A;  1M19 A;  5AVC C;  3C1B A;  3LJA C;  5AVB D;  5B40 B;  3AN2 B;  4NE6 A;  1B6W A;  3MGR A;  4KUD D;  4KGC C;  5F99 D;  4XZQ C;  4X23 D;  2NZD C;  2HUE C;  3X1T D;  4H9R A;  5CPK D;  3W97 D;  3AZK C;  1M19 C;  2YFV A;  3AFA D;  3AZH D;  1BH8 A;  4H9Q A;  1AOI B;  3AZI D;  3AV1 D;  5B0Z B;  3B6G A;  5CPI B;  1M1A B;  4UUZ B;  1TAF A;  1P3O A;  4EO5 B;  3W98 A;  2YFW A;  3AV2 D;  5FUG A;  3C1B D;  3TU4 B;  3B6G C;  3REH B;  3MGR D;  5B1M C;  1ID3 B;  4CAY B;  4Z5T C;  3LEL D;  5DNM B;  2BYK B;  3REI D;  4H9S A;  1P3M D;  3UTA D;  2IO5 B;  4NFT A;  2FJ7 D;  3REK D;  5AV6 B;  3C1C A;  4R8P B;  3KWQ C;  5AY8 B;  4H9N B;  2PYO A;  5AV5 A;  1P3O D;  2CV5 A;  4H9S C;  3W98 D;  3B6F D;  3MNN A;  1R4V A;  1HQ3 B;  4YM6 D;  3AZF B;  1KX3 A;  1EQZ B;  1M18 D;  5BNV A;  2L5A A;  5B32 A;  5AVB B;  1P3L C;  1ZLA D;  5CP6 D;  4KUD B;  5F99 B;  4X23 B;  5B40 C;  3AN2 C;  3X1T B;  5CPK B;  3W97 B;  2CWE A;  1F66 D;  5GT3 D;  5CPI A;  5B31 D;  3AFA B;  3AZH B;  2PYO D;  2CV5 D;  1P34 D;  3WAA A;  3AZI B;  3AV1 B;  3B0C W;  1AOI C;  3TU4 A;  3LZ1 D;  3KXB A;  5B0Z C;  5CPI C;  1KX3 D;  1M1A C;  1ID3 A;  4CAY A;  3UTB A;  4EO5 C;  3AV2 B;  5DNM A;  3C1B B;  5B2J A;  2BYK A;  5B32 D;  3MGR B;  3TU4 C;  5C3I B;  3LEL B;  3X1V A;  5B1L D;  3AZJ A;  3REH C;  4R8P A;  2HIO A;  1P3M B;  1ID3 C;  3UTA B;  2YFV B;  4ZBJ B;  5DNM C;  1BH8 B;  4H9N A;  2FJ7 B;  3REK B;  4LD9 A;  3WAA D;  1HQ3 A;  3AZE A;  1KU5 A;  4XUJ D;  3MVD A;  1TAF B;  5AV6 C;  4DRA A;  3UT9 D;  4R8P C;  1P3O B;  3KXB D;  3W98 B;  3B6F B;  5AY8 C;  4YM6 B;  2YFW B;  3UTB D;  4ZUX D;  5JRG A;  1A7W A;  3A6N D;  5B2J D;  1P3B A;  1HQ3 C;  4KUD A;  1M18 B;  3AZF C;  2RVQ C;  3X1V D;  3X1T A;  3AZJ D;  3W97 A;  3AZG A;  5CPK A;  1EQZ C;  4G91 B;  5DNN A;  1ZLA B;  2HIO D;  5CP6 B;  4Z66 A;  4YS3 D;  5AVB C;  3C1C B;  3AZI A;  4KUD C;  1F66 B;  5F99 C;  5GT3 B;  1P3I A;  5GSU A;  5B31 B;  4X23 C;  3AZE D;  3X1T C;  2PYO B;  3MVD D;  4WU9 A;  5CPK C;  3W97 C;  2CV5 B;  1P34 B;  3VH5 T;  3AFA C;  3AZH C;  1BFM A;  4E45 A;  3AV2 A;  5JRG D;  1P3B D;  5GT0 A;  3AZI C;  3AV1 C;  3LZ1 B;  1KX5 D;  1KX3 B;  3VH6 A;  3WA9 A;  3B0D B;  1N1J B;  5B24 A;  3LEL A;  5BNV B;  5B32 G;  4J8W D;  4G92 B;  3REI A;  5B32 B;  3WTP E;  4J8U A;  3AZG D;  5DNN D;  3MGS D;  1P3M A;  3R45 B;  3UTA A;  4Z66 D;  3AV2 C;  3C1B C;  3AZM A;  2FJ7 A;  5B1L B;  3REK A;  3MGR C;  1S32 D;  1P3I D;  5GSU D;  5C3I C;  3LEL C;  1Q9C A;  4WU9 D;  3WAA B;  3B6F A;  3UTA C;  4ZBJ C;  5JA4 A;  1P3P A;  2FJ7 C;  4YM6 A;  4XUJ B;  3REK C;  3UT9 B;  5GT0 D;  3X1S D;  3KXB B;  3AZN A;  3W96 A;  1M18 A;  5CPJ A;  3WA9 D;  1P3O C;  3UTB B;  4J8V A;  5B24 D;  4ZUX B;  1U35 D;  3A6N B;  3W98 C;  5B2J B;  3B6F C;  4J8U D;  1ZLA A;  5CP6 A;  4YM6 C;  1KX4 D;  3AZM D;  3X1V B;  3AZJ B;  1M18 C;  1F66 A;  2HIO B;  5GT3 A;  4YS3 B;  3MGP A;  5B31 A;  5B2I D;  4G91 C;  3AYW A;  1P34 A;  1ZLA C;  5CP6 C;  4LD9 B;  3REJ A;  3AZE B;  1P3P D;  2JSS A;  3MVD B;  3C1C C;  3LZ1 A;  1F66 C;  5GT3 C;  2LY8 A;  5B31 C;  3AZN D;  3W96 D;  5CPJ D;  2PYO C;  5AV5 C;  1N1J A;  4J8V D;  2CV5 C;  5JRG B;  5B0Y D;  1P34 C;  1P3B B;  3MNN C;  5AV9 A;  3R45 A;  4QLC D;  1P3F A;  3LZ1 C;  5B1L A;  3MGQ A;  5G49 A;  4J8W B;  1KX3 C;  3AZG B;  5DNN B;  3MGS B;  5B33 A;  4Z66 B;  3B0D C;  3O62 A;  3MGP D;  5AV8 D;  4G92 C;  1HTA A;  5B32 C;  3AYW D;  2NQB D;  3REJ D;  1S32 B;  4HGA B;  1P3I B;  5GSU B;  3W99 D;  5B1L C;  4XUJ A;  4WU9 B;  3UT9 A;  1ULY A;  2F8N D;  5BO0 B;  4ZUX A;  1JFI B;  3WAA C;  3A6N A;  5GT0 B;  2ARO A;  5AV9 D;  4XUJ C;  3X1U A;  3WA9 B;  3UT9 C;  4Z2M H;  5B24 B;  1U35 B;  1P3F D;  3KXB C;  3MGQ D;  3REI B;  4J8U B;  4WNN A;  5B33 D;  4YS3 A;  1TZY A;  3O62 D;  3UTB C;  1KX4 B;  3REL D;  3A6N C;  5BNX A;  5B2J C;  3WKJ A;  3AZM B;  1WWS A;  5GXQ A;  1BH9 A;  2IO5 C;  3NQU B;  4H9P A;  5B40 D;  3X1V C;  5B2I B;  3AZJ C;  2HIO C;  4YS3 C;  4Z2M G;  5JA4 B;  1B67 A;  1P3P B;  4WV4 B;  3WTP A;  4LD9 C;  1P3G A;  2ARO D;  1KX5 A;  1F1E A;  1P3K A;  5BT1 D;  3AZE C;  3AZN B;  3W96 B;  1P3A D;  3KUY A;  3X1U D;  3MVD C;  4NE5 A;  5CPJ B;  4KHA B;  4J8V B;  5B0Y B;  4CSR A;  4J8W A;  4JJN A;  4M6B A;  3MGS A;  1TZY D;  3WKJ D;  4QLC B;  5JRG C;  1P3B C;  3KSY A;  5BS7 A;  5GXQ D;  3LZ0 D;  5E5A A;  5B31 G;  1S32 A;  3MGP B;  5AV8 B;  4J8W C;  4J8X D;  3AZG C;  5DNN C;  3MGS C;  3AYW B;  2NQB B;  4Z66 C;  3REJ B;  1TZY B;  3W99 B;  5BO0 A;  3WTP D;  1JFI A;  3X1S A;  1P3G D;  1S32 C;  4HGA C;  3VH6 T;  1P3I C;  5GSU C;  1P3K D;  2F8N G;  3KUY D;  4H9O B;  4WU9 C;  2F8N B;  1U35 A;  4JJN D;  5AV9 B;  1KX4 A;  3NQJ A;  5GT0 C;  3LJA A;  1P3F B;  3MGQ B;  5G49 B;  5B33 B;  5E5A D;  3WA9 C;  3NQU A;  5B24 C;  3O62 B;  3REL B;  1U35 C;  5B2I A;  3V9R B;  3REI C;  4J8U C;  3AZK A;  1P3M C;  1KX4 C;  3AZM C;  3AZL D;  5B2I C;  4KHA A;  5B0Y A;  2ARO B;  4WU8 D;  3B0C T;  1P3P C;  5AVC D;  1P3A B;  4QLC A;  3X1U B;  3LJA D;  3AZN C;  3W96 C;  5B1M A;  4KGC D;  4XZQ D;  4WNN B;  5CPJ C;  2NZD D;  4Z5T A;  4J8V C;  5AV8 A;  5B0Y C; 
#chains in the Genus database with same CATH topology
 5BNX B;  5GXQ B;  3AZK D;  1M19 D;  2NQB A;  3LZ0 B;  3H0L C;  4QLC C;  1BH9 B;  4H9P B;  3W99 A;  4J8X B;  2Y2Q A;  3KWQ A;  3MGP C;  5AV8 C;  4H9O A;  2ZY4 A;  2F8N A;  3WTP B;  4E44 A;  3AYW C;  4WZS B;  1P3G B;  2NQB C;  3REJ C;  5CHL B;  2UWX A;  3VH5 W;  1KX5 B;  1P3K B;  3W99 C;  3KUY B;  3B6G D;  2Y2O A;  4CSR B;  4JJN B;  5B1M D;  3VH6 W;  3WKJ B;  4Z5T D;  3REL A;  3V9R A;  1P3L A;  5KDM A;  5AV9 C;  5E5A B;  1P3F C;  5B40 A;  2BYM B;  3AN2 A;  3MGQ C;  2F8N K;  3KWQ D;  5B33 C;  3O62 C;  3B0B A;  3REL C;  4AWL B;  3AZL B;  3X1S B;  4NE3 A;  2Y2K A;  1P3A A;  1AOI A;  3AL0 C;  3C1C D;  5B0Z A;  4WU8 B;  1M1A A;  4UUZ A;  1T3U A;  5AV5 D;  5AVC B;  4ZUX C;  3NQJ B;  3MNN D;  3LJA B;  2ARO C;  1P3L D;  2Y2L A;  5BT1 C;  1P3A C;  4KGC B;  3LZ0 A;  4XZQ B;  3X1U C;  2NZD B;  2HUE B;  3AN2 D;  4J8X A;  3REH A;  3AZK B;  1H3O B;  3H0R C;  1M19 B;  1TZY C;  3WKJ C;  1WWI A;  5GXQ C;  3LZ0 C;  4H9R B;  5AV6 A;  4J8X C;  1AOI D;  5B0Z D;  5CPI D;  4WJ3 C;  5AY8 A;  1M1A D;  4H9Q B;  3WTP C;  1P3G C;  3B6G B;  2F8N H;  1KX5 C;  1P3K C;  3IP4 C;  2DF4 C;  5B1M B;  3KUY C;  3TU4 D;  3AZF A;  4Z5T B;  2BYM A;  1EQZ A;  3REH D;  4JJN C;  1ID3 D;  3EG5 B;  5FUG B;  5DNM D;  5AVB A;  4DRB A;  5BS7 C;  3AZL A;  3KWQ B;  2FFF B;  5F99 A;  5E5A C;  4X23 A;  5AV6 D;  4R8P D;  4WU8 A;  5AY8 D;  3AFA A;  3AZH A;  2F2A C;  3P5J B;  5AVC A;  4AWL C;  4LD9 D;  3AZL C;  3AV1 A;  3X1S C;  1HQ3 D;  4KGC A;  4XZQ A;  5AV5 B;  3AZF D;  2RVQ D;  2NZD A;  3MNN B;  1EQZ D;  3VH5 A;  4WU8 C;  1P3L B;  5KDM B;  1H3O A;  1M19 A;  5AVC C;  3C1B A;  3LJA C;  5AVB D;  5B40 B;  3AN2 B;  2JCH A;  2ZY3 A;  4NE6 A;  1B6W A;  3MGR A;  4KUD D;  4KGC C;  5F99 D;  4XZQ C;  4X23 D;  2NZD C;  2HUE C;  3X1T D;  4H9R A;  5CPK D;  3W97 D;  1PZR A;  3AZK C;  1M19 C;  2YFV A;  3AFA D;  3AZH D;  1BH8 A;  4H9Q A;  2ZM5 A;  1AOI B;  3AZI D;  3AV1 D;  5B0Z B;  3B6G A;  5CPI B;  1M1A B;  4UUZ B;  3FDD A;  1TAF A;  1P3O A;  4EO5 B;  3W98 A;  2YFW A;  3AV2 D;  5FUG A;  3C1B D;  3TU4 B;  3B6G C;  3REH B;  3MGR D;  5B1M C;  1ID3 B;  4CAY B;  4Z5T C;  3LEL D;  5DNM B;  2BYK B;  3REI D;  4H9S A;  1P3M D;  3UTA D;  2IO5 B;  4NFT A;  2FJ7 D;  3REK D;  5AV6 B;  3C1C A;  4R8P B;  3KWQ C;  5AY8 B;  4H9N B;  2PYO A;  5AV5 A;  1P3O D;  2CV5 A;  4H9S C;  3W98 D;  3B6F D;  3MNN A;  1R4V A;  1HQ3 B;  4YM6 D;  3AZF B;  1KX3 A;  1EQZ B;  2BG1 A;  1M18 D;  5BNV A;  2L5A A;  5B32 A;  5AVB B;  1P3L C;  1ZLA D;  5CP6 D;  4KUD B;  5F99 B;  4X23 B;  5B40 C;  3AN2 C;  3X1T B;  5CPK B;  3W97 B;  2CWE A;  3EPH A;  1F66 D;  5GT3 D;  5CPI A;  5B31 D;  3AFA B;  3AZH B;  2PYO D;  2CV5 D;  1P34 D;  3WAA A;  3AZI B;  3AV1 B;  3B0C W;  1AOI C;  3TU4 A;  3LZ1 D;  3KXB A;  5B0Z C;  5CPI C;  1KX3 D;  1M1A C;  3A1K A;  1ID3 A;  4CAY A;  3UTB A;  4EO5 C;  3AV2 B;  5DNM A;  3C1B B;  5B2J A;  2BYK A;  5B32 D;  3MGR B;  3EPJ A;  3TU4 C;  5C3I B;  3LEL B;  3X1V A;  5B1L D;  3AZJ A;  3REH C;  4R8P A;  2HIO A;  1P3M B;  1ID3 C;  3UTA B;  2YFV B;  4ZBJ B;  5DNM C;  1BH8 B;  4H9N A;  2FJ7 B;  3REK B;  4LD9 A;  3WAA D;  2Y2H A;  1HQ3 A;  3AZE A;  1KU5 A;  4XUJ D;  3MVD A;  1TAF B;  5AV6 C;  4DRA A;  4DQY B;  4R8P C;  3UT9 D;  1P3O B;  3KXB D;  3W98 B;  3B6F B;  5AY8 C;  4YM6 B;  2YFW B;  3UTB D;  4ZUX D;  5JRG A;  1A7W A;  3A6N D;  5B2J D;  1P3B A;  1HQ3 C;  2DQN C;  4KUD A;  1M18 B;  3AZF C;  2RVQ C;  3X1V D;  3X1T A;  3AZJ D;  3W97 A;  3AZG A;  5CPK A;  1EQZ C;  4G91 B;  5DNN A;  1ZLA B;  2HIO D;  5CP6 B;  4Z66 A;  4YS3 D;  2ZY5 A;  5AVB C;  4J8V C;  2Y2M A;  3C1C B;  3AZI A;  1F66 B;  4KUD C;  5F99 C;  5GT3 B;  1P3I A;  5GSU A;  5B31 B;  4X23 C;  3AZE D;  3X1T C;  2PYO B;  1Z2C B;  3MVD D;  4WU9 A;  5CPK C;  2CV5 B;  3W97 C;  1P34 B;  3VH5 T;  3AFA C;  3AZH C;  1BFM A;  4E45 A;  3AV2 A;  5JRG D;  1P3B D;  5GT0 A;  3AZI C;  3AV1 C;  3LZ1 B;  1KX5 D;  1KX3 B;  3A1I A;  3VH6 A;  3WA9 A;  2VQR A;  3B0D B;  1N1J B;  5B24 A;  3LEL A;  5BNV B;  5B32 G;  4J8W D;  4G92 B;  3REI A;  5B32 B;  3WTP E;  4J8U A;  3AZG D;  5DNN D;  3MGS D;  1P3M A;  2J8P A;  3F6T A;  3R45 B;  4Z66 D;  3UTA A;  3AV2 C;  3C1B C;  3AZM A;  2FJ7 A;  5B1L B;  3REK A;  3MGR C;  1S32 D;  1P3I D;  5GSU D;  5C3I C;  3LEL C;  1Q9C A;  4WU9 D;  2Y2N A;  3WAA B;  3B6F A;  3UTA C;  4ZBJ C;  5JA4 A;  1P3P A;  2FJ7 C;  4YM6 A;  4XUJ B;  3REK C;  3H0M C;  3UT9 B;  5GT0 D;  3X1S D;  3KXB B;  3AZN A;  3W96 A;  1M18 A;  5CPJ A;  3WA9 D;  1P3O C;  3UTB B;  4J8V A;  5B24 D;  4ZUX B;  1U35 D;  3A6N B;  3W98 C;  5B2J B;  3B6F C;  4J8U D;  1ZLA A;  5CP6 A;  2XD1 A;  4YM6 C;  2G5H C;  2ZY2 A;  1KX4 D;  3AZM D;  3X1V B;  2G5I C;  3AZJ B;  1M18 C;  1F66 A;  2HIO B;  5GT3 A;  4YS3 B;  3MGP A;  5B31 A;  5B2I D;  4G91 C;  3AYW A;  1P34 A;  1ZLA C;  5CP6 C;  4LD9 B;  3REJ A;  2W8S A;  3AZE B;  1P3P D;  2JSS A;  3MVD B;  3C1C C;  3LZ1 A;  1F66 C;  5GT3 C;  2LY8 A;  5B31 C;  4UPK A;  3AZN D;  3W96 D;  5CPJ D;  2PYO C;  5AV5 C;  1N1J A;  4J8V D;  2CV5 C;  5JRG B;  5B0Y D;  1P34 C;  1P3B B;  2RIQ A;  3MNN C;  5AV9 A;  3R45 A;  4QLC D;  1P3F A;  3LZ1 C;  5B1L A;  3MGQ A;  5G49 A;  2Y2I A;  4J8W B;  3AZG B;  1KX3 C;  5DNN B;  3MGS B;  5B33 A;  4Z66 B;  3B0D C;  3O62 A;  3MGP D;  5AV8 D;  4G92 C;  1HTA A;  5B32 C;  3AYW D;  2NQB D;  3REJ D;  1S32 B;  4HGA B;  1P3I B;  5GSU B;  3W99 D;  5B1L C;  4XUJ A;  4WU9 B;  3UT9 A;  1ULY A;  2F8N D;  5BO0 B;  4ZUX A;  1JFI B;  3WAA C;  3A6N A;  5GT0 B;  2ARO A;  5AV9 D;  4XUJ C;  3X1U A;  3WA9 B;  3UT9 C;  4Z2M H;  5B24 B;  1U35 B;  1P3F D;  3KXB C;  3MGQ D;  3REI B;  4J8U B;  4WNN A;  5B33 D;  4YS3 A;  3KFU G;  1TZY A;  3O62 D;  3UTB C;  1KX4 B;  3REL D;  3A6N C;  5BNX A;  5B2J C;  3WKJ A;  3AZM B;  1WWS A;  5GXQ A;  1BH9 A;  2IO5 C;  3NQU B;  4H9P A;  5B40 D;  3X1V C;  5B2I B;  3AZJ C;  2HIO C;  4YS3 C;  4Z2M G;  5JA4 B;  1B67 A;  1P3P B;  4WV4 B;  3WTP A;  4LD9 C;  1P3G A;  2ARO D;  1KX5 A;  1F1E A;  1P3K A;  5BT1 D;  3AZE C;  3AZN B;  3W96 B;  1P3A D;  3KUY A;  3X1U D;  3MVD C;  4NE5 A;  5CPJ B;  4KHA B;  4J8V B;  5B0Y B;  1W2E A;  4CSR A;  4J8W A;  4JJN A;  2JE5 A;  4M6B A;  3MGS A;  1TZY D;  3WKJ D;  4QLC B;  5JRG C;  1P3B C;  3KSY A;  5BS7 A;  5GXQ D;  3LZ0 D;  5E5A A;  5B31 G;  1S32 A;  3MGP B;  5AV8 B;  4J8W C;  4J8X D;  3AZG C;  2XD5 A;  5DNN C;  3MGS C;  3AYW B;  2NQB B;  4Z66 C;  3REJ B;  3W99 B;  5BO0 A;  3WTP D;  1JFI A;  3X1S A;  1P3G D;  1S32 C;  4HGA C;  3VH6 T;  1P3I C;  5GSU C;  1P3K D;  2Y2P A;  3KUY D;  4H9O B;  2F8N G;  4WU9 C;  2F8N B;  1U35 A;  4JJN D;  5AV9 B;  1KX4 A;  3NQJ A;  4Z5T A;  5GT0 C;  3LJA A;  1P3F B;  3MGQ B;  5G49 B;  2Y2J A;  5E5A D;  5B33 B;  3EPK A;  3WA9 C;  3NQU A;  5B24 C;  3O62 B;  3REL B;  1U35 C;  5B2I A;  3V9R B;  3REI C;  4J8U C;  3AZK A;  1P3M C;  1KX4 C;  3AZM C;  2Y2G A;  3AZL D;  5B2I C;  4KHA A;  5B0Y A;  2ARO B;  4WU8 D;  3B0C T;  1P3P C;  5AVC D;  1P3A B;  4QLC A;  3X1U B;  3LJA D;  3AZN C;  3W96 C;  5B1M A;  4KGC D;  4XZQ D;  4WNN B;  5CPJ C;  2NZD D;  1TZY B;  3EPL A;  5AV8 A;  5B0Y C; 
#chains in the Genus database with same CATH homology
 5BNX B;  5GXQ B;  3AZK D;  1M19 D;  2NQB A;  3LZ0 B;  3H0L C;  4QLC C;  1BH9 B;  4H9P B;  3W99 A;  4J8X B;  2Y2Q A;  3KWQ A;  3MGP C;  5AV8 C;  4H9O A;  2ZY4 A;  2F8N A;  3WTP B;  4E44 A;  3AYW C;  4WZS B;  1P3G B;  2NQB C;  3REJ C;  5CHL B;  2UWX A;  3VH5 W;  1KX5 B;  1P3K B;  3W99 C;  3KUY B;  3B6G D;  2Y2O A;  4CSR B;  4JJN B;  5B1M D;  3VH6 W;  3WKJ B;  4Z5T D;  3REL A;  3V9R A;  1P3L A;  5KDM A;  5AV9 C;  5E5A B;  1P3F C;  5B40 A;  2BYM B;  3AN2 A;  3MGQ C;  2F8N K;  3KWQ D;  5B33 C;  3O62 C;  3B0B A;  3REL C;  4AWL B;  3AZL B;  3X1S B;  4NE3 A;  2Y2K A;  1P3A A;  1AOI A;  3AL0 C;  3C1C D;  5B0Z A;  4WU8 B;  1M1A A;  4UUZ A;  1T3U A;  5AV5 D;  5AVC B;  4ZUX C;  3NQJ B;  3MNN D;  3LJA B;  2ARO C;  1P3L D;  2Y2L A;  5BT1 C;  1P3A C;  4KGC B;  3LZ0 A;  4XZQ B;  3X1U C;  2NZD B;  2HUE B;  3AN2 D;  4J8X A;  3REH A;  3AZK B;  1H3O B;  3H0R C;  1M19 B;  1TZY C;  3WKJ C;  1WWI A;  5GXQ C;  3LZ0 C;  4H9R B;  5AV6 A;  4J8X C;  1AOI D;  5B0Z D;  5CPI D;  4WJ3 C;  5AY8 A;  1M1A D;  4H9Q B;  3WTP C;  1P3G C;  3B6G B;  2F8N H;  1KX5 C;  1P3K C;  3IP4 C;  2DF4 C;  5B1M B;  3KUY C;  3TU4 D;  3AZF A;  4Z5T B;  2BYM A;  1EQZ A;  3REH D;  4JJN C;  1ID3 D;  3EG5 B;  5FUG B;  5DNM D;  5AVB A;  4DRB A;  5BS7 C;  3AZL A;  3KWQ B;  2FFF B;  5F99 A;  5E5A C;  4X23 A;  5AV6 D;  4R8P D;  4WU8 A;  5AY8 D;  3AFA A;  3AZH A;  2F2A C;  3P5J B;  5AVC A;  4AWL C;  4LD9 D;  3AZL C;  3AV1 A;  3X1S C;  1HQ3 D;  4KGC A;  4XZQ A;  5AV5 B;  3AZF D;  2RVQ D;  2NZD A;  3MNN B;  1EQZ D;  3VH5 A;  4WU8 C;  1P3L B;  5KDM B;  1H3O A;  1M19 A;  5AVC C;  3C1B A;  3LJA C;  5AVB D;  5B40 B;  3AN2 B;  2JCH A;  2ZY3 A;  4NE6 A;  1B6W A;  3MGR A;  4KUD D;  4KGC C;  5F99 D;  4XZQ C;  4X23 D;  2NZD C;  2HUE C;  3X1T D;  4H9R A;  5CPK D;  3W97 D;  1PZR A;  3AZK C;  1M19 C;  2YFV A;  3AFA D;  3AZH D;  1BH8 A;  4H9Q A;  2ZM5 A;  1AOI B;  3AZI D;  3AV1 D;  5B0Z B;  3B6G A;  5CPI B;  1M1A B;  4UUZ B;  3FDD A;  1TAF A;  1P3O A;  4EO5 B;  3W98 A;  2YFW A;  3AV2 D;  5FUG A;  3C1B D;  3TU4 B;  3B6G C;  3REH B;  3MGR D;  5B1M C;  1ID3 B;  4CAY B;  4Z5T C;  3LEL D;  5DNM B;  2BYK B;  3REI D;  4H9S A;  1P3M D;  3UTA D;  2IO5 B;  4NFT A;  2FJ7 D;  3REK D;  5AV6 B;  3C1C A;  4R8P B;  3KWQ C;  5AY8 B;  4H9N B;  2PYO A;  5AV5 A;  1P3O D;  2CV5 A;  4H9S C;  3W98 D;  3B6F D;  3MNN A;  1R4V A;  1HQ3 B;  4YM6 D;  3AZF B;  1KX3 A;  1EQZ B;  2BG1 A;  1M18 D;  5BNV A;  2L5A A;  5B32 A;  5AVB B;  1P3L C;  1ZLA D;  5CP6 D;  4KUD B;  5F99 B;  4X23 B;  5B40 C;  3AN2 C;  3X1T B;  5CPK B;  3W97 B;  2CWE A;  3EPH A;  1F66 D;  5GT3 D;  5CPI A;  5B31 D;  3AFA B;  3AZH B;  2PYO D;  2CV5 D;  1P34 D;  3WAA A;  3AZI B;  3AV1 B;  3B0C W;  1AOI C;  3TU4 A;  3LZ1 D;  3KXB A;  5B0Z C;  5CPI C;  1KX3 D;  1M1A C;  3A1K A;  1ID3 A;  4CAY A;  3UTB A;  4EO5 C;  3AV2 B;  5DNM A;  3C1B B;  5B2J A;  2BYK A;  5B32 D;  3MGR B;  3EPJ A;  3TU4 C;  5C3I B;  3LEL B;  3X1V A;  5B1L D;  3AZJ A;  3REH C;  4R8P A;  2HIO A;  1P3M B;  1ID3 C;  3UTA B;  2YFV B;  4ZBJ B;  5DNM C;  1BH8 B;  4H9N A;  2FJ7 B;  3REK B;  4LD9 A;  3WAA D;  2Y2H A;  1HQ3 A;  3AZE A;  1KU5 A;  4XUJ D;  3MVD A;  1TAF B;  5AV6 C;  4DRA A;  4DQY B;  4R8P C;  3UT9 D;  1P3O B;  3KXB D;  3W98 B;  3B6F B;  5AY8 C;  4YM6 B;  2YFW B;  3UTB D;  4ZUX D;  5JRG A;  1A7W A;  3A6N D;  5B2J D;  1P3B A;  1HQ3 C;  2DQN C;  4KUD A;  1M18 B;  3AZF C;  2RVQ C;  3X1V D;  3X1T A;  3AZJ D;  3W97 A;  3AZG A;  5CPK A;  1EQZ C;  4G91 B;  5DNN A;  1ZLA B;  2HIO D;  5CP6 B;  4Z66 A;  4YS3 D;  2ZY5 A;  5AVB C;  4J8V C;  2Y2M A;  3C1C B;  3AZI A;  1F66 B;  4KUD C;  5F99 C;  5GT3 B;  1P3I A;  5GSU A;  5B31 B;  4X23 C;  3AZE D;  3X1T C;  2PYO B;  1Z2C B;  3MVD D;  4WU9 A;  5CPK C;  2CV5 B;  3W97 C;  1P34 B;  3VH5 T;  3AFA C;  3AZH C;  1BFM A;  4E45 A;  3AV2 A;  5JRG D;  1P3B D;  5GT0 A;  3AZI C;  3AV1 C;  3LZ1 B;  1KX5 D;  1KX3 B;  3A1I A;  3VH6 A;  3WA9 A;  2VQR A;  3B0D B;  1N1J B;  5B24 A;  3LEL A;  5BNV B;  5B32 G;  4J8W D;  4G92 B;  3REI A;  5B32 B;  3WTP E;  4J8U A;  3AZG D;  5DNN D;  3MGS D;  1P3M A;  2J8P A;  3F6T A;  3R45 B;  4Z66 D;  3UTA A;  3AV2 C;  3C1B C;  3AZM A;  2FJ7 A;  5B1L B;  3REK A;  3MGR C;  1S32 D;  1P3I D;  5GSU D;  5C3I C;  3LEL C;  1Q9C A;  4WU9 D;  2Y2N A;  3WAA B;  3B6F A;  3UTA C;  4ZBJ C;  5JA4 A;  1P3P A;  2FJ7 C;  4YM6 A;  4XUJ B;  3REK C;  3H0M C;  3UT9 B;  5GT0 D;  3X1S D;  3KXB B;  3AZN A;  3W96 A;  1M18 A;  5CPJ A;  3WA9 D;  1P3O C;  3UTB B;  4J8V A;  5B24 D;  4ZUX B;  1U35 D;  3A6N B;  3W98 C;  5B2J B;  3B6F C;  4J8U D;  1ZLA A;  5CP6 A;  2XD1 A;  4YM6 C;  2G5H C;  2ZY2 A;  1KX4 D;  3AZM D;  3X1V B;  2G5I C;  3AZJ B;  1M18 C;  1F66 A;  2HIO B;  5GT3 A;  4YS3 B;  3MGP A;  5B31 A;  5B2I D;  4G91 C;  3AYW A;  1P34 A;  1ZLA C;  5CP6 C;  4LD9 B;  3REJ A;  2W8S A;  3AZE B;  1P3P D;  2JSS A;  3MVD B;  3C1C C;  3LZ1 A;  1F66 C;  5GT3 C;  2LY8 A;  5B31 C;  4UPK A;  3AZN D;  3W96 D;  5CPJ D;  2PYO C;  5AV5 C;  1N1J A;  4J8V D;  2CV5 C;  5JRG B;  5B0Y D;  1P34 C;  1P3B B;  2RIQ A;  3MNN C;  5AV9 A;  3R45 A;  4QLC D;  1P3F A;  3LZ1 C;  5B1L A;  3MGQ A;  5G49 A;  2Y2I A;  4J8W B;  3AZG B;  1KX3 C;  5DNN B;  3MGS B;  5B33 A;  4Z66 B;  3B0D C;  3O62 A;  3MGP D;  5AV8 D;  4G92 C;  1HTA A;  5B32 C;  3AYW D;  2NQB D;  3REJ D;  1S32 B;  4HGA B;  1P3I B;  5GSU B;  3W99 D;  5B1L C;  4XUJ A;  4WU9 B;  3UT9 A;  1ULY A;  2F8N D;  5BO0 B;  4ZUX A;  1JFI B;  3WAA C;  3A6N A;  5GT0 B;  2ARO A;  5AV9 D;  4XUJ C;  3X1U A;  3WA9 B;  3UT9 C;  4Z2M H;  5B24 B;  1U35 B;  1P3F D;  3KXB C;  3MGQ D;  3REI B;  4J8U B;  4WNN A;  5B33 D;  4YS3 A;  3KFU G;  1TZY A;  3O62 D;  3UTB C;  1KX4 B;  3REL D;  3A6N C;  5BNX A;  5B2J C;  3WKJ A;  3AZM B;  1WWS A;  5GXQ A;  1BH9 A;  2IO5 C;  3NQU B;  4H9P A;  5B40 D;  3X1V C;  5B2I B;  3AZJ C;  2HIO C;  4YS3 C;  4Z2M G;  5JA4 B;  1B67 A;  1P3P B;  4WV4 B;  3WTP A;  4LD9 C;  1P3G A;  2ARO D;  1KX5 A;  1F1E A;  1P3K A;  5BT1 D;  3AZE C;  3AZN B;  3W96 B;  1P3A D;  3KUY A;  3X1U D;  3MVD C;  4NE5 A;  5CPJ B;  4KHA B;  4J8V B;  5B0Y B;  1W2E A;  4CSR A;  4J8W A;  4JJN A;  2JE5 A;  4M6B A;  3MGS A;  1TZY D;  3WKJ D;  4QLC B;  5JRG C;  1P3B C;  3KSY A;  5BS7 A;  5GXQ D;  3LZ0 D;  5E5A A;  5B31 G;  1S32 A;  3MGP B;  5AV8 B;  4J8W C;  4J8X D;  3AZG C;  2XD5 A;  5DNN C;  3MGS C;  3AYW B;  2NQB B;  4Z66 C;  3REJ B;  3W99 B;  5BO0 A;  3WTP D;  1JFI A;  3X1S A;  1P3G D;  1S32 C;  4HGA C;  3VH6 T;  1P3I C;  5GSU C;  1P3K D;  2Y2P A;  3KUY D;  4H9O B;  2F8N G;  4WU9 C;  2F8N B;  1U35 A;  4JJN D;  5AV9 B;  1KX4 A;  3NQJ A;  4Z5T A;  5GT0 C;  3LJA A;  1P3F B;  3MGQ B;  5G49 B;  2Y2J A;  5E5A D;  5B33 B;  3EPK A;  3WA9 C;  3NQU A;  5B24 C;  3O62 B;  3REL B;  1U35 C;  5B2I A;  3V9R B;  3REI C;  4J8U C;  3AZK A;  1P3M C;  1KX4 C;  3AZM C;  2Y2G A;  3AZL D;  5B2I C;  4KHA A;  5B0Y A;  2ARO B;  4WU8 D;  3B0C T;  1P3P C;  5AVC D;  1P3A B;  4QLC A;  3X1U B;  3LJA D;  3AZN C;  3W96 C;  5B1M A;  4KGC D;  4XZQ D;  4WNN B;  5CPJ C;  2NZD D;  1TZY B;  3EPL A;  5AV8 A;  5B0Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...