5B0ZD

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zD00
2NZDC 1HQ3C 5B1MD 2IO5B 2JSSA 4WU9D 3REKD 4LD9B 1N1JA 5GT0A 5B31G 1ZLAB 5GT3A 3LELC 5AVCD 3MGSB 3AZKB 1TZYC 1M19A 3WTPB 5AVBC 4AWLB 5B0YA 3X1UD 3UTBB 2F8NG 3AZFA 3UT9C 5B31A 5AY8D 3C1CA 1P3MB 5DNMD 5GT0D 4J8UB 3REJC 3AZMA 3AZGB 5GT3D 3AZEB 4H9QB 3AZHB 3W99D 1P3BA 2IO5C 5AV5D 1P3AB 3B0CT 3AZMD 4Z5TB 4LD9C 4XUJA 3NQUA 1S32C 2F8NH 4CSRA 3R45A 3AYWC 3MGSC 3AZKC 3C1BD 4J8VD 5AVCB 4G92B 1ID3A 3WKJA 3W96C 1Q9CA 4KUDB 3MNNA 4AWLC 3W97C 3UTBC 4QLCA 1P3FA 3X1SA 3B6GA 4X23A 3KUYC 4NFTA 1BH8A 4EO5B 3X1VA 1B6WA 4HGAB 1AOIA 4J8WA 4J8UC 3AZGC 5GT0B 1U35C 2RVQD 5GT3B 5CPJD 3MVDA 1M19B 3MNND 3AZHC 4QLCD 1KX3D 5B0YB 1KX4A 3X1SD 5B1MC 5B32G 3AZFB 3B6GD 5B31B 1P3AC 3C1CB 3AZJA 2FJ7A 4YM6A 3AZMB 2CV5A 3W98D 5AVCC 2F8NB 5B32A 4JJND 4KUDC 1B67A 5B2IA 1KX4D 5E5AB 2HIOD 3X1UC 3MGQD 1P3BB 5JRGD 5G49A 2NZDD 4HGAC 1HQ3D 4H9PA 3NQUB 4XUJB 5GT0C 3VH5W 2CV5D 5GT3C 4CSRB 4J8XA 3R45B 3MGRA 1M19C 1ID3B 3WKJB 5B2ID 3MNNB 5B0YC 3V9RA 3LZ0A 3LELD 2PYOA 1P3FB 3X1SB 3B6GB 4X23B 1BH8B 3O62A 3C1CC 3X1VB 1P3GA 4H9RA 5CP6A 1P34D 1AOIB 4J8WB 3AZMC 4Z66A 3UT9D 1JFIA 5AV8A 3MVDB 4J8VC 3REJD 3LZ0D 3X1TD 1BFMA 1WWSA 1KX4B 1HTAA 1P3BC 5CP6D 3AZJB 2FJ7B 3B6FB 1P3PA 3AZLA 4Z66D 4YM6B 4XUJC 1F66B 5BS7C 2RVQC 5CPJC 2LY8A 1P3KA 4LD9D 1BH9A 5B32B 5AV6A 1ZLAD 3MNNC 5B2IB 3RELA 4QLCC 2YFWA 3AZEA 3AZKD 3B0DC 1P3FC 5G49B 3X1SC 3KXBA 3WTPD 3B6GC 5BT1D 3AFAA 3X1VC 3UTBD 4H9PB 4J8WC 3A6NA 4J8XB 3B0CW 3KSYA 3NQJA 4H9OA 5GSUA 1P3MD 3W98C 3MGRB 3AZGD 4Z5TA 5BNXA 3V9RB 3LZ0B 3AZED 1KX4C 3MGPA 2PYOB 3VH6A 3AFAD 3O62B 1P3GB 2FJ7C 4CAYB 4H9RB 5CP6B 4YM6C 3A6ND 4Z66B 1JFIB 4E44A 2CV5C 1P3AD 5AV8B 4E45A 4Z5TD 2CWEA 5B2IC 3AN2A 3MGPD 1KX5A 5B2JA 4KUDD 4R8PA 4WU8A 1P3PB 3AZLB 1P34C 4KHAA 4DRBA 4J8XC 1P3KB 3MGRC 1BH9B 3WA9A 5AV6B 3RELB 3LZ0C 3X1TC 2YFWB 1P3IA 2PYOC 4DRAA 1M19D 3KXBB 2F8NA 4KGCA 3O62C 3AFAB 5F99B 5CP6C 5B0YD 5E5AA 1M18A 3AZFD 4Z66C 3A6NB 5B31D 4M6BA 3C1CD 4H9OB 3NQJB 5BO0A 5GSUB 5AV8C 5B40A 5BNXB 1ZLAC 3VH5A 1M1AA 3MGPB 2F8ND 4KGCD 3WTPC 3REIA 5BT1C 5E5AD 3LJAA 1P3BD 1P3OA 4KUDA 1P3KC 1P3MC 4XUJD 5JA4A 4WNNA 5AV6C 3RELC 3AN2B 3AZEC 4NE3A 1ID3D 3WKJD 1KX5B 5B2JB 3WTPE 3AFAC 4R8PB 4WU8B 5B33A 3A6NC 4KHAB 5AV9A 4X23D 3LZ1B 1P3FD 3X1VD 5GSUC 1AOID 3B6FA 4J8WD 4Z5TC 1F66A 5C3IB 3WA9B 3MGPC 1P3IB 3MVDD 4G92C 4KGCB 5B33D 1M18B 5B24A 3AZIA 3KWQA 3AZJD 2FJ7D 4EO5C 4XZQA 5BO0B 3B6FD 4YM6D 1F66D 5B40B 5B0ZA 3AN2C 1TAFA 1M1AB 4YS3A 5B32D 1KX5C 5B2JC 3REIB 1ULYA 3LJAB 2NQBA 5B24D 3AZID 5B1LA 2L5AA 3AZFC 1A7WA 1P3OB 5CPIA 5B31C 4CAYA 2HUEB 5JA4B 4WNNB 4H9NA 2AROA 4J8XD 3AV1A 1P3IC 3MGRD 4KGCC 5E5AC 5GXQA 5B33B 3AZNA 2PYOD 5AV9B 3WAAA 3O62D 1P3GD 4ZUXA 3VH6T 5CHLB 5B40C 1M1AC 5AV8D 4G91B 1ID3C 3WKJC 3REIC 3LJAC 5B24B 3WAAD 4H9SA 1P3OC 3AZIB 3KWQB 4ZUXD 4X23C 4XZQB 5F99A 3AZLD 1P3PD 1AOIC 1S32A 5B0ZB 1TAFB 3AYWA 4YS3B 1P3KD 3MVDC 5AV6D 3RELD 5DNNB 2NQBB 3W97A 5B33C 3AV2A 5B1LB 3KXBD 5CPIB 5F99D 3AZJC 3B6FC 1P3LA 1F66C 5CPKA 4H9NB 2AROB 3AV1B 5GSUD 5B32C 3UTAA 5GXQB 3AZNB 5B24C 5B1MA 3AZIC 3WAAB 3VH5T 4XZQC 4ZUXB 4WU9A 3REKA 5B0ZC 3LZ1A 4YS3C 3AN2D 2NQBC 3X1UA 5B1LC 1KX5D 5B2JD 5CPIC 4R8PD 1P3GC 5AY8A 4WU8D 5DNMA 1S32B 3LZ1D 2AROC 3AV1C 3AYWB 3WA9D 3W96B 5BNVA 3W97B 5GXQC 3AZNC 3AV2B 1P3ID 1F1EA 3W99A 3WAAC 5FUGA 4NE5A 3KUYB 4ZUXC 5AV5A 1P3LB 1P3PC 3AZLC 1M18D 3TU4A 5CPKB 1U35B 3C1BA 4J8VA 5B40D 3UTAB 1M1AD 4H9SC 5B1MB 3KXBC 3REID 3LJAD 5F99C 3TU4D 4WU9B 3REKB 1P3OD 5BS7A 3VH6W 5CPJA 1H3OA 3AV2C 1KX3A 3X1UB 5AY8B 1P3LC 5KDMA 5DNMB 1N1JB 1EQZA 5AV9D 5CPKC 3W98A 5BNVB 4JJNA 3UTAC 3W99B 2HIOA 5FUGB 3MGQA 5JRGA 3REHA 4R8PC 5AV5B 5DNNA 4WU8C 4WU9C 1EQZD 2NZDA 3TU4B 1HQ3A 3REKC 3KWQD 3LZ1C 2BYKA 4XZQD 3C1BB 4J8VB 4ZBJB 3WA9C 5C3IC 5B0ZD 4YS3D 3LELA 3B0BA 4UUZA 1TZYA 3REHD 5AY8C 5DNND 5AVBA 2NQBD 2BYMA 4Z2MG 5B1LD 5DNMC 1P34A 1M18C 5CPID 3UT9A 5CPJB 1H3OB 3REJA 2AROD 3AV1D 2YFVA 3X1TA 4QLCB 1KX3B 3W99C 3B0DB 1TZYD 5AVBD 4WV4B 5AV5C 5GXQD 5KDMB 3AZND 3TU4C 1EQZB 4NE6A 3W98B 4Z2MH 2HUEC 3C1BC 4LD9A 4ZBJC 4JJNB 1ZLAA 1WWIA 2HIOB 3MGSA 3AZKA 3MGQB 5JRGB 3W96A 3WTPA 3REHB 2NZDB 3UTBA 1HQ3B 5AV9C 2CV5B 2BYKB 3KUYA 2F8NK 1P3MA 1S32D 1KU5A 4WZSB 4J8UA 3AZGA 1U35A 1KX3C 3AYWD 3MGSD 3LELB 4UUZB 4G91C 3W96D 1R4VA 1TZYB 4H9QA 5AVBB 3AZHA 3W97D 2BYMB 3AV2D 1EQZC 1P34B 3KUYD 3KWQC 3UT9B 1P3AA 1P3LD 4J8UD 3REJB 5CPKD 4JJNC 1U35D 2YFVB 3X1TB 2HIOC 3MGQC 5AVCA 5JRGC 3AZHD 3REHC 3UTAD 5DNNC
chains in the Genus database with same CATH superfamily
2NZDC 1HQ3C 5B1MD 2IO5B 2JSSA 4WU9D 3REKD 4LD9B 1N1JA 5GT0A 5B31G 1ZLAB 3H0LC 5GT3A 3LELC 5AVCD 3MGSB 3AZKB 1TZYC 1M19A 3WTPB 2BG1A 5AVBC 4AWLB 5B0YA 3X1UD 3UTBB 2F8NG 3AZFA 3UT9C 5B31A 5AY8D 3C1CA 1P3MB 5DNMD 5GT0D 4J8UB 3REJC 3AZMA 3AZGB 2Y2MA 5GT3D 3AZEB 4H9QB 3AZHB 3W99D 1P3BA 2IO5C 5AV5D 1P3AB 3B0CT 3AZMD 3EPHA 4Z5TB 2Y2KA 4XUJA 3NQUA 1S32C 2F8NH 4LD9C 4CSRA 3H0MC 3R45A 3AYWC 3MGSC 3AZKC 3C1BD 2DQNC 3EG5B 5AVCB 4J8VD 4G92B 3W96C 1ID3A 3WKJA 1Q9CA 4KUDB 3MNNA 4AWLC 3W97C 3UTBC 4QLCA 2DF4C 2J8PA 1P3FA 3X1SA 1Z2CB 4X23A 3KUYC 4NFTA 3B6GA 1BH8A 4EO5B 3X1VA 1B6WA 4HGAB 1AOIA 4J8WA 4J8UC 3AZGC 5GT0B 1U35C 2RVQD 5GT3B 5CPJD 3MVDA 1M19B 3MNND 3AZHC 2JE5A 4QLCD 1KX3D 5B0YB 1KX4A 3X1SD 5B1MC 5B32G 3AZFB 3B6GD 5B31B 1P3AC 3C1CB 3AZJA 2FJ7A 4YM6A 3AZMB 2CV5A 3W98D 5AVCC 2F8NB 5B32A 4JJND 4KUDC 1B67A 5B2IA 1KX4D 5E5AB 2HIOD 3X1UC 3MGQD 2ZY5A 1P3BB 5JRGD 5G49A 2NZDD 4HGAC 1HQ3D 4H9PA 3NQUB 4XUJB 5GT0C 3VH5W 2CV5D 5GT3C 4CSRB 4J8XA 3R45B 3MGRA 2JCHA 1M19C 1ID3B 3WKJB 3IP4C 5B2ID 3MNNB 5B0YC 3V9RA 3LZ0A 3LELD 2PYOA 1P3FB 3X1SB 3B6GB 4X23B 1BH8B 3O62A 3C1CC 3X1VB 1P3GA 4H9RA 5CP6A 1P34D 1AOIB 4J8WB 3AZMC 4Z66A 3UT9D 1JFIA 2Y2QA 5AV8A 3MVDB 4J8VC 3REJD 3LZ0D 3X1TD 1BFMA 1WWSA 1KX4B 1HTAA 1P3BC 5CP6D 3AZJB 2FJ7B 3B6FB 1P3PA 3AZLA 4YM6B 4Z66D 4XUJC 1F66B 5BS7C 2RVQC 5CPJC 2LY8A 1P3KA 4LD9D 1BH9A 5B32B 5AV6A 1ZLAD 3MNNC 5B2IB 3RELA 4QLCC 2YFWA 3AZEA 3AZKD 3B0DC 1P3FC 5G49B 3X1SC 3KXBA 3WTPD 3B6GC 5BT1D 3AFAA 3X1VC 3FDDA 3UTBD 4H9PB 4J8WC 3A6NA 4J8XB 3B0CW 3KSYA 3NQJA 4H9OA 5GSUA 1T3UA 1P3MD 3W98C 3MGRB 3AZGD 4Z5TA 5BNXA 3V9RB 3LZ0B 3AZED 1KX4C 3MGPA 2PYOB 3VH6A 2UWXA 3AFAD 3O62B 1P3GB 2FJ7C 4CAYB 4H9RB 5CP6B 4YM6C 3A6ND 4Z66B 1JFIB 4E44A 2CV5C 1P3AD 5AV8B 4E45A 4Z5TD 2CWEA 5B2IC 3AN2A 3MGPD 3EPJA 2G5HC 1KX5A 5B2JA 2Y2NA 4KUDD 4R8PA 4WU8A 1P3PB 3AZLB 1P34C 4KHAA 4DRBA 4J8XC 1P3KB 3MGRC 1BH9B 3WA9A 5AV6B 3RELB 3LZ0C 3X1TC 2YFWB 1P3IA 2PYOC 4DRAA 1M19D 3KXBB 2F8NA 4KGCA 3O62C 3AFAB 5F99B 5CP6C 5B0YD 5E5AA 1M18A 3AZFD 4Z66C 3A6NB 2Y2HA 5B31D 4M6BA 3C1CD 4H9OB 3NQJB 2Y2JA 5BO0A 5GSUB 5AV8C 2ZY3A 5B40A 5BNXB 1ZLAC 3VH5A 1M1AA 3MGPB 2F8ND 4KGCD 3WTPC 3REIA 5BT1C 5E5AD 3LJAA 1P3BD 1P3OA 4KUDA 1P3KC 1P3MC 4XUJD 5JA4A 5AV6C 4WNNA 3RELC 3AN2B 3A1KA 3AZEC 4NE3A 2ZY4A 1ID3D 3WKJD 1KX5B 5B2JB 3WTPE 3AFAC 4R8PB 4WU8B 5B33A 3A6NC 4KHAB 5AV9A 4X23D 3LZ1B 1P3FD 3AL0C 4WJ3C 3X1VD 5GSUC 1AOID 3B6FA 4J8WD 4Z5TC 1F66A 5C3IB 3WA9B 3MGPC 1P3IB 3MVDD 2Y2GA 4G92C 4KGCB 5B33D 2VQRA 1M18B 5B24A 3AZIA 3KWQA 3AZJD 2FJ7D 4EO5C 4XZQA 5BO0B 3B6FD 4YM6D 1F66D 5B40B 5B0ZA 3AN2C 1TAFA 1M1AB 4YS3A 5B32D 1KX5C 5B2JC 2Y2OA 3REIB 1ULYA 3LJAB 2NQBA 5B24D 3AZID 5B1LA 2L5AA 3AZFC 1A7WA 1P3OB 5CPIA 2FFFB 5B31C 4CAYA 2HUEB 5JA4B 4WNNB 4H9NA 2AROA 4J8XD 3AV1A 1P3IC 3MGRD 4KGCC 5E5AC 5GXQA 5B33B 3AZNA 2PYOD 5AV9B 3WAAA 3O62D 1P3GD 4ZUXA 3VH6T 5CHLB 5B40C 1M1AC 5AV8D 4G91B 4UPKA 1ID3C 3WKJC 3REIC 3LJAC 5B24B 3WAAD 4H9SA 1P3OC 3AZIB 3KWQB 4ZUXD 4X23C 4XZQB 5F99A 3AZLD 1P3PD 1AOIC 1S32A 2Y2LA 5B0ZB 1TAFB 2XD1A 3AYWA 4YS3B 1P3KD 3MVDC 5AV6D 3RELD 5DNNB 2NQBB 3W97A 5B33C 3AV2A 5B1LB 3KXBD 3A1IA 5CPIB 5F99D 3AZJC 3B6FC 1P3LA 1F66C 5CPKA 4H9NB 2AROB 3AV1B 5GSUD 4DQYB 5B32C 3UTAA 5GXQB 3AZNB 5B24C 5B1MA 3AZIC 3WAAB 3VH5T 4XZQC 4ZUXB 4WU9A 3REKA 5B0ZC 3LZ1A 4YS3C 1W2EA 3AN2D 2Y2IA 2NQBC 3X1UA 5B1LC 1KX5D 5B2JD 5CPIC 4R8PD 1P3GC 5AY8A 4WU8D 5DNMA 1S32B 3LZ1D 2AROC 3AV1C 3F6TA 3AYWB 2ZM5A 3WA9D 3W96B 5BNVA 1PZRA 3W97B 5GXQC 3AZNC 3AV2B 1P3ID 1F1EA 3W99A 3WAAC 5FUGA 4NE5A 3KUYB 4ZUXC 5AV5A 1P3LB 1P3PC 3AZLC 1M18D 3TU4A 5CPKB 1U35B 2W8SA 3C1BA 4J8VA 5B40D 3UTAB 2Y2PA 1M1AD 2ZY2A 4H9SC 2XD5A 5B1MB 3KXBC 3REID 3LJAD 5F99C 3TU4D 4WU9B 3REKB 1P3OD 5BS7A 3VH6W 2RIQA 5CPJA 2G5IC 1H3OA 3AV2C 1KX3A 3X1UB 5AY8B 3EPKA 1P3LC 5KDMA 5DNMB 1N1JB 1EQZA 5AV9D 5CPKC 3W98A 3H0RC 5BNVB 4JJNA 3UTAC 3W99B 2HIOA 5FUGB 3MGQA 5JRGA 3REHA 4R8PC 5AV5B 5DNNA 4WU8C 4WU9C 1EQZD 2NZDA 3TU4B 1HQ3A 3REKC 3KWQD 3LZ1C 2BYKA 4XZQD 3C1BB 4J8VB 4ZBJB 3WA9C 5C3IC 5B0ZD 4YS3D 3LELA 3B0BA 4UUZA 1TZYA 3REHD 5AY8C 5DNND 5AVBA 2NQBD 2BYMA 4Z2MG 5B1LD 5DNMC 1P34A 1M18C 5CPID 3UT9A 2F2AC 5CPJB 1H3OB 3REJA 2AROD 3AV1D 2YFVA 3X1TA 4QLCB 1KX3B 3W99C 3B0DB 1TZYD 5AVBD 4WV4B 5AV5C 5GXQD 5KDMB 3AZND 3TU4C 1EQZB 4NE6A 3EPLA 3P5JB 3W98B 4Z2MH 2HUEC 3C1BC 4LD9A 4ZBJC 4JJNB 1ZLAA 1WWIA 2HIOB 3MGSA 3AZKA 3MGQB 5JRGB 3W96A 3WTPA 3REHB 2NZDB 3UTBA 1HQ3B 5AV9C 2CV5B 2BYKB 3KUYA 2F8NK 1P3MA 1S32D 1KU5A 4WZSB 4J8UA 3AZGA 1U35A 1KX3C 3AYWD 3MGSD 3LELB 4UUZB 4G91C 3W96D 1R4VA 1TZYB 4H9QA 5AVBB 3AZHA 3W97D 2BYMB 3AV2D 1EQZC 1P34B 3KUYD 3KWQC 3UT9B 1P3AA 1P3LD 3KFUG 4J8UD 3REJB 5CPKD 4JJNC 1U35D 2YFVB 3X1TB 2HIOC 3MGQC 5AVCA 5JRGC 3AZHD 3REHC 3UTAD 5DNNC
chains in the Genus database with same CATH topology
2NZDC 1HQ3C 5B1MD 2IO5B 2JSSA 4WU9D 3REKD 4LD9B 1N1JA 5GT0A 5B31G 1ZLAB 3H0LC 5GT3A 3LELC 5AVCD 3MGSB 3AZKB 1TZYC 1M19A 3WTPB 2BG1A 5AVBC 4AWLB 5B0YA 3X1UD 3UTBB 2F8NG 3AZFA 3UT9C 5B31A 5AY8D 3C1CA 1P3MB 5DNMD 5GT0D 4J8UB 3REJC 3AZMA 3AZGB 2Y2MA 5GT3D 3AZEB 4H9QB 3AZHB 3W99D 1P3BA 2IO5C 5AV5D 1P3AB 3B0CT 3AZMD 3EPHA 4Z5TB 2Y2KA 4XUJA 3NQUA 1S32C 2F8NH 4LD9C 4CSRA 3H0MC 3R45A 3AYWC 3MGSC 3AZKC 3C1BD 2DQNC 3EG5B 5AVCB 4J8VD 4G92B 3W96C 1ID3A 3WKJA 1Q9CA 4KUDB 3MNNA 4AWLC 3W97C 3UTBC 4QLCA 2DF4C 2J8PA 1P3FA 3X1SA 1Z2CB 4X23A 3KUYC 4NFTA 3B6GA 1BH8A 4EO5B 3X1VA 1B6WA 4HGAB 1AOIA 4J8WA 4J8UC 3AZGC 5GT0B 1U35C 2RVQD 5GT3B 5CPJD 3MVDA 1M19B 3MNND 3AZHC 2JE5A 4QLCD 1KX3D 5B0YB 1KX4A 3X1SD 5B1MC 5B32G 3AZFB 3B6GD 5B31B 1P3AC 3C1CB 3AZJA 2FJ7A 4YM6A 3AZMB 2CV5A 3W98D 5AVCC 2F8NB 5B32A 4JJND 4KUDC 1B67A 5B2IA 1KX4D 5E5AB 2HIOD 3X1UC 3MGQD 2ZY5A 1P3BB 5JRGD 5G49A 2NZDD 4HGAC 1HQ3D 4H9PA 3NQUB 4XUJB 5GT0C 3VH5W 2CV5D 5GT3C 4CSRB 4J8XA 3R45B 3MGRA 2JCHA 1M19C 1ID3B 3WKJB 3IP4C 5B2ID 3MNNB 5B0YC 3V9RA 3LZ0A 3LELD 2PYOA 1P3FB 3X1SB 3B6GB 4X23B 1BH8B 3O62A 3C1CC 3X1VB 1P3GA 4H9RA 5CP6A 1P34D 1AOIB 4J8WB 3AZMC 4Z66A 3UT9D 1JFIA 2Y2QA 5AV8A 3MVDB 4J8VC 3REJD 3LZ0D 3X1TD 1BFMA 1WWSA 1KX4B 1HTAA 1P3BC 5CP6D 3AZJB 2FJ7B 3B6FB 1P3PA 3AZLA 4YM6B 4Z66D 4XUJC 1F66B 5BS7C 2RVQC 5CPJC 2LY8A 1P3KA 4LD9D 1BH9A 5B32B 5AV6A 1ZLAD 3MNNC 5B2IB 3RELA 4QLCC 2YFWA 3AZEA 3AZKD 3B0DC 1P3FC 5G49B 3X1SC 3KXBA 3WTPD 3B6GC 5BT1D 3AFAA 3X1VC 3FDDA 3UTBD 4H9PB 4J8WC 3A6NA 4J8XB 3B0CW 3KSYA 3NQJA 4H9OA 5GSUA 1T3UA 1P3MD 3W98C 3MGRB 3AZGD 4Z5TA 5BNXA 3V9RB 3LZ0B 3AZED 1KX4C 3MGPA 2PYOB 3VH6A 2UWXA 3AFAD 3O62B 1P3GB 2FJ7C 4CAYB 4H9RB 5CP6B 4YM6C 3A6ND 4Z66B 1JFIB 4E44A 2CV5C 1P3AD 5AV8B 4E45A 4Z5TD 2CWEA 5B2IC 3AN2A 3MGPD 3EPJA 2G5HC 1KX5A 5B2JA 2Y2NA 4KUDD 4R8PA 4WU8A 1P3PB 3AZLB 1P34C 4KHAA 4DRBA 4J8XC 1P3KB 3MGRC 1BH9B 3WA9A 5AV6B 3RELB 3LZ0C 3X1TC 2YFWB 1P3IA 2PYOC 4DRAA 1M19D 3KXBB 2F8NA 4KGCA 3O62C 3AFAB 5F99B 5CP6C 5B0YD 5E5AA 1M18A 3AZFD 4Z66C 3A6NB 2Y2HA 5B31D 4M6BA 3C1CD 4H9OB 3NQJB 2Y2JA 5BO0A 5GSUB 5AV8C 2ZY3A 5B40A 5BNXB 1ZLAC 3VH5A 1M1AA 3MGPB 2F8ND 4KGCD 3WTPC 3REIA 5BT1C 5E5AD 3LJAA 1P3BD 1P3OA 4KUDA 1P3KC 1P3MC 4XUJD 5JA4A 5AV6C 4WNNA 3RELC 3AN2B 3A1KA 3AZEC 4NE3A 2ZY4A 1ID3D 3WKJD 1KX5B 5B2JB 3WTPE 3AFAC 4R8PB 4WU8B 5B33A 3A6NC 4KHAB 5AV9A 4X23D 3LZ1B 1P3FD 3AL0C 4WJ3C 3X1VD 5GSUC 1AOID 3B6FA 4J8WD 4Z5TC 1F66A 5C3IB 3WA9B 3MGPC 1P3IB 3MVDD 2Y2GA 4G92C 4KGCB 5B33D 2VQRA 1M18B 5B24A 3AZIA 3KWQA 3AZJD 2FJ7D 4EO5C 4XZQA 5BO0B 3B6FD 4YM6D 1F66D 5B40B 5B0ZA 3AN2C 1TAFA 1M1AB 4YS3A 5B32D 1KX5C 5B2JC 2Y2OA 3REIB 1ULYA 3LJAB 2NQBA 5B24D 3AZID 5B1LA 2L5AA 3AZFC 1A7WA 1P3OB 5CPIA 2FFFB 5B31C 4CAYA 2HUEB 5JA4B 4WNNB 4H9NA 2AROA 4J8XD 3AV1A 1P3IC 3MGRD 4KGCC 5E5AC 5GXQA 5B33B 3AZNA 2PYOD 5AV9B 3WAAA 3O62D 1P3GD 4ZUXA 3VH6T 5CHLB 5B40C 1M1AC 5AV8D 4G91B 4UPKA 1ID3C 3WKJC 3REIC 3LJAC 5B24B 3WAAD 4H9SA 1P3OC 3AZIB 3KWQB 4ZUXD 4X23C 4XZQB 5F99A 3AZLD 1P3PD 1AOIC 1S32A 2Y2LA 5B0ZB 1TAFB 2XD1A 3AYWA 4YS3B 1P3KD 3MVDC 5AV6D 3RELD 5DNNB 2NQBB 3W97A 5B33C 3AV2A 5B1LB 3KXBD 3A1IA 5CPIB 5F99D 3AZJC 3B6FC 1P3LA 1F66C 5CPKA 4H9NB 2AROB 3AV1B 5GSUD 4DQYB 5B32C 3UTAA 5GXQB 3AZNB 5B24C 5B1MA 3AZIC 3WAAB 3VH5T 4XZQC 4ZUXB 4WU9A 3REKA 5B0ZC 3LZ1A 4YS3C 1W2EA 3AN2D 2Y2IA 2NQBC 3X1UA 5B1LC 1KX5D 5B2JD 5CPIC 4R8PD 1P3GC 5AY8A 4WU8D 5DNMA 1S32B 3LZ1D 2AROC 3AV1C 3F6TA 3AYWB 2ZM5A 3WA9D 3W96B 5BNVA 1PZRA 3W97B 5GXQC 3AZNC 3AV2B 1P3ID 1F1EA 3W99A 3WAAC 5FUGA 4NE5A 3KUYB 4ZUXC 5AV5A 1P3LB 1P3PC 3AZLC 1M18D 3TU4A 5CPKB 1U35B 2W8SA 3C1BA 4J8VA 5B40D 3UTAB 2Y2PA 1M1AD 2ZY2A 4H9SC 2XD5A 5B1MB 3KXBC 3REID 3LJAD 5F99C 3TU4D 4WU9B 3REKB 1P3OD 5BS7A 3VH6W 2RIQA 5CPJA 2G5IC 1H3OA 3AV2C 1KX3A 3X1UB 5AY8B 3EPKA 1P3LC 5KDMA 5DNMB 1N1JB 1EQZA 5AV9D 5CPKC 3W98A 3H0RC 5BNVB 4JJNA 3UTAC 3W99B 2HIOA 5FUGB 3MGQA 5JRGA 3REHA 4R8PC 5AV5B 5DNNA 4WU8C 4WU9C 1EQZD 2NZDA 3TU4B 1HQ3A 3REKC 3KWQD 3LZ1C 2BYKA 4XZQD 3C1BB 4J8VB 4ZBJB 3WA9C 5C3IC 5B0ZD 4YS3D 3LELA 3B0BA 4UUZA 1TZYA 3REHD 5AY8C 5DNND 5AVBA 2NQBD 2BYMA 4Z2MG 5B1LD 5DNMC 1P34A 1M18C 5CPID 3UT9A 2F2AC 5CPJB 1H3OB 3REJA 2AROD 3AV1D 2YFVA 3X1TA 4QLCB 1KX3B 3W99C 3B0DB 1TZYD 5AVBD 4WV4B 5AV5C 5GXQD 5KDMB 3AZND 3TU4C 1EQZB 4NE6A 3EPLA 3P5JB 3W98B 4Z2MH 2HUEC 3C1BC 4LD9A 4ZBJC 4JJNB 1ZLAA 1WWIA 2HIOB 3MGSA 3AZKA 3MGQB 5JRGB 3W96A 3WTPA 3REHB 2NZDB 3UTBA 1HQ3B 5AV9C 2CV5B 2BYKB 3KUYA 2F8NK 1P3MA 1S32D 1KU5A 4WZSB 4J8UA 3AZGA 1U35A 1KX3C 3AYWD 3MGSD 3LELB 4UUZB 4G91C 3W96D 1R4VA 1TZYB 4H9QA 5AVBB 3AZHA 3W97D 2BYMB 3AV2D 1EQZC 1P34B 3KUYD 3KWQC 3UT9B 1P3AA 1P3LD 3KFUG 4J8UD 3REJB 5CPKD 4JJNC 1U35D 2YFVB 3X1TB 2HIOC 3MGQC 5AVCA 5JRGC 3AZHD 3REHC 3UTAD 5DNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZD C;  1HQ3 C;  5B1M D;  2IO5 B;  2JSS A;  4WU9 D;  3REK D;  4LD9 B;  1N1J A;  5GT0 A;  5B31 G;  1ZLA B;  5GT3 A;  3LEL C;  5AVC D;  3MGS B;  3AZK B;  1TZY C;  1M19 A;  3WTP B;  5AVB C;  4AWL B;  5B0Y A;  3X1U D;  3UTB B;  2F8N G;  3AZF A;  3UT9 C;  5B31 A;  5AY8 D;  3C1C A;  1P3M B;  5DNM D;  5GT0 D;  4J8U B;  3REJ C;  3AZM A;  3AZG B;  5GT3 D;  3AZE B;  4H9Q B;  3AZH B;  3W99 D;  1P3B A;  2IO5 C;  5AV5 D;  1P3A B;  3B0C T;  3AZM D;  4Z5T B;  4LD9 C;  4XUJ A;  3NQU A;  1S32 C;  2F8N H;  4CSR A;  3R45 A;  3AYW C;  3MGS C;  3AZK C;  3C1B D;  4J8V D;  5AVC B;  4G92 B;  1ID3 A;  3WKJ A;  3W96 C;  1Q9C A;  4KUD B;  3MNN A;  4AWL C;  3W97 C;  3UTB C;  4QLC A;  1P3F A;  3X1S A;  3B6G A;  4X23 A;  3KUY C;  4NFT A;  1BH8 A;  4EO5 B;  3X1V A;  1B6W A;  4HGA B;  1AOI A;  4J8W A;  4J8U C;  3AZG C;  5GT0 B;  1U35 C;  2RVQ D;  5GT3 B;  5CPJ D;  3MVD A;  1M19 B;  3MNN D;  3AZH C;  4QLC D;  1KX3 D;  5B0Y B;  1KX4 A;  3X1S D;  5B1M C;  5B32 G;  3AZF B;  3B6G D;  5B31 B;  1P3A C;  3C1C B;  3AZJ A;  2FJ7 A;  4YM6 A;  3AZM B;  2CV5 A;  3W98 D;  5AVC C;  2F8N B;  5B32 A;  4JJN D;  4KUD C;  1B67 A;  5B2I A;  1KX4 D;  5E5A B;  2HIO D;  3X1U C;  3MGQ D;  1P3B B;  5JRG D;  5G49 A;  2NZD D;  4HGA C;  1HQ3 D;  4H9P A;  3NQU B;  4XUJ B;  5GT0 C;  3VH5 W;  2CV5 D;  5GT3 C;  4CSR B;  4J8X A;  3R45 B;  3MGR A;  1M19 C;  1ID3 B;  3WKJ B;  5B2I D;  3MNN B;  5B0Y C;  3V9R A;  3LZ0 A;  3LEL D;  2PYO A;  1P3F B;  3X1S B;  3B6G B;  4X23 B;  1BH8 B;  3O62 A;  3C1C C;  3X1V B;  1P3G A;  4H9R A;  5CP6 A;  1P34 D;  1AOI B;  4J8W B;  3AZM C;  4Z66 A;  3UT9 D;  1JFI A;  5AV8 A;  3MVD B;  4J8V C;  3REJ D;  3LZ0 D;  3X1T D;  1BFM A;  1WWS A;  1KX4 B;  1HTA A;  1P3B C;  5CP6 D;  3AZJ B;  2FJ7 B;  3B6F B;  1P3P A;  3AZL A;  4Z66 D;  4YM6 B;  4XUJ C;  1F66 B;  5BS7 C;  2RVQ C;  5CPJ C;  2LY8 A;  1P3K A;  4LD9 D;  1BH9 A;  5B32 B;  5AV6 A;  1ZLA D;  3MNN C;  5B2I B;  3REL A;  4QLC C;  2YFW A;  3AZE A;  3AZK D;  3B0D C;  1P3F C;  5G49 B;  3X1S C;  3KXB A;  3WTP D;  3B6G C;  5BT1 D;  3AFA A;  3X1V C;  3UTB D;  4H9P B;  4J8W C;  3A6N A;  4J8X B;  3B0C W;  3KSY A;  3NQJ A;  4H9O A;  5GSU A;  1P3M D;  3W98 C;  3MGR B;  3AZG D;  4Z5T A;  5BNX A;  3V9R B;  3LZ0 B;  3AZE D;  1KX4 C;  3MGP A;  2PYO B;  3VH6 A;  3AFA D;  3O62 B;  1P3G B;  2FJ7 C;  4CAY B;  4H9R B;  5CP6 B;  4YM6 C;  3A6N D;  4Z66 B;  1JFI B;  4E44 A;  2CV5 C;  1P3A D;  5AV8 B;  4E45 A;  4Z5T D;  2CWE A;  5B2I C;  3AN2 A;  3MGP D;  1KX5 A;  5B2J A;  4KUD D;  4R8P A;  4WU8 A;  1P3P B;  3AZL B;  1P34 C;  4KHA A;  4DRB A;  4J8X C;  1P3K B;  3MGR C;  1BH9 B;  3WA9 A;  5AV6 B;  3REL B;  3LZ0 C;  3X1T C;  2YFW B;  1P3I A;  2PYO C;  4DRA A;  1M19 D;  3KXB B;  2F8N A;  4KGC A;  3O62 C;  3AFA B;  5F99 B;  5CP6 C;  5B0Y D;  5E5A A;  1M18 A;  3AZF D;  4Z66 C;  3A6N B;  5B31 D;  4M6B A;  3C1C D;  4H9O B;  3NQJ B;  5BO0 A;  5GSU B;  5AV8 C;  5B40 A;  5BNX B;  1ZLA C;  3VH5 A;  1M1A A;  3MGP B;  2F8N D;  4KGC D;  3WTP C;  3REI A;  5BT1 C;  5E5A D;  3LJA A;  1P3B D;  1P3O A;  4KUD A;  1P3K C;  1P3M C;  4XUJ D;  5JA4 A;  4WNN A;  5AV6 C;  3REL C;  3AN2 B;  3AZE C;  4NE3 A;  1ID3 D;  3WKJ D;  1KX5 B;  5B2J B;  3WTP E;  3AFA C;  4R8P B;  4WU8 B;  5B33 A;  3A6N C;  4KHA B;  5AV9 A;  4X23 D;  3LZ1 B;  1P3F D;  3X1V D;  5GSU C;  1AOI D;  3B6F A;  4J8W D;  4Z5T C;  1F66 A;  5C3I B;  3WA9 B;  3MGP C;  1P3I B;  3MVD D;  4G92 C;  4KGC B;  5B33 D;  1M18 B;  5B24 A;  3AZI A;  3KWQ A;  3AZJ D;  2FJ7 D;  4EO5 C;  4XZQ A;  5BO0 B;  3B6F D;  4YM6 D;  1F66 D;  5B40 B;  5B0Z A;  3AN2 C;  1TAF A;  1M1A B;  4YS3 A;  5B32 D;  1KX5 C;  5B2J C;  3REI B;  1ULY A;  3LJA B;  2NQB A;  5B24 D;  3AZI D;  5B1L A;  2L5A A;  3AZF C;  1A7W A;  1P3O B;  5CPI A;  5B31 C;  4CAY A;  2HUE B;  5JA4 B;  4WNN B;  4H9N A;  2ARO A;  4J8X D;  3AV1 A;  1P3I C;  3MGR D;  4KGC C;  5E5A C;  5GXQ A;  5B33 B;  3AZN A;  2PYO D;  5AV9 B;  3WAA A;  3O62 D;  1P3G D;  4ZUX A;  3VH6 T;  5CHL B;  5B40 C;  1M1A C;  5AV8 D;  4G91 B;  1ID3 C;  3WKJ C;  3REI C;  3LJA C;  5B24 B;  3WAA D;  4H9S A;  1P3O C;  3AZI B;  3KWQ B;  4ZUX D;  4X23 C;  4XZQ B;  5F99 A;  3AZL D;  1P3P D;  1AOI C;  1S32 A;  5B0Z B;  1TAF B;  3AYW A;  4YS3 B;  1P3K D;  3MVD C;  5AV6 D;  3REL D;  5DNN B;  2NQB B;  3W97 A;  5B33 C;  3AV2 A;  5B1L B;  3KXB D;  5CPI B;  5F99 D;  3AZJ C;  3B6F C;  1P3L A;  1F66 C;  5CPK A;  4H9N B;  2ARO B;  3AV1 B;  5GSU D;  5B32 C;  3UTA A;  5GXQ B;  3AZN B;  5B24 C;  5B1M A;  3AZI C;  3WAA B;  3VH5 T;  4XZQ C;  4ZUX B;  4WU9 A;  3REK A;  5B0Z C;  3LZ1 A;  4YS3 C;  3AN2 D;  2NQB C;  3X1U A;  5B1L C;  1KX5 D;  5B2J D;  5CPI C;  4R8P D;  1P3G C;  5AY8 A;  4WU8 D;  5DNM A;  1S32 B;  3LZ1 D;  2ARO C;  3AV1 C;  3AYW B;  3WA9 D;  3W96 B;  5BNV A;  3W97 B;  5GXQ C;  3AZN C;  3AV2 B;  1P3I D;  1F1E A;  3W99 A;  3WAA C;  5FUG A;  4NE5 A;  3KUY B;  4ZUX C;  5AV5 A;  1P3L B;  1P3P C;  3AZL C;  1M18 D;  3TU4 A;  5CPK B;  1U35 B;  3C1B A;  4J8V A;  5B40 D;  3UTA B;  1M1A D;  4H9S C;  5B1M B;  3KXB C;  3REI D;  3LJA D;  5F99 C;  3TU4 D;  4WU9 B;  3REK B;  1P3O D;  5BS7 A;  3VH6 W;  5CPJ A;  1H3O A;  3AV2 C;  1KX3 A;  3X1U B;  5AY8 B;  1P3L C;  5KDM A;  5DNM B;  1N1J B;  1EQZ A;  5AV9 D;  5CPK C;  3W98 A;  5BNV B;  4JJN A;  3UTA C;  3W99 B;  2HIO A;  5FUG B;  3MGQ A;  5JRG A;  3REH A;  4R8P C;  5AV5 B;  5DNN A;  4WU8 C;  4WU9 C;  1EQZ D;  2NZD A;  3TU4 B;  1HQ3 A;  3REK C;  3KWQ D;  3LZ1 C;  2BYK A;  4XZQ D;  3C1B B;  4J8V B;  4ZBJ B;  3WA9 C;  5C3I C;  5B0Z D;  4YS3 D;  3LEL A;  3B0B A;  4UUZ A;  1TZY A;  3REH D;  5AY8 C;  5DNN D;  5AVB A;  2NQB D;  2BYM A;  4Z2M G;  5B1L D;  5DNM C;  1P34 A;  1M18 C;  5CPI D;  3UT9 A;  5CPJ B;  1H3O B;  3REJ A;  2ARO D;  3AV1 D;  2YFV A;  3X1T A;  4QLC B;  1KX3 B;  3W99 C;  3B0D B;  1TZY D;  5AVB D;  4WV4 B;  5AV5 C;  5GXQ D;  5KDM B;  3AZN D;  3TU4 C;  1EQZ B;  4NE6 A;  3W98 B;  4Z2M H;  2HUE C;  3C1B C;  4LD9 A;  4ZBJ C;  4JJN B;  1ZLA A;  1WWI A;  2HIO B;  3MGS A;  3AZK A;  3MGQ B;  5JRG B;  3W96 A;  3WTP A;  3REH B;  2NZD B;  3UTB A;  1HQ3 B;  5AV9 C;  2CV5 B;  2BYK B;  3KUY A;  2F8N K;  1P3M A;  1S32 D;  1KU5 A;  4WZS B;  4J8U A;  3AZG A;  1U35 A;  1KX3 C;  3AYW D;  3MGS D;  3LEL B;  4UUZ B;  4G91 C;  3W96 D;  1R4V A;  1TZY B;  4H9Q A;  5AVB B;  3AZH A;  3W97 D;  2BYM B;  3AV2 D;  1EQZ C;  1P34 B;  3KUY D;  3KWQ C;  3UT9 B;  1P3A A;  1P3L D;  4J8U D;  3REJ B;  5CPK D;  4JJN C;  1U35 D;  2YFV B;  3X1T B;  2HIO C;  3MGQ C;  5AVC A;  5JRG C;  3AZH D;  3REH C;  3UTA D;  5DNN C; 
#chains in the Genus database with same CATH topology
 2NZD C;  1HQ3 C;  5B1M D;  2IO5 B;  2JSS A;  4WU9 D;  3REK D;  4LD9 B;  1N1J A;  5GT0 A;  5B31 G;  1ZLA B;  3H0L C;  5GT3 A;  3LEL C;  5AVC D;  3MGS B;  3AZK B;  1TZY C;  1M19 A;  3WTP B;  2BG1 A;  5AVB C;  4AWL B;  5B0Y A;  3X1U D;  3UTB B;  2F8N G;  3AZF A;  3UT9 C;  5B31 A;  5AY8 D;  3C1C A;  1P3M B;  5DNM D;  5GT0 D;  4J8U B;  3REJ C;  3AZM A;  3AZG B;  2Y2M A;  5GT3 D;  3AZE B;  4H9Q B;  3AZH B;  3W99 D;  1P3B A;  2IO5 C;  5AV5 D;  1P3A B;  3B0C T;  3AZM D;  3EPH A;  4Z5T B;  2Y2K A;  4XUJ A;  3NQU A;  1S32 C;  2F8N H;  4LD9 C;  4CSR A;  3H0M C;  3R45 A;  3AYW C;  3MGS C;  3AZK C;  3C1B D;  2DQN C;  3EG5 B;  5AVC B;  4J8V D;  4G92 B;  3W96 C;  1ID3 A;  3WKJ A;  1Q9C A;  4KUD B;  3MNN A;  4AWL C;  3W97 C;  3UTB C;  4QLC A;  2DF4 C;  2J8P A;  1P3F A;  3X1S A;  1Z2C B;  4X23 A;  3KUY C;  4NFT A;  3B6G A;  1BH8 A;  4EO5 B;  3X1V A;  1B6W A;  4HGA B;  1AOI A;  4J8W A;  4J8U C;  3AZG C;  5GT0 B;  1U35 C;  2RVQ D;  5GT3 B;  5CPJ D;  3MVD A;  1M19 B;  3MNN D;  3AZH C;  2JE5 A;  4QLC D;  1KX3 D;  5B0Y B;  1KX4 A;  3X1S D;  5B1M C;  5B32 G;  3AZF B;  3B6G D;  5B31 B;  1P3A C;  3C1C B;  3AZJ A;  2FJ7 A;  4YM6 A;  3AZM B;  2CV5 A;  3W98 D;  5AVC C;  2F8N B;  5B32 A;  4JJN D;  4KUD C;  1B67 A;  5B2I A;  1KX4 D;  5E5A B;  2HIO D;  3X1U C;  3MGQ D;  2ZY5 A;  1P3B B;  5JRG D;  5G49 A;  2NZD D;  4HGA C;  1HQ3 D;  4H9P A;  3NQU B;  4XUJ B;  5GT0 C;  3VH5 W;  2CV5 D;  5GT3 C;  4CSR B;  4J8X A;  3R45 B;  3MGR A;  2JCH A;  1M19 C;  1ID3 B;  3WKJ B;  3IP4 C;  5B2I D;  3MNN B;  5B0Y C;  3V9R A;  3LZ0 A;  3LEL D;  2PYO A;  1P3F B;  3X1S B;  3B6G B;  4X23 B;  1BH8 B;  3O62 A;  3C1C C;  3X1V B;  1P3G A;  4H9R A;  5CP6 A;  1P34 D;  1AOI B;  4J8W B;  3AZM C;  4Z66 A;  3UT9 D;  1JFI A;  2Y2Q A;  5AV8 A;  3MVD B;  4J8V C;  3REJ D;  3LZ0 D;  3X1T D;  1BFM A;  1WWS A;  1KX4 B;  1HTA A;  1P3B C;  5CP6 D;  3AZJ B;  2FJ7 B;  3B6F B;  1P3P A;  3AZL A;  4YM6 B;  4Z66 D;  4XUJ C;  1F66 B;  5BS7 C;  2RVQ C;  5CPJ C;  2LY8 A;  1P3K A;  4LD9 D;  1BH9 A;  5B32 B;  5AV6 A;  1ZLA D;  3MNN C;  5B2I B;  3REL A;  4QLC C;  2YFW A;  3AZE A;  3AZK D;  3B0D C;  1P3F C;  5G49 B;  3X1S C;  3KXB A;  3WTP D;  3B6G C;  5BT1 D;  3AFA A;  3X1V C;  3FDD A;  3UTB D;  4H9P B;  4J8W C;  3A6N A;  4J8X B;  3B0C W;  3KSY A;  3NQJ A;  4H9O A;  5GSU A;  1T3U A;  1P3M D;  3W98 C;  3MGR B;  3AZG D;  4Z5T A;  5BNX A;  3V9R B;  3LZ0 B;  3AZE D;  1KX4 C;  3MGP A;  2PYO B;  3VH6 A;  2UWX A;  3AFA D;  3O62 B;  1P3G B;  2FJ7 C;  4CAY B;  4H9R B;  5CP6 B;  4YM6 C;  3A6N D;  4Z66 B;  1JFI B;  4E44 A;  2CV5 C;  1P3A D;  5AV8 B;  4E45 A;  4Z5T D;  2CWE A;  5B2I C;  3AN2 A;  3MGP D;  3EPJ A;  2G5H C;  1KX5 A;  5B2J A;  2Y2N A;  4KUD D;  4R8P A;  4WU8 A;  1P3P B;  3AZL B;  1P34 C;  4KHA A;  4DRB A;  4J8X C;  1P3K B;  3MGR C;  1BH9 B;  3WA9 A;  5AV6 B;  3REL B;  3LZ0 C;  3X1T C;  2YFW B;  1P3I A;  2PYO C;  4DRA A;  1M19 D;  3KXB B;  2F8N A;  4KGC A;  3O62 C;  3AFA B;  5F99 B;  5CP6 C;  5B0Y D;  5E5A A;  1M18 A;  3AZF D;  4Z66 C;  3A6N B;  2Y2H A;  5B31 D;  4M6B A;  3C1C D;  4H9O B;  3NQJ B;  2Y2J A;  5BO0 A;  5GSU B;  5AV8 C;  2ZY3 A;  5B40 A;  5BNX B;  1ZLA C;  3VH5 A;  1M1A A;  3MGP B;  2F8N D;  4KGC D;  3WTP C;  3REI A;  5BT1 C;  5E5A D;  3LJA A;  1P3B D;  1P3O A;  4KUD A;  1P3K C;  1P3M C;  4XUJ D;  5JA4 A;  5AV6 C;  4WNN A;  3REL C;  3AN2 B;  3A1K A;  3AZE C;  4NE3 A;  2ZY4 A;  1ID3 D;  3WKJ D;  1KX5 B;  5B2J B;  3WTP E;  3AFA C;  4R8P B;  4WU8 B;  5B33 A;  3A6N C;  4KHA B;  5AV9 A;  4X23 D;  3LZ1 B;  1P3F D;  3AL0 C;  4WJ3 C;  3X1V D;  5GSU C;  1AOI D;  3B6F A;  4J8W D;  4Z5T C;  1F66 A;  5C3I B;  3WA9 B;  3MGP C;  1P3I B;  3MVD D;  2Y2G A;  4G92 C;  4KGC B;  5B33 D;  2VQR A;  1M18 B;  5B24 A;  3AZI A;  3KWQ A;  3AZJ D;  2FJ7 D;  4EO5 C;  4XZQ A;  5BO0 B;  3B6F D;  4YM6 D;  1F66 D;  5B40 B;  5B0Z A;  3AN2 C;  1TAF A;  1M1A B;  4YS3 A;  5B32 D;  1KX5 C;  5B2J C;  2Y2O A;  3REI B;  1ULY A;  3LJA B;  2NQB A;  5B24 D;  3AZI D;  5B1L A;  2L5A A;  3AZF C;  1A7W A;  1P3O B;  5CPI A;  2FFF B;  5B31 C;  4CAY A;  2HUE B;  5JA4 B;  4WNN B;  4H9N A;  2ARO A;  4J8X D;  3AV1 A;  1P3I C;  3MGR D;  4KGC C;  5E5A C;  5GXQ A;  5B33 B;  3AZN A;  2PYO D;  5AV9 B;  3WAA A;  3O62 D;  1P3G D;  4ZUX A;  3VH6 T;  5CHL B;  5B40 C;  1M1A C;  5AV8 D;  4G91 B;  4UPK A;  1ID3 C;  3WKJ C;  3REI C;  3LJA C;  5B24 B;  3WAA D;  4H9S A;  1P3O C;  3AZI B;  3KWQ B;  4ZUX D;  4X23 C;  4XZQ B;  5F99 A;  3AZL D;  1P3P D;  1AOI C;  1S32 A;  2Y2L A;  5B0Z B;  1TAF B;  2XD1 A;  3AYW A;  4YS3 B;  1P3K D;  3MVD C;  5AV6 D;  3REL D;  5DNN B;  2NQB B;  3W97 A;  5B33 C;  3AV2 A;  5B1L B;  3KXB D;  3A1I A;  5CPI B;  5F99 D;  3AZJ C;  3B6F C;  1P3L A;  1F66 C;  5CPK A;  4H9N B;  2ARO B;  3AV1 B;  5GSU D;  4DQY B;  5B32 C;  3UTA A;  5GXQ B;  3AZN B;  5B24 C;  5B1M A;  3AZI C;  3WAA B;  3VH5 T;  4XZQ C;  4ZUX B;  4WU9 A;  3REK A;  5B0Z C;  3LZ1 A;  4YS3 C;  1W2E A;  3AN2 D;  2Y2I A;  2NQB C;  3X1U A;  5B1L C;  1KX5 D;  5B2J D;  5CPI C;  4R8P D;  1P3G C;  5AY8 A;  4WU8 D;  5DNM A;  1S32 B;  3LZ1 D;  2ARO C;  3AV1 C;  3F6T A;  3AYW B;  2ZM5 A;  3WA9 D;  3W96 B;  5BNV A;  1PZR A;  3W97 B;  5GXQ C;  3AZN C;  3AV2 B;  1P3I D;  1F1E A;  3W99 A;  3WAA C;  5FUG A;  4NE5 A;  3KUY B;  4ZUX C;  5AV5 A;  1P3L B;  1P3P C;  3AZL C;  1M18 D;  3TU4 A;  5CPK B;  1U35 B;  2W8S A;  3C1B A;  4J8V A;  5B40 D;  3UTA B;  2Y2P A;  1M1A D;  2ZY2 A;  4H9S C;  2XD5 A;  5B1M B;  3KXB C;  3REI D;  3LJA D;  5F99 C;  3TU4 D;  4WU9 B;  3REK B;  1P3O D;  5BS7 A;  3VH6 W;  2RIQ A;  5CPJ A;  2G5I C;  1H3O A;  3AV2 C;  1KX3 A;  3X1U B;  5AY8 B;  3EPK A;  1P3L C;  5KDM A;  5DNM B;  1N1J B;  1EQZ A;  5AV9 D;  5CPK C;  3W98 A;  3H0R C;  5BNV B;  4JJN A;  3UTA C;  3W99 B;  2HIO A;  5FUG B;  3MGQ A;  5JRG A;  3REH A;  4R8P C;  5AV5 B;  5DNN A;  4WU8 C;  4WU9 C;  1EQZ D;  2NZD A;  3TU4 B;  1HQ3 A;  3REK C;  3KWQ D;  3LZ1 C;  2BYK A;  4XZQ D;  3C1B B;  4J8V B;  4ZBJ B;  3WA9 C;  5C3I C;  5B0Z D;  4YS3 D;  3LEL A;  3B0B A;  4UUZ A;  1TZY A;  3REH D;  5AY8 C;  5DNN D;  5AVB A;  2NQB D;  2BYM A;  4Z2M G;  5B1L D;  5DNM C;  1P34 A;  1M18 C;  5CPI D;  3UT9 A;  2F2A C;  5CPJ B;  1H3O B;  3REJ A;  2ARO D;  3AV1 D;  2YFV A;  3X1T A;  4QLC B;  1KX3 B;  3W99 C;  3B0D B;  1TZY D;  5AVB D;  4WV4 B;  5AV5 C;  5GXQ D;  5KDM B;  3AZN D;  3TU4 C;  1EQZ B;  4NE6 A;  3EPL A;  3P5J B;  3W98 B;  4Z2M H;  2HUE C;  3C1B C;  4LD9 A;  4ZBJ C;  4JJN B;  1ZLA A;  1WWI A;  2HIO B;  3MGS A;  3AZK A;  3MGQ B;  5JRG B;  3W96 A;  3WTP A;  3REH B;  2NZD B;  3UTB A;  1HQ3 B;  5AV9 C;  2CV5 B;  2BYK B;  3KUY A;  2F8N K;  1P3M A;  1S32 D;  1KU5 A;  4WZS B;  4J8U A;  3AZG A;  1U35 A;  1KX3 C;  3AYW D;  3MGS D;  3LEL B;  4UUZ B;  4G91 C;  3W96 D;  1R4V A;  1TZY B;  4H9Q A;  5AVB B;  3AZH A;  3W97 D;  2BYM B;  3AV2 D;  1EQZ C;  1P34 B;  3KUY D;  3KWQ C;  3UT9 B;  1P3A A;  1P3L D;  3KFU G;  4J8U D;  3REJ B;  5CPK D;  4JJN C;  1U35 D;  2YFV B;  3X1T B;  2HIO C;  3MGQ C;  5AVC A;  5JRG C;  3AZH D;  3REH C;  3UTA D;  5DNN C; 
#chains in the Genus database with same CATH homology
 2NZD C;  1HQ3 C;  5B1M D;  2IO5 B;  2JSS A;  4WU9 D;  3REK D;  4LD9 B;  1N1J A;  5GT0 A;  5B31 G;  1ZLA B;  3H0L C;  5GT3 A;  3LEL C;  5AVC D;  3MGS B;  3AZK B;  1TZY C;  1M19 A;  3WTP B;  2BG1 A;  5AVB C;  4AWL B;  5B0Y A;  3X1U D;  3UTB B;  2F8N G;  3AZF A;  3UT9 C;  5B31 A;  5AY8 D;  3C1C A;  1P3M B;  5DNM D;  5GT0 D;  4J8U B;  3REJ C;  3AZM A;  3AZG B;  2Y2M A;  5GT3 D;  3AZE B;  4H9Q B;  3AZH B;  3W99 D;  1P3B A;  2IO5 C;  5AV5 D;  1P3A B;  3B0C T;  3AZM D;  3EPH A;  4Z5T B;  2Y2K A;  4XUJ A;  3NQU A;  1S32 C;  2F8N H;  4LD9 C;  4CSR A;  3H0M C;  3R45 A;  3AYW C;  3MGS C;  3AZK C;  3C1B D;  2DQN C;  3EG5 B;  5AVC B;  4J8V D;  4G92 B;  3W96 C;  1ID3 A;  3WKJ A;  1Q9C A;  4KUD B;  3MNN A;  4AWL C;  3W97 C;  3UTB C;  4QLC A;  2DF4 C;  2J8P A;  1P3F A;  3X1S A;  1Z2C B;  4X23 A;  3KUY C;  4NFT A;  3B6G A;  1BH8 A;  4EO5 B;  3X1V A;  1B6W A;  4HGA B;  1AOI A;  4J8W A;  4J8U C;  3AZG C;  5GT0 B;  1U35 C;  2RVQ D;  5GT3 B;  5CPJ D;  3MVD A;  1M19 B;  3MNN D;  3AZH C;  2JE5 A;  4QLC D;  1KX3 D;  5B0Y B;  1KX4 A;  3X1S D;  5B1M C;  5B32 G;  3AZF B;  3B6G D;  5B31 B;  1P3A C;  3C1C B;  3AZJ A;  2FJ7 A;  4YM6 A;  3AZM B;  2CV5 A;  3W98 D;  5AVC C;  2F8N B;  5B32 A;  4JJN D;  4KUD C;  1B67 A;  5B2I A;  1KX4 D;  5E5A B;  2HIO D;  3X1U C;  3MGQ D;  2ZY5 A;  1P3B B;  5JRG D;  5G49 A;  2NZD D;  4HGA C;  1HQ3 D;  4H9P A;  3NQU B;  4XUJ B;  5GT0 C;  3VH5 W;  2CV5 D;  5GT3 C;  4CSR B;  4J8X A;  3R45 B;  3MGR A;  2JCH A;  1M19 C;  1ID3 B;  3WKJ B;  3IP4 C;  5B2I D;  3MNN B;  5B0Y C;  3V9R A;  3LZ0 A;  3LEL D;  2PYO A;  1P3F B;  3X1S B;  3B6G B;  4X23 B;  1BH8 B;  3O62 A;  3C1C C;  3X1V B;  1P3G A;  4H9R A;  5CP6 A;  1P34 D;  1AOI B;  4J8W B;  3AZM C;  4Z66 A;  3UT9 D;  1JFI A;  2Y2Q A;  5AV8 A;  3MVD B;  4J8V C;  3REJ D;  3LZ0 D;  3X1T D;  1BFM A;  1WWS A;  1KX4 B;  1HTA A;  1P3B C;  5CP6 D;  3AZJ B;  2FJ7 B;  3B6F B;  1P3P A;  3AZL A;  4YM6 B;  4Z66 D;  4XUJ C;  1F66 B;  5BS7 C;  2RVQ C;  5CPJ C;  2LY8 A;  1P3K A;  4LD9 D;  1BH9 A;  5B32 B;  5AV6 A;  1ZLA D;  3MNN C;  5B2I B;  3REL A;  4QLC C;  2YFW A;  3AZE A;  3AZK D;  3B0D C;  1P3F C;  5G49 B;  3X1S C;  3KXB A;  3WTP D;  3B6G C;  5BT1 D;  3AFA A;  3X1V C;  3FDD A;  3UTB D;  4H9P B;  4J8W C;  3A6N A;  4J8X B;  3B0C W;  3KSY A;  3NQJ A;  4H9O A;  5GSU A;  1T3U A;  1P3M D;  3W98 C;  3MGR B;  3AZG D;  4Z5T A;  5BNX A;  3V9R B;  3LZ0 B;  3AZE D;  1KX4 C;  3MGP A;  2PYO B;  3VH6 A;  2UWX A;  3AFA D;  3O62 B;  1P3G B;  2FJ7 C;  4CAY B;  4H9R B;  5CP6 B;  4YM6 C;  3A6N D;  4Z66 B;  1JFI B;  4E44 A;  2CV5 C;  1P3A D;  5AV8 B;  4E45 A;  4Z5T D;  2CWE A;  5B2I C;  3AN2 A;  3MGP D;  3EPJ A;  2G5H C;  1KX5 A;  5B2J A;  2Y2N A;  4KUD D;  4R8P A;  4WU8 A;  1P3P B;  3AZL B;  1P34 C;  4KHA A;  4DRB A;  4J8X C;  1P3K B;  3MGR C;  1BH9 B;  3WA9 A;  5AV6 B;  3REL B;  3LZ0 C;  3X1T C;  2YFW B;  1P3I A;  2PYO C;  4DRA A;  1M19 D;  3KXB B;  2F8N A;  4KGC A;  3O62 C;  3AFA B;  5F99 B;  5CP6 C;  5B0Y D;  5E5A A;  1M18 A;  3AZF D;  4Z66 C;  3A6N B;  2Y2H A;  5B31 D;  4M6B A;  3C1C D;  4H9O B;  3NQJ B;  2Y2J A;  5BO0 A;  5GSU B;  5AV8 C;  2ZY3 A;  5B40 A;  5BNX B;  1ZLA C;  3VH5 A;  1M1A A;  3MGP B;  2F8N D;  4KGC D;  3WTP C;  3REI A;  5BT1 C;  5E5A D;  3LJA A;  1P3B D;  1P3O A;  4KUD A;  1P3K C;  1P3M C;  4XUJ D;  5JA4 A;  5AV6 C;  4WNN A;  3REL C;  3AN2 B;  3A1K A;  3AZE C;  4NE3 A;  2ZY4 A;  1ID3 D;  3WKJ D;  1KX5 B;  5B2J B;  3WTP E;  3AFA C;  4R8P B;  4WU8 B;  5B33 A;  3A6N C;  4KHA B;  5AV9 A;  4X23 D;  3LZ1 B;  1P3F D;  3AL0 C;  4WJ3 C;  3X1V D;  5GSU C;  1AOI D;  3B6F A;  4J8W D;  4Z5T C;  1F66 A;  5C3I B;  3WA9 B;  3MGP C;  1P3I B;  3MVD D;  2Y2G A;  4G92 C;  4KGC B;  5B33 D;  2VQR A;  1M18 B;  5B24 A;  3AZI A;  3KWQ A;  3AZJ D;  2FJ7 D;  4EO5 C;  4XZQ A;  5BO0 B;  3B6F D;  4YM6 D;  1F66 D;  5B40 B;  5B0Z A;  3AN2 C;  1TAF A;  1M1A B;  4YS3 A;  5B32 D;  1KX5 C;  5B2J C;  2Y2O A;  3REI B;  1ULY A;  3LJA B;  2NQB A;  5B24 D;  3AZI D;  5B1L A;  2L5A A;  3AZF C;  1A7W A;  1P3O B;  5CPI A;  2FFF B;  5B31 C;  4CAY A;  2HUE B;  5JA4 B;  4WNN B;  4H9N A;  2ARO A;  4J8X D;  3AV1 A;  1P3I C;  3MGR D;  4KGC C;  5E5A C;  5GXQ A;  5B33 B;  3AZN A;  2PYO D;  5AV9 B;  3WAA A;  3O62 D;  1P3G D;  4ZUX A;  3VH6 T;  5CHL B;  5B40 C;  1M1A C;  5AV8 D;  4G91 B;  4UPK A;  1ID3 C;  3WKJ C;  3REI C;  3LJA C;  5B24 B;  3WAA D;  4H9S A;  1P3O C;  3AZI B;  3KWQ B;  4ZUX D;  4X23 C;  4XZQ B;  5F99 A;  3AZL D;  1P3P D;  1AOI C;  1S32 A;  2Y2L A;  5B0Z B;  1TAF B;  2XD1 A;  3AYW A;  4YS3 B;  1P3K D;  3MVD C;  5AV6 D;  3REL D;  5DNN B;  2NQB B;  3W97 A;  5B33 C;  3AV2 A;  5B1L B;  3KXB D;  3A1I A;  5CPI B;  5F99 D;  3AZJ C;  3B6F C;  1P3L A;  1F66 C;  5CPK A;  4H9N B;  2ARO B;  3AV1 B;  5GSU D;  4DQY B;  5B32 C;  3UTA A;  5GXQ B;  3AZN B;  5B24 C;  5B1M A;  3AZI C;  3WAA B;  3VH5 T;  4XZQ C;  4ZUX B;  4WU9 A;  3REK A;  5B0Z C;  3LZ1 A;  4YS3 C;  1W2E A;  3AN2 D;  2Y2I A;  2NQB C;  3X1U A;  5B1L C;  1KX5 D;  5B2J D;  5CPI C;  4R8P D;  1P3G C;  5AY8 A;  4WU8 D;  5DNM A;  1S32 B;  3LZ1 D;  2ARO C;  3AV1 C;  3F6T A;  3AYW B;  2ZM5 A;  3WA9 D;  3W96 B;  5BNV A;  1PZR A;  3W97 B;  5GXQ C;  3AZN C;  3AV2 B;  1P3I D;  1F1E A;  3W99 A;  3WAA C;  5FUG A;  4NE5 A;  3KUY B;  4ZUX C;  5AV5 A;  1P3L B;  1P3P C;  3AZL C;  1M18 D;  3TU4 A;  5CPK B;  1U35 B;  2W8S A;  3C1B A;  4J8V A;  5B40 D;  3UTA B;  2Y2P A;  1M1A D;  2ZY2 A;  4H9S C;  2XD5 A;  5B1M B;  3KXB C;  3REI D;  3LJA D;  5F99 C;  3TU4 D;  4WU9 B;  3REK B;  1P3O D;  5BS7 A;  3VH6 W;  2RIQ A;  5CPJ A;  2G5I C;  1H3O A;  3AV2 C;  1KX3 A;  3X1U B;  5AY8 B;  3EPK A;  1P3L C;  5KDM A;  5DNM B;  1N1J B;  1EQZ A;  5AV9 D;  5CPK C;  3W98 A;  3H0R C;  5BNV B;  4JJN A;  3UTA C;  3W99 B;  2HIO A;  5FUG B;  3MGQ A;  5JRG A;  3REH A;  4R8P C;  5AV5 B;  5DNN A;  4WU8 C;  4WU9 C;  1EQZ D;  2NZD A;  3TU4 B;  1HQ3 A;  3REK C;  3KWQ D;  3LZ1 C;  2BYK A;  4XZQ D;  3C1B B;  4J8V B;  4ZBJ B;  3WA9 C;  5C3I C;  5B0Z D;  4YS3 D;  3LEL A;  3B0B A;  4UUZ A;  1TZY A;  3REH D;  5AY8 C;  5DNN D;  5AVB A;  2NQB D;  2BYM A;  4Z2M G;  5B1L D;  5DNM C;  1P34 A;  1M18 C;  5CPI D;  3UT9 A;  2F2A C;  5CPJ B;  1H3O B;  3REJ A;  2ARO D;  3AV1 D;  2YFV A;  3X1T A;  4QLC B;  1KX3 B;  3W99 C;  3B0D B;  1TZY D;  5AVB D;  4WV4 B;  5AV5 C;  5GXQ D;  5KDM B;  3AZN D;  3TU4 C;  1EQZ B;  4NE6 A;  3EPL A;  3P5J B;  3W98 B;  4Z2M H;  2HUE C;  3C1B C;  4LD9 A;  4ZBJ C;  4JJN B;  1ZLA A;  1WWI A;  2HIO B;  3MGS A;  3AZK A;  3MGQ B;  5JRG B;  3W96 A;  3WTP A;  3REH B;  2NZD B;  3UTB A;  1HQ3 B;  5AV9 C;  2CV5 B;  2BYK B;  3KUY A;  2F8N K;  1P3M A;  1S32 D;  1KU5 A;  4WZS B;  4J8U A;  3AZG A;  1U35 A;  1KX3 C;  3AYW D;  3MGS D;  3LEL B;  4UUZ B;  4G91 C;  3W96 D;  1R4V A;  1TZY B;  4H9Q A;  5AVB B;  3AZH A;  3W97 D;  2BYM B;  3AV2 D;  1EQZ C;  1P34 B;  3KUY D;  3KWQ C;  3UT9 B;  1P3A A;  1P3L D;  3KFU G;  4J8U D;  3REJ B;  5CPK D;  4JJN C;  1U35 D;  2YFV B;  3X1T B;  2HIO C;  3MGQ C;  5AVC A;  5JRG C;  3AZH D;  3REH C;  3UTA D;  5DNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...