3KUYB

Dna stretching in the nucleosome facilitates alkylation by an intercalating antitumor agent
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title DNA stretching in the nucleosome facilitates alkylation by an intercalating antitumour agent
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kuyB00
5CP6D 1U35A 1HQ3B 3UTAC 1P3LA 4ZUXD 5B24B 3LZ0D 5FUGB 1P3FA 1P3OB 3AZHA 4J8XA 2NQBB 4XUJB 4AWLB 3AZLA 3REKD 4LD9C 5GSUB 4J8WD 3AZFD 5B0ZB 4R8PD 3VH5A 4WV4B 1ULYA 2YFWA 5GT3A 5CPIC 5AV5C 1P3PC 1M19B 3KWQA 3MGRC 5B33C 5DNNC 1TAFB 1HTAA 3X1UA 5B31G 1S32B 3AFAC 3AZGD 3LJAC 3R45A 2JSSA 4NE6A 5CPKA 1P3GA 3X1TC 3B0CW 5B32G 5AV8D 3LELD 3AN2B 4UUZA 1M1AB 5KDMA 1EQZA 3AZKC 3MGQD 1P3IC 2BYKA 3MVDA 3W96C 5AV6B 4J8UA 2PYOD 4X23A 4E45A 2NZDD 3RELA 4WU9A 1P3LB 5AVBD 3X1VC 3MNNA 3B0CT 1P3FB 3VH6T 5AVCA 3AZLB 3WKJA 1HQ3D 4Z66B 2HIOA 5B24D 5B2JC 1TZYC 1P3OD 3B6GA 2NQBD 4XUJD 2FJ7C 5B0YA 2YFWB 5GT3B 3A6NA 4J8WA 5GSUD 3REKA 5B0ZD 4R8PA 3AV2C 5BT1D 5DNMB 3REHC 3VH5W 3LZ1A 3X1UB 4J8VC 3R45B 5CPKB 1M19D 4JJNC 4KGCA 4G92C 5B2IB 1S32D 3AZMB 4UUZB 5KDMB 1EQZB 5C3IB 4CSRA 2BYKB 5AV8A 3W97C 3B0DC 2CV5A 4J8UB 3AN2D 1M1AD 5AV9C 3RELB 3AZJB 3X1SC 3WAAA 5AV6D 3W99C 3WA9B 2AROC 3REIA 1B6WA 3MNNB 4XZQC 4YM6A 3UTBA 5AVCB 5E5AA 2NZDA 3WKJB 5F99A 1H3OA 1P3LD 2HIOB 5AY8C 4ZBJC 1P3FD 3B6GB 1ID3C 5B0YB 3A6NB 3AZLD 5BS7A 4Z66D 1KX4C 5GXQC 3LZ1B 1KX5C 5GT0A 2NQBA 5BNXA 5GT3D 3UT9C 5GSUA 4WU8A 3C1CB 4G91C 5DNMD 4KGCB 3X1UD 1P34A 3W98C 1U35C 5CPKD 5CHLB 3AZNC 1AOIA 5B2ID 2CV5B 3KXBA 3AZHC 4J8XC 3AZMD 1EQZD 3W96B 4YS3C 5CPJC 3WTPA 5B1MC 3WAAB 5B40B 3AZIC 1WWIA 3REIB 4J8UD 2F8NH 3AZEC 4YM6B 5B1LC 3UTBB 3B6FA 5E5AB 1P3AA 3RELD 5F99B 3MGPC 3AZJD 1H3OB 3WA9D 3KWQC 3MNND 5AVCD 4KUDB 3REJB 3WKJD 1P3BC 4QLCA 1P3GC 2HIOD 1P3KA 2IO5C 5GT0B 3B6GD 5BNXB 5B0YD 3A6ND 4Z66A 4WU8B 1KX3C 3MVDC 3KUYC 4HGAB 4WZSB 3LZ1D 4X23C 1P34B 3AYWB 2RVQD 3C1CD 4WU9C 4H9SA 5DNMA 1P3MC 1F66C 4KGCD 1AOIB 1ZLAA 5CP6C 3KXBB 3C1BA 3WTPB 4ZUXC 3VH6W 3LZ0C 5B2IA 4Z2MH 3MGSA 2CV5D 3AZMA 4H9OA 3B6FB 3W96D 1P3AB 3AZFC 5B31B 4R8PC 3WAAD 5B40D 3REID 4YM6D 5B32B 3UTBD 5E5AD 2F8NA 3AZJA 5F99D 4QLCB 3AV1A 3WA9A 1B67A 4DRBA 1P3KB 3UTAA 4KUDD 3AZGC 3REJD 4DRAA 4EO5C 2BYMB 5JA4B 4H9NB 5AV8C 3LELC 4LD9A 5GT0D 1JFIA 3MGQC 4WU8D 5CPIA 3NQJA 4E44A 2PYOC 1ZLAB 5AV5A 1P34D 3C1BB 3AYWD 2NZDC 5B33A 3C1CA 5DNNA 2YFVB 5AVBC 1AOID 3LJAA 2HUEC 4Z5TB 3MGSB 3KXBD 4YS3B 4H9OB 1M18B 3X1TA 1HQ3C 5BS7C 5JRGB 3WTPD 5B24C 3O62B 1P3OC 1P3IA 4XUJC 4AWLC 3TU4B 2NQBC 3W96A 4H9QA 3B6FD 5GSUC 1P3AD 5B31D 5B0ZC 2F8NB 5B40A 3AV1B 5BT1C 5B32D 3UTAB 5BO0A 4QLCD 1BH9A 1M19C 1P3KD 4LD9B 4KUDA 1S32C 1JFIB 3REJA 3KUYB 5B2JA 1TZYA 5CPIB 3NQJB 3AN2C 1M1AC 4WNNA 2CWEA 5AV5B 1P3PB 3MGRB 5B33B 3WTPE 3REHA 1F66B 5DNNB 5AV6C 3AFAB 3LJAB 1ZLAD 3AYWA 3C1BD 3X1TB 3VH6A 1P3LC 1N1JB 5BNVA 3MGSD 1P3FC 4Z5TD 3AZKB 4H9RB 1P3IB 3AZLC 1M18D 4H9QB 4Z66C 5JRGD 5AV9A 3O62D 1F1EA 3TU4D 5GT3C 3X1SA 5BO0B 3W99A 5B31A 2AROA 3X1VB 2F8ND 3B0BA 1BH9B 3AV1D 4H9PA 5DNMC 5B32A 3X1UC 3UTAD 5AY8A 5CPKC 5B2JB 1TZYB 2FJ7B 1ID3A 4LD9D 4KHAA 5B2IC 3AZMC 4WNNB 3AV2B 1EQZC 1KX4A 5C3IC 2BYMA 5JA4A 4H9NA 3REHB 1KX5A 4J8VB 3UT9A 5CPID 4J8UC 4CAYA 5AV5D 1P3PD 3MGRD 5B33D 4JJNB 3RELC 3AZJC 1F66D 5DNND 4G92B 3WA9C 5BNVB 3MNNC 3AFAD 3LJAD 3W98A 5AVCC 1WWSA 3WKJC 3X1TD 3AZNA 3W97B 3B0DB 2YFVA 2HIOC 5AV9B 3NQUB 4Z5TA 3AZKD 4YS3A 5CPJA 3B6GC 1P3ID 1M18A 5B0YC 3A6NC 5B1MA 3X1SB 4J8WC 3REKC 3W99B 5JRGA 3AZIA 2AROB 3AZEA 4XZQB 3O62A 5B1LA 4H9PB 3LZ1C 3TU4A 3MGPA 3X1VD 5AY8B 2RVQC 3C1CC 4ZBJB 4KGCC 1ID3B 4KHAB 1P3BA 1KX4B 5GXQB 5B2JD 1TZYD 1KX5B 1Q9CA 2FJ7D 3UT9B 5G49A 2CV5C 1KX3A 3AV2D 4CAYB 3KUYA 4G91B 3REHD 3WAAC 5B40C 4J8VD 3REIC 4YM6C 3W98B 3UTBC 1U35B 1P3PA 5E5AC 3MGRA 1P3MA 4JJND 5F99C 3AZNB 1F66A 5CP6A 3AZHB 3AFAA 4J8XB 2L5AA 5CPJB 4KUDC 4NFTA 5B1MB 4ZUXA 3REJC 3KSYA 3LZ0A 3AZIB 3W97D 1N1JA 3AZEB 5B1LB 5AV9D 3AZKA 3AZFA 4H9RA 5GT0C 3MGPB 3X1SD 3W99D 2AROD 4WU8C 3KWQB 4HGAC 4XZQD 1P3BB 1P34C 1R4VA 3X1VA 3AYWC 3V9RA 1P3GB 5AY8D 2IO5B 4M6BA 2F8NG 1ID3D 3AZGA 1AOIC 5G49B 3KXBC 1KU5A 1KX3B 3MVDB 1KX4D 3LELA 5GXQD 1BFMA 3WTPC 1BH8A 1KX5D 2FJ7A 3VH5T 4X23B 3UT9D 3MGQA 3AV2A 3B6FC 1P3AC 4WU9B 5B31C 1P3MB 2F8NK 2PYOA 2LY8A 4J8VA 5CP6B 3W98D 5B32C 1U35D 5AVBA 4ZUXB 4JJNA 4QLCC 3AZND 3LZ0B 1P3KC 3AZHD 4J8XD 3REKB 4J8WB 1HQ3A 4YS3D 5CPJD 3AZFB 5B1MD 3W97A 5B24A 4R8PB 3AZID 5FUGA 1P3OA 3AZED 4XUJA 5B1LD 3NQUA 5B0ZA 3MGPD 3V9RB 3KWQD 4XZQA 4H9SC 4Z2MG 4NE5A 3AZGB 1P3BD 1ZLAC 4EO5B 1M19A 3C1BC 4CSRB 1P3GD 5AV8B 3LELB 1TAFA 1BH8B 1S32A 3MGSC 4Z5TC 4NE3A 3MGQB 1KX3D 3MVDD 3KUYD 1M18C 5GXQA 5JRGC 3AN2A 2PYOB 1M1AA 3O62C 4X23D 2NZDB 3TU4C 5AV6A 4WU9D 5AVBB 1P3MD 1A7WA 3AV1C 2HUEB
chains in the Genus database with same CATH superfamily
5CP6D 1U35A 1HQ3B 3UTAC 1P3LA 4ZUXD 5B24B 3LZ0D 5FUGB 1P3FA 1P3OB 3AZHA 4J8XA 2NQBB 4XUJB 4AWLB 3AZLA 3REKD 4LD9C 5GSUB 4J8WD 3AZFD 5B0ZB 4R8PD 3VH5A 4WV4B 1ULYA 2UWXA 2YFWA 5GT3A 5CPIC 5AV5C 1P3PC 1M19B 3KWQA 2ZY5A 3MGRC 5B33C 5DNNC 1TAFB 1HTAA 3X1UA 5B31G 1S32B 2Y2PA 4UPKA 3AFAC 3AZGD 3LJAC 3R45A 2JSSA 4NE6A 5CPKA 1P3GA 3X1TC 3B0CW 5B32G 5AV8D 3LELD 3AN2B 4UUZA 1M1AB 5KDMA 1EQZA 3AZKC 3MGQD 1P3IC 2BYKA 3MVDA 3W96C 5AV6B 4J8UA 2PYOD 4X23A 4E45A 2NZDD 3RELA 4WU9A 1P3LB 5AVBD 3X1VC 3MNNA 3B0CT 1P3FB 3VH6T 5AVCA 3AZLB 3WKJA 1HQ3D 4Z66B 2HIOA 5B24D 5B2JC 1TZYC 2F2AC 1P3OD 3B6GA 2NQBD 4XUJD 2FJ7C 5B0YA 2YFWB 5GT3B 3A6NA 4J8WA 5GSUD 3REKA 5B0ZD 4R8PA 3AV2C 5BT1D 2G5IC 5DNMB 3REHC 3VH5W 3LZ1A 3X1UB 4J8VC 3R45B 5CPKB 1M19D 4JJNC 4KGCA 4G92C 5B2IB 1S32D 3AZMB 4UUZB 5KDMB 1EQZB 5C3IB 4CSRA 2BYKB 5AV8A 3W97C 3B0DC 2CV5A 4J8UB 3AN2D 1M1AD 5AV9C 3RELB 3AZJB 3X1SC 3WAAA 5AV6D 3W99C 2DF4C 3WA9B 2AROC 3REIA 1B6WA 3MNNB 4XZQC 4YM6A 3UTBA 5AVCB 5E5AA 2NZDA 3WKJB 5F99A 1H3OA 1P3LD 2HIOB 5AY8C 4ZBJC 1P3FD 3B6GB 1ID3C 3EG5B 5B0YB 3A6NB 3AZLD 5BS7A 4Z66D 4WJ3C 1KX4C 5GXQC 3LZ1B 1KX5C 5GT0A 2NQBA 5BNXA 5GT3D 3UT9C 5GSUA 4WU8A 3C1CB 4G91C 5DNMD 4KGCB 3X1UD 3F6TA 1P34A 2Y2QA 3W98C 1U35C 5CPKD 5CHLB 3AZNC 1AOIA 5B2ID 2CV5B 3KXBA 3AZHC 4J8XC 3AZMD 1EQZD 3W96B 4YS3C 5CPJC 3WTPA 5B1MC 3WAAB 5B40B 3AZIC 2Y2OA 1WWIA 3REIB 4J8UD 2F8NH 3AZEC 4YM6B 5B1LC 3UTBB 3B6FA 5E5AB 1P3AA 3RELD 5F99B 3MGPC 3AZJD 1H3OB 3WA9D 3KWQC 3MNND 5AVCD 4KUDB 3REJB 3WKJD 1P3BC 4QLCA 1P3GC 2HIOD 1P3KA 2IO5C 2JCHA 5GT0B 3B6GD 5BNXB 5B0YD 3A6ND 4Z66A 4WU8B 1KX3C 3MVDC 3KUYC 4HGAB 4WZSB 3LZ1D 4X23C 1P34B 3AYWB 2RVQD 3C1CD 3IP4C 4H9SA 5DNMA 4WU9C 1P3MC 1F66C 4KGCD 1AOIB 1ZLAA 5CP6C 3KXBB 2BG1A 3C1BA 3EPJA 3WTPB 4ZUXC 3VH6W 3LZ0C 5B2IA 4Z2MH 3MGSA 2CV5D 3AZMA 4H9OA 3B6FB 3W96D 1P3AB 3AZFC 5B31B 4R8PC 3WAAD 5B40D 2ZY3A 3REID 4YM6D 5B32B 3UTBD 5E5AD 2F8NA 3AZJA 5F99D 4QLCB 3AV1A 3WA9A 1B67A 4DRBA 1P3KB 3UTAA 4KUDD 3AZGC 3REJD 4DRAA 4EO5C 2BYMB 5JA4B 4H9NB 5AV8C 3LELC 4LD9A 1Z2CB 5GT0D 1JFIA 3MGQC 4WU8D 5CPIA 3NQJA 3H0LC 4E44A 2PYOC 1ZLAB 2W8SA 5AV5A 1P34D 3C1BB 3AYWD 2NZDC 5B33A 3C1CA 5DNNA 2YFVB 5AVBC 1AOID 3LJAA 2HUEC 4Z5TB 3MGSB 3EPKA 3KXBD 4YS3B 4H9OB 1M18B 3X1TA 1T3UA 1HQ3C 5BS7C 5JRGB 3WTPD 5B24C 3O62B 1P3OC 1P3IA 4XUJC 4AWLC 3TU4B 2NQBC 3W96A 4H9QA 3B6FD 5GSUC 1P3AD 5B31D 5B0ZC 2F8NB 5B40A 3AV1B 5BT1C 5B32D 3UTAB 5BO0A 2Y2MA 4QLCD 1BH9A 1M19C 2G5HC 1P3KD 4DQYB 4LD9B 4KUDA 1S32C 1JFIB 3REJA 1PZRA 3KUYB 5B2JA 1TZYA 5CPIB 3NQJB 3AN2C 1M1AC 4WNNA 2CWEA 5AV5B 1P3PB 3MGRB 5B33B 3WTPE 3REHA 1F66B 5DNNB 5AV6C 3AL0C 3FDDA 3AFAB 3LJAB 1ZLAD 3AYWA 3C1BD 3X1TB 3VH6A 1P3LC 1N1JB 5BNVA 3MGSD 1P3FC 4Z5TD 3AZKB 4H9RB 1P3IB 3AZLC 1M18D 4H9QB 4Z66C 5JRGD 5AV9A 3O62D 2Y2LA 1F1EA 3TU4D 5GT3C 3X1SA 5BO0B 3W99A 5B31A 2AROA 3A1IA 3X1VB 2F8ND 3B0BA 1BH9B 3AV1D 2Y2JA 4H9PA 5DNMC 5B32A 3X1UC 3UTAD 5AY8A 5CPKC 5B2JB 1TZYB 2FJ7B 1ID3A 4LD9D 4KHAA 5B2IC 3AZMC 4WNNB 3AV2B 3EPHA 1EQZC 1KX4A 5C3IC 2BYMA 2JE5A 5JA4A 4H9NA 3REHB 1KX5A 4J8VB 3UT9A 5CPID 4J8UC 4CAYA 5AV5D 1P3PD 3MGRD 5B33D 4JJNB 3RELC 3AZJC 1F66D 5DNND 4G92B 3WA9C 5BNVB 3MNNC 3AFAD 3LJAD 3W98A 5AVCC 1WWSA 3WKJC 3X1TD 3AZNA 3W97B 3B0DB 2YFVA 2ZY2A 2HIOC 5AV9B 3NQUB 4Z5TA 3P5JB 3AZKD 4YS3A 5CPJA 3B6GC 1P3ID 1M18A 5B0YC 3A6NC 5B1MA 3X1SB 4J8WC 3REKC 3W99B 5JRGA 3AZIA 2AROB 3AZEA 4XZQB 3O62A 5B1LA 4H9PB 2ZM5A 2DQNC 2Y2IA 3LZ1C 3TU4A 3MGPA 3X1VD 2Y2GA 2RVQC 5AY8B 3C1CC 4ZBJB 4KGCC 1ID3B 4KHAB 1P3BA 2RIQA 1KX4B 5GXQB 5B2JD 1TZYD 1KX5B 1Q9CA 2FJ7D 2Y2HA 3UT9B 1W2EA 5G49A 2CV5C 1KX3A 3AV2D 4CAYB 3KUYA 4G91B 3REHD 3WAAC 5B40C 4J8VD 3REIC 4YM6C 3W98B 3UTBC 1U35B 1P3PA 2Y2KA 5E5AC 3MGRA 2XD1A 1P3MA 4JJND 5F99C 3AZNB 1F66A 5CP6A 3AZHB 3AFAA 4J8XB 2L5AA 5CPJB 4KUDC 4NFTA 3A1KA 5B1MB 4ZUXA 3KSYA 3LZ0A 3REJC 3AZIB 3W97D 1N1JA 3AZEB 2ZY4A 5B1LB 5AV9D 3AZKA 3AZFA 4H9RA 5GT0C 3MGPB 3X1SD 3W99D 2FFFB 2AROD 4WU8C 3KWQB 4HGAC 4XZQD 1P3BB 1P34C 2J8PA 1R4VA 3X1VA 3AYWC 3V9RA 1P3GB 5AY8D 2IO5B 4M6BA 2F8NG 1ID3D 3AZGA 1AOIC 5G49B 3KXBC 1KU5A 1KX3B 3MVDB 1KX4D 3LELA 5GXQD 1BFMA 3WTPC 1BH8A 2VQRA 1KX5D 2FJ7A 3VH5T 4X23B 3UT9D 3MGQA 3AV2A 3B6FC 1P3AC 4WU9B 5B31C 1P3MB 2F8NK 2PYOA 2LY8A 4J8VA 5CP6B 3W98D 5B32C 1U35D 5AVBA 4ZUXB 4JJNA 4QLCC 3AZND 3LZ0B 1P3KC 3AZHD 4J8XD 3KFUG 2XD5A 3REKB 4J8WB 1HQ3A 4YS3D 5CPJD 3AZFB 5B1MD 3W97A 5B24A 4R8PB 3AZID 5FUGA 1P3OA 3AZED 4XUJA 5B1LD 3NQUA 5B0ZA 3MGPD 2Y2NA 3V9RB 3KWQD 4XZQA 4H9SC 4Z2MG 4NE5A 3AZGB 1P3BD 1ZLAC 4EO5B 1M19A 3C1BC 4CSRB 1P3GD 5AV8B 3LELB 3EPLA 1TAFA 1BH8B 1S32A 3MGSC 4Z5TC 4NE3A 3MGQB 1KX3D 3MVDD 3KUYD 1M18C 5GXQA 5JRGC 3H0RC 3AN2A 2PYOB 1M1AA 3O62C 4X23D 2NZDB 3TU4C 5AV6A 4WU9D 5AVBB 1P3MD 1A7WA 3H0MC 3AV1C 2HUEB
chains in the Genus database with same CATH topology
5CP6D 1U35A 1HQ3B 3UTAC 1P3LA 4ZUXD 5B24B 3LZ0D 5FUGB 1P3FA 1P3OB 3AZHA 4J8XA 2NQBB 4XUJB 4AWLB 3AZLA 3REKD 4LD9C 5GSUB 4J8WD 3AZFD 5B0ZB 4R8PD 3VH5A 4WV4B 1ULYA 2UWXA 2YFWA 5GT3A 5CPIC 5AV5C 1P3PC 1M19B 3KWQA 2ZY5A 3MGRC 5B33C 5DNNC 1TAFB 1HTAA 3X1UA 5B31G 1S32B 2Y2PA 4UPKA 3AFAC 3AZGD 3LJAC 3R45A 2JSSA 4NE6A 5CPKA 1P3GA 3X1TC 3B0CW 5B32G 5AV8D 3LELD 3AN2B 4UUZA 1M1AB 5KDMA 1EQZA 3AZKC 3MGQD 1P3IC 2BYKA 3MVDA 3W96C 5AV6B 4J8UA 2PYOD 4X23A 4E45A 2NZDD 3RELA 4WU9A 1P3LB 5AVBD 3X1VC 3MNNA 3B0CT 1P3FB 3VH6T 5AVCA 3AZLB 3WKJA 1HQ3D 4Z66B 2HIOA 5B24D 5B2JC 1TZYC 2F2AC 1P3OD 3B6GA 2NQBD 4XUJD 2FJ7C 5B0YA 2YFWB 5GT3B 3A6NA 4J8WA 5GSUD 3REKA 5B0ZD 4R8PA 3AV2C 5BT1D 2G5IC 5DNMB 3REHC 3VH5W 3LZ1A 3X1UB 4J8VC 3R45B 5CPKB 1M19D 4JJNC 4KGCA 4G92C 5B2IB 1S32D 3AZMB 4UUZB 5KDMB 1EQZB 5C3IB 4CSRA 2BYKB 5AV8A 3W97C 3B0DC 2CV5A 4J8UB 3AN2D 1M1AD 5AV9C 3RELB 3AZJB 3X1SC 3WAAA 5AV6D 3W99C 2DF4C 3WA9B 2AROC 3REIA 1B6WA 3MNNB 4XZQC 4YM6A 3UTBA 5AVCB 5E5AA 2NZDA 3WKJB 5F99A 1H3OA 1P3LD 2HIOB 5AY8C 4ZBJC 1P3FD 3B6GB 1ID3C 3EG5B 5B0YB 3A6NB 3AZLD 5BS7A 4Z66D 4WJ3C 1KX4C 5GXQC 3LZ1B 1KX5C 5GT0A 2NQBA 5BNXA 5GT3D 3UT9C 5GSUA 4WU8A 3C1CB 4G91C 5DNMD 4KGCB 3X1UD 3F6TA 1P34A 2Y2QA 3W98C 1U35C 5CPKD 5CHLB 3AZNC 1AOIA 5B2ID 2CV5B 3KXBA 3AZHC 4J8XC 3AZMD 1EQZD 3W96B 4YS3C 5CPJC 3WTPA 5B1MC 3WAAB 5B40B 3AZIC 2Y2OA 1WWIA 3REIB 4J8UD 2F8NH 3AZEC 4YM6B 5B1LC 3UTBB 3B6FA 5E5AB 1P3AA 3RELD 5F99B 3MGPC 3AZJD 1H3OB 3WA9D 3KWQC 3MNND 5AVCD 4KUDB 3REJB 3WKJD 1P3BC 4QLCA 1P3GC 2HIOD 1P3KA 2IO5C 2JCHA 5GT0B 3B6GD 5BNXB 5B0YD 3A6ND 4Z66A 4WU8B 1KX3C 3MVDC 3KUYC 4HGAB 4WZSB 3LZ1D 4X23C 1P34B 3AYWB 2RVQD 3C1CD 3IP4C 4H9SA 5DNMA 4WU9C 1P3MC 1F66C 4KGCD 1AOIB 1ZLAA 5CP6C 3KXBB 2BG1A 3C1BA 3EPJA 3WTPB 4ZUXC 3VH6W 3LZ0C 5B2IA 4Z2MH 3MGSA 2CV5D 3AZMA 4H9OA 3B6FB 3W96D 1P3AB 3AZFC 5B31B 4R8PC 3WAAD 5B40D 2ZY3A 3REID 4YM6D 5B32B 3UTBD 5E5AD 2F8NA 3AZJA 5F99D 4QLCB 3AV1A 3WA9A 1B67A 4DRBA 1P3KB 3UTAA 4KUDD 3AZGC 3REJD 4DRAA 4EO5C 2BYMB 5JA4B 4H9NB 5AV8C 3LELC 4LD9A 1Z2CB 5GT0D 1JFIA 3MGQC 4WU8D 5CPIA 3NQJA 3H0LC 4E44A 2PYOC 1ZLAB 2W8SA 5AV5A 1P34D 3C1BB 3AYWD 2NZDC 5B33A 3C1CA 5DNNA 2YFVB 5AVBC 1AOID 3LJAA 2HUEC 4Z5TB 3MGSB 3EPKA 3KXBD 4YS3B 4H9OB 1M18B 3X1TA 1T3UA 1HQ3C 5BS7C 5JRGB 3WTPD 5B24C 3O62B 1P3OC 1P3IA 4XUJC 4AWLC 3TU4B 2NQBC 3W96A 4H9QA 3B6FD 5GSUC 1P3AD 5B31D 5B0ZC 2F8NB 5B40A 3AV1B 5BT1C 5B32D 3UTAB 5BO0A 2Y2MA 4QLCD 1BH9A 1M19C 2G5HC 1P3KD 4DQYB 4LD9B 4KUDA 1S32C 1JFIB 3REJA 1PZRA 3KUYB 5B2JA 1TZYA 5CPIB 3NQJB 3AN2C 1M1AC 4WNNA 2CWEA 5AV5B 1P3PB 3MGRB 5B33B 3WTPE 3REHA 1F66B 5DNNB 5AV6C 3AL0C 3FDDA 3AFAB 3LJAB 1ZLAD 3AYWA 3C1BD 3X1TB 3VH6A 1P3LC 1N1JB 5BNVA 3MGSD 1P3FC 4Z5TD 3AZKB 4H9RB 1P3IB 3AZLC 1M18D 4H9QB 4Z66C 5JRGD 5AV9A 3O62D 2Y2LA 1F1EA 3TU4D 5GT3C 3X1SA 5BO0B 3W99A 5B31A 2AROA 3A1IA 3X1VB 2F8ND 3B0BA 1BH9B 3AV1D 2Y2JA 4H9PA 5DNMC 5B32A 3X1UC 3UTAD 5AY8A 5CPKC 5B2JB 1TZYB 2FJ7B 1ID3A 4LD9D 4KHAA 5B2IC 3AZMC 4WNNB 3AV2B 3EPHA 1EQZC 1KX4A 5C3IC 2BYMA 2JE5A 5JA4A 4H9NA 3REHB 1KX5A 4J8VB 3UT9A 5CPID 4J8UC 4CAYA 5AV5D 1P3PD 3MGRD 5B33D 4JJNB 3RELC 3AZJC 1F66D 5DNND 4G92B 3WA9C 5BNVB 3MNNC 3AFAD 3LJAD 3W98A 5AVCC 1WWSA 3WKJC 3X1TD 3AZNA 3W97B 3B0DB 2YFVA 2ZY2A 2HIOC 5AV9B 3NQUB 4Z5TA 3P5JB 3AZKD 4YS3A 5CPJA 3B6GC 1P3ID 1M18A 5B0YC 3A6NC 5B1MA 3X1SB 4J8WC 3REKC 3W99B 5JRGA 3AZIA 2AROB 3AZEA 4XZQB 3O62A 5B1LA 4H9PB 2ZM5A 2DQNC 2Y2IA 3LZ1C 3TU4A 3MGPA 3X1VD 2Y2GA 2RVQC 5AY8B 3C1CC 4ZBJB 4KGCC 1ID3B 4KHAB 1P3BA 2RIQA 1KX4B 5GXQB 5B2JD 1TZYD 1KX5B 1Q9CA 2FJ7D 2Y2HA 3UT9B 1W2EA 5G49A 2CV5C 1KX3A 3AV2D 4CAYB 3KUYA 4G91B 3REHD 3WAAC 5B40C 4J8VD 3REIC 4YM6C 3W98B 3UTBC 1U35B 1P3PA 2Y2KA 5E5AC 3MGRA 2XD1A 1P3MA 4JJND 5F99C 3AZNB 1F66A 5CP6A 3AZHB 3AFAA 4J8XB 2L5AA 5CPJB 4KUDC 4NFTA 3A1KA 5B1MB 4ZUXA 3KSYA 3LZ0A 3REJC 3AZIB 3W97D 1N1JA 3AZEB 2ZY4A 5B1LB 5AV9D 3AZKA 3AZFA 4H9RA 5GT0C 3MGPB 3X1SD 3W99D 2FFFB 2AROD 4WU8C 3KWQB 4HGAC 4XZQD 1P3BB 1P34C 2J8PA 1R4VA 3X1VA 3AYWC 3V9RA 1P3GB 5AY8D 2IO5B 4M6BA 2F8NG 1ID3D 3AZGA 1AOIC 5G49B 3KXBC 1KU5A 1KX3B 3MVDB 1KX4D 3LELA 5GXQD 1BFMA 3WTPC 1BH8A 2VQRA 1KX5D 2FJ7A 3VH5T 4X23B 3UT9D 3MGQA 3AV2A 3B6FC 1P3AC 4WU9B 5B31C 1P3MB 2F8NK 2PYOA 2LY8A 4J8VA 5CP6B 3W98D 5B32C 1U35D 5AVBA 4ZUXB 4JJNA 4QLCC 3AZND 3LZ0B 1P3KC 3AZHD 4J8XD 3KFUG 2XD5A 3REKB 4J8WB 1HQ3A 4YS3D 5CPJD 3AZFB 5B1MD 3W97A 5B24A 4R8PB 3AZID 5FUGA 1P3OA 3AZED 4XUJA 5B1LD 3NQUA 5B0ZA 3MGPD 2Y2NA 3V9RB 3KWQD 4XZQA 4H9SC 4Z2MG 4NE5A 3AZGB 1P3BD 1ZLAC 4EO5B 1M19A 3C1BC 4CSRB 1P3GD 5AV8B 3LELB 3EPLA 1TAFA 1BH8B 1S32A 3MGSC 4Z5TC 4NE3A 3MGQB 1KX3D 3MVDD 3KUYD 1M18C 5GXQA 5JRGC 3H0RC 3AN2A 2PYOB 1M1AA 3O62C 4X23D 2NZDB 3TU4C 5AV6A 4WU9D 5AVBB 1P3MD 1A7WA 3H0MC 3AV1C 2HUEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 D;  1U35 A;  1HQ3 B;  3UTA C;  1P3L A;  4ZUX D;  5B24 B;  3LZ0 D;  5FUG B;  1P3F A;  1P3O B;  3AZH A;  4J8X A;  2NQB B;  4XUJ B;  4AWL B;  3AZL A;  3REK D;  4LD9 C;  5GSU B;  4J8W D;  3AZF D;  5B0Z B;  4R8P D;  3VH5 A;  4WV4 B;  1ULY A;  2YFW A;  5GT3 A;  5CPI C;  5AV5 C;  1P3P C;  1M19 B;  3KWQ A;  3MGR C;  5B33 C;  5DNN C;  1TAF B;  1HTA A;  3X1U A;  5B31 G;  1S32 B;  3AFA C;  3AZG D;  3LJA C;  3R45 A;  2JSS A;  4NE6 A;  5CPK A;  1P3G A;  3X1T C;  3B0C W;  5B32 G;  5AV8 D;  3LEL D;  3AN2 B;  4UUZ A;  1M1A B;  5KDM A;  1EQZ A;  3AZK C;  3MGQ D;  1P3I C;  2BYK A;  3MVD A;  3W96 C;  5AV6 B;  4J8U A;  2PYO D;  4X23 A;  4E45 A;  2NZD D;  3REL A;  4WU9 A;  1P3L B;  5AVB D;  3X1V C;  3MNN A;  3B0C T;  1P3F B;  3VH6 T;  5AVC A;  3AZL B;  3WKJ A;  1HQ3 D;  4Z66 B;  2HIO A;  5B24 D;  5B2J C;  1TZY C;  1P3O D;  3B6G A;  2NQB D;  4XUJ D;  2FJ7 C;  5B0Y A;  2YFW B;  5GT3 B;  3A6N A;  4J8W A;  5GSU D;  3REK A;  5B0Z D;  4R8P A;  3AV2 C;  5BT1 D;  5DNM B;  3REH C;  3VH5 W;  3LZ1 A;  3X1U B;  4J8V C;  3R45 B;  5CPK B;  1M19 D;  4JJN C;  4KGC A;  4G92 C;  5B2I B;  1S32 D;  3AZM B;  4UUZ B;  5KDM B;  1EQZ B;  5C3I B;  4CSR A;  2BYK B;  5AV8 A;  3W97 C;  3B0D C;  2CV5 A;  4J8U B;  3AN2 D;  1M1A D;  5AV9 C;  3REL B;  3AZJ B;  3X1S C;  3WAA A;  5AV6 D;  3W99 C;  3WA9 B;  2ARO C;  3REI A;  1B6W A;  3MNN B;  4XZQ C;  4YM6 A;  3UTB A;  5AVC B;  5E5A A;  2NZD A;  3WKJ B;  5F99 A;  1H3O A;  1P3L D;  2HIO B;  5AY8 C;  4ZBJ C;  1P3F D;  3B6G B;  1ID3 C;  5B0Y B;  3A6N B;  3AZL D;  5BS7 A;  4Z66 D;  1KX4 C;  5GXQ C;  3LZ1 B;  1KX5 C;  5GT0 A;  2NQB A;  5BNX A;  5GT3 D;  3UT9 C;  5GSU A;  4WU8 A;  3C1C B;  4G91 C;  5DNM D;  4KGC B;  3X1U D;  1P34 A;  3W98 C;  1U35 C;  5CPK D;  5CHL B;  3AZN C;  1AOI A;  5B2I D;  2CV5 B;  3KXB A;  3AZH C;  4J8X C;  3AZM D;  1EQZ D;  3W96 B;  4YS3 C;  5CPJ C;  3WTP A;  5B1M C;  3WAA B;  5B40 B;  3AZI C;  1WWI A;  3REI B;  4J8U D;  2F8N H;  3AZE C;  4YM6 B;  5B1L C;  3UTB B;  3B6F A;  5E5A B;  1P3A A;  3REL D;  5F99 B;  3MGP C;  3AZJ D;  1H3O B;  3WA9 D;  3KWQ C;  3MNN D;  5AVC D;  4KUD B;  3REJ B;  3WKJ D;  1P3B C;  4QLC A;  1P3G C;  2HIO D;  1P3K A;  2IO5 C;  5GT0 B;  3B6G D;  5BNX B;  5B0Y D;  3A6N D;  4Z66 A;  4WU8 B;  1KX3 C;  3MVD C;  3KUY C;  4HGA B;  4WZS B;  3LZ1 D;  4X23 C;  1P34 B;  3AYW B;  2RVQ D;  3C1C D;  4WU9 C;  4H9S A;  5DNM A;  1P3M C;  1F66 C;  4KGC D;  1AOI B;  1ZLA A;  5CP6 C;  3KXB B;  3C1B A;  3WTP B;  4ZUX C;  3VH6 W;  3LZ0 C;  5B2I A;  4Z2M H;  3MGS A;  2CV5 D;  3AZM A;  4H9O A;  3B6F B;  3W96 D;  1P3A B;  3AZF C;  5B31 B;  4R8P C;  3WAA D;  5B40 D;  3REI D;  4YM6 D;  5B32 B;  3UTB D;  5E5A D;  2F8N A;  3AZJ A;  5F99 D;  4QLC B;  3AV1 A;  3WA9 A;  1B67 A;  4DRB A;  1P3K B;  3UTA A;  4KUD D;  3AZG C;  3REJ D;  4DRA A;  4EO5 C;  2BYM B;  5JA4 B;  4H9N B;  5AV8 C;  3LEL C;  4LD9 A;  5GT0 D;  1JFI A;  3MGQ C;  4WU8 D;  5CPI A;  3NQJ A;  4E44 A;  2PYO C;  1ZLA B;  5AV5 A;  1P34 D;  3C1B B;  3AYW D;  2NZD C;  5B33 A;  3C1C A;  5DNN A;  2YFV B;  5AVB C;  1AOI D;  3LJA A;  2HUE C;  4Z5T B;  3MGS B;  3KXB D;  4YS3 B;  4H9O B;  1M18 B;  3X1T A;  1HQ3 C;  5BS7 C;  5JRG B;  3WTP D;  5B24 C;  3O62 B;  1P3O C;  1P3I A;  4XUJ C;  4AWL C;  3TU4 B;  2NQB C;  3W96 A;  4H9Q A;  3B6F D;  5GSU C;  1P3A D;  5B31 D;  5B0Z C;  2F8N B;  5B40 A;  3AV1 B;  5BT1 C;  5B32 D;  3UTA B;  5BO0 A;  4QLC D;  1BH9 A;  1M19 C;  1P3K D;  4LD9 B;  4KUD A;  1S32 C;  1JFI B;  3REJ A;  3KUY B;  5B2J A;  1TZY A;  5CPI B;  3NQJ B;  3AN2 C;  1M1A C;  4WNN A;  2CWE A;  5AV5 B;  1P3P B;  3MGR B;  5B33 B;  3WTP E;  3REH A;  1F66 B;  5DNN B;  5AV6 C;  3AFA B;  3LJA B;  1ZLA D;  3AYW A;  3C1B D;  3X1T B;  3VH6 A;  1P3L C;  1N1J B;  5BNV A;  3MGS D;  1P3F C;  4Z5T D;  3AZK B;  4H9R B;  1P3I B;  3AZL C;  1M18 D;  4H9Q B;  4Z66 C;  5JRG D;  5AV9 A;  3O62 D;  1F1E A;  3TU4 D;  5GT3 C;  3X1S A;  5BO0 B;  3W99 A;  5B31 A;  2ARO A;  3X1V B;  2F8N D;  3B0B A;  1BH9 B;  3AV1 D;  4H9P A;  5DNM C;  5B32 A;  3X1U C;  3UTA D;  5AY8 A;  5CPK C;  5B2J B;  1TZY B;  2FJ7 B;  1ID3 A;  4LD9 D;  4KHA A;  5B2I C;  3AZM C;  4WNN B;  3AV2 B;  1EQZ C;  1KX4 A;  5C3I C;  2BYM A;  5JA4 A;  4H9N A;  3REH B;  1KX5 A;  4J8V B;  3UT9 A;  5CPI D;  4J8U C;  4CAY A;  5AV5 D;  1P3P D;  3MGR D;  5B33 D;  4JJN B;  3REL C;  3AZJ C;  1F66 D;  5DNN D;  4G92 B;  3WA9 C;  5BNV B;  3MNN C;  3AFA D;  3LJA D;  3W98 A;  5AVC C;  1WWS A;  3WKJ C;  3X1T D;  3AZN A;  3W97 B;  3B0D B;  2YFV A;  2HIO C;  5AV9 B;  3NQU B;  4Z5T A;  3AZK D;  4YS3 A;  5CPJ A;  3B6G C;  1P3I D;  1M18 A;  5B0Y C;  3A6N C;  5B1M A;  3X1S B;  4J8W C;  3REK C;  3W99 B;  5JRG A;  3AZI A;  2ARO B;  3AZE A;  4XZQ B;  3O62 A;  5B1L A;  4H9P B;  3LZ1 C;  3TU4 A;  3MGP A;  3X1V D;  5AY8 B;  2RVQ C;  3C1C C;  4ZBJ B;  4KGC C;  1ID3 B;  4KHA B;  1P3B A;  1KX4 B;  5GXQ B;  5B2J D;  1TZY D;  1KX5 B;  1Q9C A;  2FJ7 D;  3UT9 B;  5G49 A;  2CV5 C;  1KX3 A;  3AV2 D;  4CAY B;  3KUY A;  4G91 B;  3REH D;  3WAA C;  5B40 C;  4J8V D;  3REI C;  4YM6 C;  3W98 B;  3UTB C;  1U35 B;  1P3P A;  5E5A C;  3MGR A;  1P3M A;  4JJN D;  5F99 C;  3AZN B;  1F66 A;  5CP6 A;  3AZH B;  3AFA A;  4J8X B;  2L5A A;  5CPJ B;  4KUD C;  4NFT A;  5B1M B;  4ZUX A;  3REJ C;  3KSY A;  3LZ0 A;  3AZI B;  3W97 D;  1N1J A;  3AZE B;  5B1L B;  5AV9 D;  3AZK A;  3AZF A;  4H9R A;  5GT0 C;  3MGP B;  3X1S D;  3W99 D;  2ARO D;  4WU8 C;  3KWQ B;  4HGA C;  4XZQ D;  1P3B B;  1P34 C;  1R4V A;  3X1V A;  3AYW C;  3V9R A;  1P3G B;  5AY8 D;  2IO5 B;  4M6B A;  2F8N G;  1ID3 D;  3AZG A;  1AOI C;  5G49 B;  3KXB C;  1KU5 A;  1KX3 B;  3MVD B;  1KX4 D;  3LEL A;  5GXQ D;  1BFM A;  3WTP C;  1BH8 A;  1KX5 D;  2FJ7 A;  3VH5 T;  4X23 B;  3UT9 D;  3MGQ A;  3AV2 A;  3B6F C;  1P3A C;  4WU9 B;  5B31 C;  1P3M B;  2F8N K;  2PYO A;  2LY8 A;  4J8V A;  5CP6 B;  3W98 D;  5B32 C;  1U35 D;  5AVB A;  4ZUX B;  4JJN A;  4QLC C;  3AZN D;  3LZ0 B;  1P3K C;  3AZH D;  4J8X D;  3REK B;  4J8W B;  1HQ3 A;  4YS3 D;  5CPJ D;  3AZF B;  5B1M D;  3W97 A;  5B24 A;  4R8P B;  3AZI D;  5FUG A;  1P3O A;  3AZE D;  4XUJ A;  5B1L D;  3NQU A;  5B0Z A;  3MGP D;  3V9R B;  3KWQ D;  4XZQ A;  4H9S C;  4Z2M G;  4NE5 A;  3AZG B;  1P3B D;  1ZLA C;  4EO5 B;  1M19 A;  3C1B C;  4CSR B;  1P3G D;  5AV8 B;  3LEL B;  1TAF A;  1BH8 B;  1S32 A;  3MGS C;  4Z5T C;  4NE3 A;  3MGQ B;  1KX3 D;  3MVD D;  3KUY D;  1M18 C;  5GXQ A;  5JRG C;  3AN2 A;  2PYO B;  1M1A A;  3O62 C;  4X23 D;  2NZD B;  3TU4 C;  5AV6 A;  4WU9 D;  5AVB B;  1P3M D;  1A7W A;  3AV1 C;  2HUE B; 
#chains in the Genus database with same CATH topology
 5CP6 D;  1U35 A;  1HQ3 B;  3UTA C;  1P3L A;  4ZUX D;  5B24 B;  3LZ0 D;  5FUG B;  1P3F A;  1P3O B;  3AZH A;  4J8X A;  2NQB B;  4XUJ B;  4AWL B;  3AZL A;  3REK D;  4LD9 C;  5GSU B;  4J8W D;  3AZF D;  5B0Z B;  4R8P D;  3VH5 A;  4WV4 B;  1ULY A;  2UWX A;  2YFW A;  5GT3 A;  5CPI C;  5AV5 C;  1P3P C;  1M19 B;  3KWQ A;  2ZY5 A;  3MGR C;  5B33 C;  5DNN C;  1TAF B;  1HTA A;  3X1U A;  5B31 G;  1S32 B;  2Y2P A;  4UPK A;  3AFA C;  3AZG D;  3LJA C;  3R45 A;  2JSS A;  4NE6 A;  5CPK A;  1P3G A;  3X1T C;  3B0C W;  5B32 G;  5AV8 D;  3LEL D;  3AN2 B;  4UUZ A;  1M1A B;  5KDM A;  1EQZ A;  3AZK C;  3MGQ D;  1P3I C;  2BYK A;  3MVD A;  3W96 C;  5AV6 B;  4J8U A;  2PYO D;  4X23 A;  4E45 A;  2NZD D;  3REL A;  4WU9 A;  1P3L B;  5AVB D;  3X1V C;  3MNN A;  3B0C T;  1P3F B;  3VH6 T;  5AVC A;  3AZL B;  3WKJ A;  1HQ3 D;  4Z66 B;  2HIO A;  5B24 D;  5B2J C;  1TZY C;  2F2A C;  1P3O D;  3B6G A;  2NQB D;  4XUJ D;  2FJ7 C;  5B0Y A;  2YFW B;  5GT3 B;  3A6N A;  4J8W A;  5GSU D;  3REK A;  5B0Z D;  4R8P A;  3AV2 C;  5BT1 D;  2G5I C;  5DNM B;  3REH C;  3VH5 W;  3LZ1 A;  3X1U B;  4J8V C;  3R45 B;  5CPK B;  1M19 D;  4JJN C;  4KGC A;  4G92 C;  5B2I B;  1S32 D;  3AZM B;  4UUZ B;  5KDM B;  1EQZ B;  5C3I B;  4CSR A;  2BYK B;  5AV8 A;  3W97 C;  3B0D C;  2CV5 A;  4J8U B;  3AN2 D;  1M1A D;  5AV9 C;  3REL B;  3AZJ B;  3X1S C;  3WAA A;  5AV6 D;  3W99 C;  2DF4 C;  3WA9 B;  2ARO C;  3REI A;  1B6W A;  3MNN B;  4XZQ C;  4YM6 A;  3UTB A;  5AVC B;  5E5A A;  2NZD A;  3WKJ B;  5F99 A;  1H3O A;  1P3L D;  2HIO B;  5AY8 C;  4ZBJ C;  1P3F D;  3B6G B;  1ID3 C;  3EG5 B;  5B0Y B;  3A6N B;  3AZL D;  5BS7 A;  4Z66 D;  4WJ3 C;  1KX4 C;  5GXQ C;  3LZ1 B;  1KX5 C;  5GT0 A;  2NQB A;  5BNX A;  5GT3 D;  3UT9 C;  5GSU A;  4WU8 A;  3C1C B;  4G91 C;  5DNM D;  4KGC B;  3X1U D;  3F6T A;  1P34 A;  2Y2Q A;  3W98 C;  1U35 C;  5CPK D;  5CHL B;  3AZN C;  1AOI A;  5B2I D;  2CV5 B;  3KXB A;  3AZH C;  4J8X C;  3AZM D;  1EQZ D;  3W96 B;  4YS3 C;  5CPJ C;  3WTP A;  5B1M C;  3WAA B;  5B40 B;  3AZI C;  2Y2O A;  1WWI A;  3REI B;  4J8U D;  2F8N H;  3AZE C;  4YM6 B;  5B1L C;  3UTB B;  3B6F A;  5E5A B;  1P3A A;  3REL D;  5F99 B;  3MGP C;  3AZJ D;  1H3O B;  3WA9 D;  3KWQ C;  3MNN D;  5AVC D;  4KUD B;  3REJ B;  3WKJ D;  1P3B C;  4QLC A;  1P3G C;  2HIO D;  1P3K A;  2IO5 C;  2JCH A;  5GT0 B;  3B6G D;  5BNX B;  5B0Y D;  3A6N D;  4Z66 A;  4WU8 B;  1KX3 C;  3MVD C;  3KUY C;  4HGA B;  4WZS B;  3LZ1 D;  4X23 C;  1P34 B;  3AYW B;  2RVQ D;  3C1C D;  3IP4 C;  4H9S A;  5DNM A;  4WU9 C;  1P3M C;  1F66 C;  4KGC D;  1AOI B;  1ZLA A;  5CP6 C;  3KXB B;  2BG1 A;  3C1B A;  3EPJ A;  3WTP B;  4ZUX C;  3VH6 W;  3LZ0 C;  5B2I A;  4Z2M H;  3MGS A;  2CV5 D;  3AZM A;  4H9O A;  3B6F B;  3W96 D;  1P3A B;  3AZF C;  5B31 B;  4R8P C;  3WAA D;  5B40 D;  2ZY3 A;  3REI D;  4YM6 D;  5B32 B;  3UTB D;  5E5A D;  2F8N A;  3AZJ A;  5F99 D;  4QLC B;  3AV1 A;  3WA9 A;  1B67 A;  4DRB A;  1P3K B;  3UTA A;  4KUD D;  3AZG C;  3REJ D;  4DRA A;  4EO5 C;  2BYM B;  5JA4 B;  4H9N B;  5AV8 C;  3LEL C;  4LD9 A;  1Z2C B;  5GT0 D;  1JFI A;  3MGQ C;  4WU8 D;  5CPI A;  3NQJ A;  3H0L C;  4E44 A;  2PYO C;  1ZLA B;  2W8S A;  5AV5 A;  1P34 D;  3C1B B;  3AYW D;  2NZD C;  5B33 A;  3C1C A;  5DNN A;  2YFV B;  5AVB C;  1AOI D;  3LJA A;  2HUE C;  4Z5T B;  3MGS B;  3EPK A;  3KXB D;  4YS3 B;  4H9O B;  1M18 B;  3X1T A;  1T3U A;  1HQ3 C;  5BS7 C;  5JRG B;  3WTP D;  5B24 C;  3O62 B;  1P3O C;  1P3I A;  4XUJ C;  4AWL C;  3TU4 B;  2NQB C;  3W96 A;  4H9Q A;  3B6F D;  5GSU C;  1P3A D;  5B31 D;  5B0Z C;  2F8N B;  5B40 A;  3AV1 B;  5BT1 C;  5B32 D;  3UTA B;  5BO0 A;  2Y2M A;  4QLC D;  1BH9 A;  1M19 C;  2G5H C;  1P3K D;  4DQY B;  4LD9 B;  4KUD A;  1S32 C;  1JFI B;  3REJ A;  1PZR A;  3KUY B;  5B2J A;  1TZY A;  5CPI B;  3NQJ B;  3AN2 C;  1M1A C;  4WNN A;  2CWE A;  5AV5 B;  1P3P B;  3MGR B;  5B33 B;  3WTP E;  3REH A;  1F66 B;  5DNN B;  5AV6 C;  3AL0 C;  3FDD A;  3AFA B;  3LJA B;  1ZLA D;  3AYW A;  3C1B D;  3X1T B;  3VH6 A;  1P3L C;  1N1J B;  5BNV A;  3MGS D;  1P3F C;  4Z5T D;  3AZK B;  4H9R B;  1P3I B;  3AZL C;  1M18 D;  4H9Q B;  4Z66 C;  5JRG D;  5AV9 A;  3O62 D;  2Y2L A;  1F1E A;  3TU4 D;  5GT3 C;  3X1S A;  5BO0 B;  3W99 A;  5B31 A;  2ARO A;  3A1I A;  3X1V B;  2F8N D;  3B0B A;  1BH9 B;  3AV1 D;  2Y2J A;  4H9P A;  5DNM C;  5B32 A;  3X1U C;  3UTA D;  5AY8 A;  5CPK C;  5B2J B;  1TZY B;  2FJ7 B;  1ID3 A;  4LD9 D;  4KHA A;  5B2I C;  3AZM C;  4WNN B;  3AV2 B;  3EPH A;  1EQZ C;  1KX4 A;  5C3I C;  2BYM A;  2JE5 A;  5JA4 A;  4H9N A;  3REH B;  1KX5 A;  4J8V B;  3UT9 A;  5CPI D;  4J8U C;  4CAY A;  5AV5 D;  1P3P D;  3MGR D;  5B33 D;  4JJN B;  3REL C;  3AZJ C;  1F66 D;  5DNN D;  4G92 B;  3WA9 C;  5BNV B;  3MNN C;  3AFA D;  3LJA D;  3W98 A;  5AVC C;  1WWS A;  3WKJ C;  3X1T D;  3AZN A;  3W97 B;  3B0D B;  2YFV A;  2ZY2 A;  2HIO C;  5AV9 B;  3NQU B;  4Z5T A;  3P5J B;  3AZK D;  4YS3 A;  5CPJ A;  3B6G C;  1P3I D;  1M18 A;  5B0Y C;  3A6N C;  5B1M A;  3X1S B;  4J8W C;  3REK C;  3W99 B;  5JRG A;  3AZI A;  2ARO B;  3AZE A;  4XZQ B;  3O62 A;  5B1L A;  4H9P B;  2ZM5 A;  2DQN C;  2Y2I A;  3LZ1 C;  3TU4 A;  3MGP A;  3X1V D;  2Y2G A;  2RVQ C;  5AY8 B;  3C1C C;  4ZBJ B;  4KGC C;  1ID3 B;  4KHA B;  1P3B A;  2RIQ A;  1KX4 B;  5GXQ B;  5B2J D;  1TZY D;  1KX5 B;  1Q9C A;  2FJ7 D;  2Y2H A;  3UT9 B;  1W2E A;  5G49 A;  2CV5 C;  1KX3 A;  3AV2 D;  4CAY B;  3KUY A;  4G91 B;  3REH D;  3WAA C;  5B40 C;  4J8V D;  3REI C;  4YM6 C;  3W98 B;  3UTB C;  1U35 B;  1P3P A;  2Y2K A;  5E5A C;  3MGR A;  2XD1 A;  1P3M A;  4JJN D;  5F99 C;  3AZN B;  1F66 A;  5CP6 A;  3AZH B;  3AFA A;  4J8X B;  2L5A A;  5CPJ B;  4KUD C;  4NFT A;  3A1K A;  5B1M B;  4ZUX A;  3KSY A;  3LZ0 A;  3REJ C;  3AZI B;  3W97 D;  1N1J A;  3AZE B;  2ZY4 A;  5B1L B;  5AV9 D;  3AZK A;  3AZF A;  4H9R A;  5GT0 C;  3MGP B;  3X1S D;  3W99 D;  2FFF B;  2ARO D;  4WU8 C;  3KWQ B;  4HGA C;  4XZQ D;  1P3B B;  1P34 C;  2J8P A;  1R4V A;  3X1V A;  3AYW C;  3V9R A;  1P3G B;  5AY8 D;  2IO5 B;  4M6B A;  2F8N G;  1ID3 D;  3AZG A;  1AOI C;  5G49 B;  3KXB C;  1KU5 A;  1KX3 B;  3MVD B;  1KX4 D;  3LEL A;  5GXQ D;  1BFM A;  3WTP C;  1BH8 A;  2VQR A;  1KX5 D;  2FJ7 A;  3VH5 T;  4X23 B;  3UT9 D;  3MGQ A;  3AV2 A;  3B6F C;  1P3A C;  4WU9 B;  5B31 C;  1P3M B;  2F8N K;  2PYO A;  2LY8 A;  4J8V A;  5CP6 B;  3W98 D;  5B32 C;  1U35 D;  5AVB A;  4ZUX B;  4JJN A;  4QLC C;  3AZN D;  3LZ0 B;  1P3K C;  3AZH D;  4J8X D;  3KFU G;  2XD5 A;  3REK B;  4J8W B;  1HQ3 A;  4YS3 D;  5CPJ D;  3AZF B;  5B1M D;  3W97 A;  5B24 A;  4R8P B;  3AZI D;  5FUG A;  1P3O A;  3AZE D;  4XUJ A;  5B1L D;  3NQU A;  5B0Z A;  3MGP D;  2Y2N A;  3V9R B;  3KWQ D;  4XZQ A;  4H9S C;  4Z2M G;  4NE5 A;  3AZG B;  1P3B D;  1ZLA C;  4EO5 B;  1M19 A;  3C1B C;  4CSR B;  1P3G D;  5AV8 B;  3LEL B;  3EPL A;  1TAF A;  1BH8 B;  1S32 A;  3MGS C;  4Z5T C;  4NE3 A;  3MGQ B;  1KX3 D;  3MVD D;  3KUY D;  1M18 C;  5GXQ A;  5JRG C;  3H0R C;  3AN2 A;  2PYO B;  1M1A A;  3O62 C;  4X23 D;  2NZD B;  3TU4 C;  5AV6 A;  4WU9 D;  5AVB B;  1P3M D;  1A7W A;  3H0M C;  3AV1 C;  2HUE B; 
#chains in the Genus database with same CATH homology
 5CP6 D;  1U35 A;  1HQ3 B;  3UTA C;  1P3L A;  4ZUX D;  5B24 B;  3LZ0 D;  5FUG B;  1P3F A;  1P3O B;  3AZH A;  4J8X A;  2NQB B;  4XUJ B;  4AWL B;  3AZL A;  3REK D;  4LD9 C;  5GSU B;  4J8W D;  3AZF D;  5B0Z B;  4R8P D;  3VH5 A;  4WV4 B;  1ULY A;  2UWX A;  2YFW A;  5GT3 A;  5CPI C;  5AV5 C;  1P3P C;  1M19 B;  3KWQ A;  2ZY5 A;  3MGR C;  5B33 C;  5DNN C;  1TAF B;  1HTA A;  3X1U A;  5B31 G;  1S32 B;  2Y2P A;  4UPK A;  3AFA C;  3AZG D;  3LJA C;  3R45 A;  2JSS A;  4NE6 A;  5CPK A;  1P3G A;  3X1T C;  3B0C W;  5B32 G;  5AV8 D;  3LEL D;  3AN2 B;  4UUZ A;  1M1A B;  5KDM A;  1EQZ A;  3AZK C;  3MGQ D;  1P3I C;  2BYK A;  3MVD A;  3W96 C;  5AV6 B;  4J8U A;  2PYO D;  4X23 A;  4E45 A;  2NZD D;  3REL A;  4WU9 A;  1P3L B;  5AVB D;  3X1V C;  3MNN A;  3B0C T;  1P3F B;  3VH6 T;  5AVC A;  3AZL B;  3WKJ A;  1HQ3 D;  4Z66 B;  2HIO A;  5B24 D;  5B2J C;  1TZY C;  2F2A C;  1P3O D;  3B6G A;  2NQB D;  4XUJ D;  2FJ7 C;  5B0Y A;  2YFW B;  5GT3 B;  3A6N A;  4J8W A;  5GSU D;  3REK A;  5B0Z D;  4R8P A;  3AV2 C;  5BT1 D;  2G5I C;  5DNM B;  3REH C;  3VH5 W;  3LZ1 A;  3X1U B;  4J8V C;  3R45 B;  5CPK B;  1M19 D;  4JJN C;  4KGC A;  4G92 C;  5B2I B;  1S32 D;  3AZM B;  4UUZ B;  5KDM B;  1EQZ B;  5C3I B;  4CSR A;  2BYK B;  5AV8 A;  3W97 C;  3B0D C;  2CV5 A;  4J8U B;  3AN2 D;  1M1A D;  5AV9 C;  3REL B;  3AZJ B;  3X1S C;  3WAA A;  5AV6 D;  3W99 C;  2DF4 C;  3WA9 B;  2ARO C;  3REI A;  1B6W A;  3MNN B;  4XZQ C;  4YM6 A;  3UTB A;  5AVC B;  5E5A A;  2NZD A;  3WKJ B;  5F99 A;  1H3O A;  1P3L D;  2HIO B;  5AY8 C;  4ZBJ C;  1P3F D;  3B6G B;  1ID3 C;  3EG5 B;  5B0Y B;  3A6N B;  3AZL D;  5BS7 A;  4Z66 D;  4WJ3 C;  1KX4 C;  5GXQ C;  3LZ1 B;  1KX5 C;  5GT0 A;  2NQB A;  5BNX A;  5GT3 D;  3UT9 C;  5GSU A;  4WU8 A;  3C1C B;  4G91 C;  5DNM D;  4KGC B;  3X1U D;  3F6T A;  1P34 A;  2Y2Q A;  3W98 C;  1U35 C;  5CPK D;  5CHL B;  3AZN C;  1AOI A;  5B2I D;  2CV5 B;  3KXB A;  3AZH C;  4J8X C;  3AZM D;  1EQZ D;  3W96 B;  4YS3 C;  5CPJ C;  3WTP A;  5B1M C;  3WAA B;  5B40 B;  3AZI C;  2Y2O A;  1WWI A;  3REI B;  4J8U D;  2F8N H;  3AZE C;  4YM6 B;  5B1L C;  3UTB B;  3B6F A;  5E5A B;  1P3A A;  3REL D;  5F99 B;  3MGP C;  3AZJ D;  1H3O B;  3WA9 D;  3KWQ C;  3MNN D;  5AVC D;  4KUD B;  3REJ B;  3WKJ D;  1P3B C;  4QLC A;  1P3G C;  2HIO D;  1P3K A;  2IO5 C;  2JCH A;  5GT0 B;  3B6G D;  5BNX B;  5B0Y D;  3A6N D;  4Z66 A;  4WU8 B;  1KX3 C;  3MVD C;  3KUY C;  4HGA B;  4WZS B;  3LZ1 D;  4X23 C;  1P34 B;  3AYW B;  2RVQ D;  3C1C D;  3IP4 C;  4H9S A;  5DNM A;  4WU9 C;  1P3M C;  1F66 C;  4KGC D;  1AOI B;  1ZLA A;  5CP6 C;  3KXB B;  2BG1 A;  3C1B A;  3EPJ A;  3WTP B;  4ZUX C;  3VH6 W;  3LZ0 C;  5B2I A;  4Z2M H;  3MGS A;  2CV5 D;  3AZM A;  4H9O A;  3B6F B;  3W96 D;  1P3A B;  3AZF C;  5B31 B;  4R8P C;  3WAA D;  5B40 D;  2ZY3 A;  3REI D;  4YM6 D;  5B32 B;  3UTB D;  5E5A D;  2F8N A;  3AZJ A;  5F99 D;  4QLC B;  3AV1 A;  3WA9 A;  1B67 A;  4DRB A;  1P3K B;  3UTA A;  4KUD D;  3AZG C;  3REJ D;  4DRA A;  4EO5 C;  2BYM B;  5JA4 B;  4H9N B;  5AV8 C;  3LEL C;  4LD9 A;  1Z2C B;  5GT0 D;  1JFI A;  3MGQ C;  4WU8 D;  5CPI A;  3NQJ A;  3H0L C;  4E44 A;  2PYO C;  1ZLA B;  2W8S A;  5AV5 A;  1P34 D;  3C1B B;  3AYW D;  2NZD C;  5B33 A;  3C1C A;  5DNN A;  2YFV B;  5AVB C;  1AOI D;  3LJA A;  2HUE C;  4Z5T B;  3MGS B;  3EPK A;  3KXB D;  4YS3 B;  4H9O B;  1M18 B;  3X1T A;  1T3U A;  1HQ3 C;  5BS7 C;  5JRG B;  3WTP D;  5B24 C;  3O62 B;  1P3O C;  1P3I A;  4XUJ C;  4AWL C;  3TU4 B;  2NQB C;  3W96 A;  4H9Q A;  3B6F D;  5GSU C;  1P3A D;  5B31 D;  5B0Z C;  2F8N B;  5B40 A;  3AV1 B;  5BT1 C;  5B32 D;  3UTA B;  5BO0 A;  2Y2M A;  4QLC D;  1BH9 A;  1M19 C;  2G5H C;  1P3K D;  4DQY B;  4LD9 B;  4KUD A;  1S32 C;  1JFI B;  3REJ A;  1PZR A;  3KUY B;  5B2J A;  1TZY A;  5CPI B;  3NQJ B;  3AN2 C;  1M1A C;  4WNN A;  2CWE A;  5AV5 B;  1P3P B;  3MGR B;  5B33 B;  3WTP E;  3REH A;  1F66 B;  5DNN B;  5AV6 C;  3AL0 C;  3FDD A;  3AFA B;  3LJA B;  1ZLA D;  3AYW A;  3C1B D;  3X1T B;  3VH6 A;  1P3L C;  1N1J B;  5BNV A;  3MGS D;  1P3F C;  4Z5T D;  3AZK B;  4H9R B;  1P3I B;  3AZL C;  1M18 D;  4H9Q B;  4Z66 C;  5JRG D;  5AV9 A;  3O62 D;  2Y2L A;  1F1E A;  3TU4 D;  5GT3 C;  3X1S A;  5BO0 B;  3W99 A;  5B31 A;  2ARO A;  3A1I A;  3X1V B;  2F8N D;  3B0B A;  1BH9 B;  3AV1 D;  2Y2J A;  4H9P A;  5DNM C;  5B32 A;  3X1U C;  3UTA D;  5AY8 A;  5CPK C;  5B2J B;  1TZY B;  2FJ7 B;  1ID3 A;  4LD9 D;  4KHA A;  5B2I C;  3AZM C;  4WNN B;  3AV2 B;  3EPH A;  1EQZ C;  1KX4 A;  5C3I C;  2BYM A;  2JE5 A;  5JA4 A;  4H9N A;  3REH B;  1KX5 A;  4J8V B;  3UT9 A;  5CPI D;  4J8U C;  4CAY A;  5AV5 D;  1P3P D;  3MGR D;  5B33 D;  4JJN B;  3REL C;  3AZJ C;  1F66 D;  5DNN D;  4G92 B;  3WA9 C;  5BNV B;  3MNN C;  3AFA D;  3LJA D;  3W98 A;  5AVC C;  1WWS A;  3WKJ C;  3X1T D;  3AZN A;  3W97 B;  3B0D B;  2YFV A;  2ZY2 A;  2HIO C;  5AV9 B;  3NQU B;  4Z5T A;  3P5J B;  3AZK D;  4YS3 A;  5CPJ A;  3B6G C;  1P3I D;  1M18 A;  5B0Y C;  3A6N C;  5B1M A;  3X1S B;  4J8W C;  3REK C;  3W99 B;  5JRG A;  3AZI A;  2ARO B;  3AZE A;  4XZQ B;  3O62 A;  5B1L A;  4H9P B;  2ZM5 A;  2DQN C;  2Y2I A;  3LZ1 C;  3TU4 A;  3MGP A;  3X1V D;  2Y2G A;  2RVQ C;  5AY8 B;  3C1C C;  4ZBJ B;  4KGC C;  1ID3 B;  4KHA B;  1P3B A;  2RIQ A;  1KX4 B;  5GXQ B;  5B2J D;  1TZY D;  1KX5 B;  1Q9C A;  2FJ7 D;  2Y2H A;  3UT9 B;  1W2E A;  5G49 A;  2CV5 C;  1KX3 A;  3AV2 D;  4CAY B;  3KUY A;  4G91 B;  3REH D;  3WAA C;  5B40 C;  4J8V D;  3REI C;  4YM6 C;  3W98 B;  3UTB C;  1U35 B;  1P3P A;  2Y2K A;  5E5A C;  3MGR A;  2XD1 A;  1P3M A;  4JJN D;  5F99 C;  3AZN B;  1F66 A;  5CP6 A;  3AZH B;  3AFA A;  4J8X B;  2L5A A;  5CPJ B;  4KUD C;  4NFT A;  3A1K A;  5B1M B;  4ZUX A;  3KSY A;  3LZ0 A;  3REJ C;  3AZI B;  3W97 D;  1N1J A;  3AZE B;  2ZY4 A;  5B1L B;  5AV9 D;  3AZK A;  3AZF A;  4H9R A;  5GT0 C;  3MGP B;  3X1S D;  3W99 D;  2FFF B;  2ARO D;  4WU8 C;  3KWQ B;  4HGA C;  4XZQ D;  1P3B B;  1P34 C;  2J8P A;  1R4V A;  3X1V A;  3AYW C;  3V9R A;  1P3G B;  5AY8 D;  2IO5 B;  4M6B A;  2F8N G;  1ID3 D;  3AZG A;  1AOI C;  5G49 B;  3KXB C;  1KU5 A;  1KX3 B;  3MVD B;  1KX4 D;  3LEL A;  5GXQ D;  1BFM A;  3WTP C;  1BH8 A;  2VQR A;  1KX5 D;  2FJ7 A;  3VH5 T;  4X23 B;  3UT9 D;  3MGQ A;  3AV2 A;  3B6F C;  1P3A C;  4WU9 B;  5B31 C;  1P3M B;  2F8N K;  2PYO A;  2LY8 A;  4J8V A;  5CP6 B;  3W98 D;  5B32 C;  1U35 D;  5AVB A;  4ZUX B;  4JJN A;  4QLC C;  3AZN D;  3LZ0 B;  1P3K C;  3AZH D;  4J8X D;  3KFU G;  2XD5 A;  3REK B;  4J8W B;  1HQ3 A;  4YS3 D;  5CPJ D;  3AZF B;  5B1M D;  3W97 A;  5B24 A;  4R8P B;  3AZI D;  5FUG A;  1P3O A;  3AZE D;  4XUJ A;  5B1L D;  3NQU A;  5B0Z A;  3MGP D;  2Y2N A;  3V9R B;  3KWQ D;  4XZQ A;  4H9S C;  4Z2M G;  4NE5 A;  3AZG B;  1P3B D;  1ZLA C;  4EO5 B;  1M19 A;  3C1B C;  4CSR B;  1P3G D;  5AV8 B;  3LEL B;  3EPL A;  1TAF A;  1BH8 B;  1S32 A;  3MGS C;  4Z5T C;  4NE3 A;  3MGQ B;  1KX3 D;  3MVD D;  3KUY D;  1M18 C;  5GXQ A;  5JRG C;  3H0R C;  3AN2 A;  2PYO B;  1M1A A;  3O62 C;  4X23 D;  2NZD B;  3TU4 C;  5AV6 A;  4WU9 D;  5AVB B;  1P3M D;  1A7W A;  3H0M C;  3AV1 C;  2HUE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...