1M1AD

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aD00
4WU8A 4H9PA 4KUDA 5AVBA 3B6FC 3LZ1B 3WTPE 2NQBD 3AZGB 3KXBB 3AZJA 1P3FD 3AZID 3V9RB 5BT1D 4H9QA 5B0YA 5AV9B 4M6BA 5KDMB 3C1BC 1HTAA 4E45A 3AZEA 5B24D 3AZLC 1P3IB 4Z5TD 5B0ZC 4H9OB 5AY8A 2HIOC 3AZMB 3UTAB 5FUGB 3UTBC 3WKJB 3REIC 3LZ1A 4ZUXC 3AZFC 3AYWD 1HQ3C 3AZGA 3X1SD 3KXBA 1TZYC 1ZLAC 5JRGD 4J8WD 4JJNB 3V9RA 3AV1D 5CP6C 1M19C 1B6WA 5AV9A 5KDMA 1TAFB 3B6GD 3C1BB 3X1TD 5B1LC 1P3IA 5E5AB 1P3MD 4H9OA 1M18B 3AZMA 3UTAA 5FUGA 1U35B 4E44A 3WKJA 3WA9D 4KGCD 5B40C 4Z66B 1P34B 3REIB 3B6FA 4ZUXB 5GT0C 3MVDD 3MGSB 1P3AC 5DNNC 2NZDD 1KX5C 1TZYB 1H3OB 3LELD 4JJNA 4LD9B 3W99D 1A7WA 2BYKB 5CP6B 1M19B 1P3GD 1TAFA 5AV8C 3C1BA 5E5AA 4DRBA 1P3BB 4Z2MG 5B0ZA 3MGPC 3AZNC 4J8UC 1M18A 2NQBB 4Z66A 1B67A 4DRAA 5B40B 1P34A 3REIA 4ZUXA 3MGSA 4CSRB 5AV6C 5GT0B 1H3OA 1TZYA 5CPKC 3UT9D 5B1MC 4G91C 3AZKC 4LD9A 1P3LC 3X1UD 1AOIC 2BYKA 2JSSA 5CP6A 1M19A 4UUZB 3WTPD 3TU4D 5AV8B 1M1AD 1ULYA 1P3BA 2NQBA 1KX4B 1BH8A 4WU8C 5CPID 4KUDC 5AVBC 1F1EA 1S32D 5B40A 5GT3D 3MNND 3W97D 4CSRA 3AZJC 5GT0A 4WU9D 3REKC 3X1TB 5CPKB 3LJAC 5B1MB 3W96D 4X23D 5B0YC 5B2JB 5AVCD 4QLCB 3C1CC 1AOIB 3NQJB 3AFAC 5B31D 4UUZA 3VH5T 3LZ0D 5CPJD 5AV8A 4J8XC 3AZHD 3NQUB 1KX4A 3O62D 3MGPA 1F66B 4H9NB 3REJC 3AZGC 5AV5D 5B32B 3REHD 4J8VB 2PYOD 5CPKA 3REKB 5B1MA 3LJAB 3B0CT 5B2JA 3WAAB 4QLCA 1AOIA 3NQJA 3C1CB 3AFAB 3NQUA 4J8XB 3MGQB 5GSUC 3UTAC 2RVQC 3WKJC 1F66A 4H9NA 3A6ND 5B32G 3REJB 3AZLD 2AROD 4JJNC 4AWLC 5B32A 3UTBD 4J8VA 3TU4B 3RELD 2YFVB 3X1VC 3REKA 1ID3C 3LJAA 2HUEB 3AZFD 1HQ3D 3WAAA 1P3PD 1ZLAD 3C1CA 3VH5A 3AFAA 5E5AC 3VH6W 1M18C 4J8XA 3MGQA 3W97B 4YM6B 5GSUB 1U35C 4Z66C 2CV5C 4XZQC 3REJA 1P34C 2FJ7C 1N1JB 5B1LD 3MGSC 2F8NH 4NE3A 4AWLB 3KWQB 4LD9C 2YFVA 5F99D 5DNMD 3AV2C 2IO5C 3X1VB 1P3KC 1ID3B 1P3AD 3KUYB 5DNND 3MGRD 1KX5D 5GXQD 1P3BC 2NQBC 4R8PD 4YM6A 5GSUA 5AV5B 4YS3D 1P3FC 3AZIC 1EQZD 2PYOB 5BT1C 2CV5B 1N1JA 4XZQB 2FJ7B 1P3OD 3AZND 4J8UD 1KX3D 3AN2B 5BNXB 3KWQA 5B2ID 4HGAC 3X1VA 3AV2B 1ID3A 2IO5B 1P3KB 4XUJB 2F8ND 3KUYA 5B33D 5AV6D 3W98D 3AYWC 3AZKD 2AROB 1KX4C 1P3LD 5BO0B 4J8WC 1U35A 3AV1C 1P3FB 3AZIB 2CV5A 4XZQA 2FJ7A 4CAYB 4EO5C 3B6GC 1P3PB 3AN2A 3X1TC 2BYMB 5BNXA 4WU8D 5B24B 5AVBD 1P3MC 4KUDD 4Z5TB 5B2JC 4QLCC 3AV2A 4HGAB 1P3KA 4XUJA 3WA9C 3AZJD 4KGCC 4NE5A 3AYWB 2NZDC 5B0YD 1F66C 3X1SB 5BO0A 5JRGB 4J8WB 3AZED 1P3FA 3AZIA 3AV1B 5AY8D 5DNMB 4CAYA 5C3IB 5B32C 4EO5B 4J8VC 2BYMA 3B0BA 3B6GB 5B24A 3LZ1D 4Z5TA 1P3MB 3AZGD 3WAAC 3KXBD 4YS3B 3WA9B 4KGCB 3MGQC 5CHLB 3AYWA 5AV9D 3X1SA 3MVDB 2NZDB 5JRGA 4J8WA 3LELB 4Z2MH 1P3ID 3AV1A 3X1UC 5DNMA 3W99B 3AZMD 3UTAD 3WTPC 3TU4C 1P3GB 3WKJD 5B33B 3B6GA 3X1TA 2HUEC 1P3MA 3B6FD 5BS7C 3WA9A 4KGCA 4ZBJB 3W97C 4YM6C 4H9RB 3MNNC 3MVDA 4WU9C 2NZDA 3C1BD 3LELA 3UT9B 3B0DC 5E5AD 5B0ZD 5AVCC 1M18D 3W99A 3X1UB 2HIOD 5B31C 1P3GA 5CPJC 3KWQC 3WTPB 3AZHC 4Z66D 1P34D 1M1AB 3REID 4ZUXD 3O62C 3MGSD 3KUYC 1TZYD 5CPIB 1S32B 4LD9D 4H9RA 5AV5C 5GT3B 5CP6D 3MNNB 1M19D 4WU9B 2PYOC 3UT9A 4G92C 3W96B 3B0DB 4X23B 1P3BD 3X1UA 5AVCB 3AN2C 2YFWB 5B31B 3WTPA 3LZ0B 3TU4A 5CPJB 5B40D 3AZHB 1M1AA 4XUJC 5GT0D 3O62B 5BS7A 3A6NC 5CPIA 1Q9CA 5G49B 2AROC 1S32A 3VH6T 3W97A 5GT3A 3MNNA 4WU9A 3RELC 3REHB 4KHAB 5AV8D 5B31G 4NFTA 3W96A 4G92B 4X23A 3B6FB 1KX4D 1P3PC 5AVCA 3MGPD 5B24C 2YFWA 5B31A 3LZ0A 4Z5TC 5CPJA 3AZHA 2LY8A 4NE6A 3O62A 2F8NK 5CPKD 3A6NB 5G49A 5B1MD 3AZLB 3X1SC 5B0ZB 5B2JD 4QLCD 5JRGC 2HIOB 5AV5A 1AOID 4H9SA 3REHA 3UTBB 1KU5A 4KHAA 2PYOA 5F99C 3RELB 5DNMC 5C3IC 3AZFB 1HQ3B 1F66D 3MGRC 1ZLAB 5GXQC 4R8PC 4YS3C 4WV4B 5B32D 1EQZC 1WWIA 4J8VD 3R45B 3A6NA 3REKD 3AZLA 3LJAD 5B1LB 3MVDC 2AROA 3VH6A 1P3OC 3WAAD 1KX3C 1BH8B 2HIOA 4WNNB 3LELC 3C1CD 5JA4B 3AFAD 3UTBA 3RELA 3W99C 5B2IC 5F99B 3MGQD 4J8XD 3AZFA 1HQ3A 1P3GC 5B33C 1P3PA 1P3AB 1ZLAA 5DNNB 1R4VA 2L5AA 3MGRB 1KX5B 3W98C 3REJD 5GXQB 3KSYA 4R8PB 1JFIB 3VH5W 3R45A 1EQZB 4ZBJC 5B1LA 1BH9B 3MGPB 1P3OB 4WNNA 3AZNB 4J8UB 3UT9C 1KX3B 5JA4A 4WZSB 5F99A 1WWSA 5B2IB 4YM6D 5GSUD 2RVQD 1P3AA 2F8NB 5DNNA 3MGRA 5BNVB 5AV6B 1KX5A 3W98B 5GXQA 1M1AC 3B0CW 4G91B 4R8PA 3AZKB 1P3LB 1JFIA 5CPIC 4JJND 3AZEC 4YS3A 1EQZA 3KWQD 1S32C 5AY8C 5GT3C 3X1VD 1ID3D 1BH9A 1P3OA 3KUYD 3AZNA 4J8UA 1KX3A 4WU8B 2F8NG 3W96C 3LZ1C 4H9PB 4KUDB 5AVBB 4X23C 3KXBC 5B2IA 2F8NA 3LZ0C 1U35D 2CWEA 5B33A 5BNVA 5AV6A 3AZJB 1BFMA 3W98A 2CV5D 4H9QB 4XZQD 2FJ7D 5AV9C 3AZKA 5B0YB 1P3LA 3AN2D 3AZEB 1P3IC 3AZMC 5AY8B 3AV2D 4H9SC 1P3KD 4XUJD 3REHC
chains in the Genus database with same CATH superfamily
4WU8A 4H9PA 4KUDA 5AVBA 3B6FC 3LZ1B 3WTPE 3A1IA 2NQBD 3AZGB 3EPLA 3KXBB 3AZJA 1P3FD 3AZID 3V9RB 5BT1D 4H9QA 5B0YA 5AV9B 2XD5A 4M6BA 5KDMB 2Y2OA 3C1BC 1HTAA 4E45A 3AZEA 5B24D 3AZLC 1P3IB 4Z5TD 5B0ZC 4H9OB 2VQRA 5AY8A 2HIOC 3AZMB 3EG5B 5FUGB 3UTAB 3UTBC 3WKJB 3REIC 3LZ1A 4ZUXC 3AZFC 3AYWD 1HQ3C 3AZGA 3X1SD 3KXBA 1TZYC 1ZLAC 5JRGD 4J8WD 4JJNB 3V9RA 3AV1D 5CP6C 1M19C 1B6WA 5AV9A 5KDMA 1TAFB 3B6GD 3C1BB 3X1TD 5B1LC 1P3IA 5E5AB 1P3MD 4H9OA 1M18B 3AZMA 3UTAA 5FUGA 1U35B 4E44A 3WKJA 3WA9D 3KFUG 4KGCD 5B40C 4Z66B 1P34B 3REIB 3B6FA 4ZUXB 5GT0C 3MVDD 3MGSB 1P3AC 5DNNC 2NZDD 1KX5C 1TZYB 1H3OB 3LELD 4JJNA 1PZRA 4LD9B 3W99D 1A7WA 2BYKB 5CP6B 1M19B 1P3GD 1TAFA 5AV8C 3C1BA 5E5AA 4DRBA 1P3BB 4Z2MG 5B0ZA 3MGPC 3AZNC 4J8UC 1M18A 2NQBB 4Z66A 1B67A 4DRAA 5B40B 1P34A 3REIA 4ZUXA 3MGSA 4CSRB 5AV6C 5GT0B 1H3OA 1TZYA 5CPKC 3UT9D 5B1MC 4G91C 3AZKC 4LD9A 1P3LC 3X1UD 1AOIC 2BYKA 2JSSA 5CP6A 1M19A 4UUZB 3H0RC 3WTPD 3TU4D 5AV8B 1M1AD 1ULYA 1P3BA 2NQBA 1KX4B 1BH8A 4WU8C 5CPID 4KUDC 5AVBC 1F1EA 1S32D 5B40A 5GT3D 3MNND 3W97D 4CSRA 3AZJC 5GT0A 4WU9D 3REKC 3X1TB 5CPKB 3LJAC 5B1MB 3W96D 4X23D 5B0YC 5B2JB 1T3UA 5AVCD 4QLCB 3C1CC 1AOIB 3NQJB 3AFAC 5B31D 4UUZA 3VH5T 3LZ0D 5CPJD 5AV8A 4J8XC 3AZHD 3NQUB 1KX4A 3O62D 3MGPA 1F66B 1Z2CB 4H9NB 3REJC 3AZGC 5AV5D 5B32B 3REHD 4J8VB 2PYOD 5CPKA 3REKB 5B1MA 3LJAB 3B0CT 5B2JA 3WAAB 4QLCA 1AOIA 3NQJA 2Y2QA 2Y2JA 3C1CB 3AFAB 3NQUA 4J8XB 3MGQB 5GSUC 3UTAC 2G5IC 2RVQC 3WKJC 1F66A 3H0LC 2Y2IA 4H9NA 3A6ND 5B32G 3REJB 2J8PA 3AZLD 2AROD 4JJNC 4AWLC 5B32A 2Y2GA 4J8VA 3UTBD 3TU4B 3RELD 2YFVB 2BG1A 3X1VC 3REKA 1ID3C 3LJAA 2HUEB 3AZFD 1HQ3D 3WAAA 4WJ3C 1P3PD 1ZLAD 3C1CA 3VH5A 3AFAA 5E5AC 3VH6W 1M18C 4J8XA 3MGQA 2W8SA 3W97B 4YM6B 5GSUB 1U35C 4Z66C 2CV5C 4XZQC 3REJA 1P34C 2FJ7C 1N1JB 5B1LD 3MGSC 2F8NH 4NE3A 4AWLB 3IP4C 3KWQB 4LD9C 2YFVA 5F99D 5DNMD 3AV2C 2IO5C 3X1VB 1P3KC 1ID3B 1P3AD 3KUYB 5DNND 3MGRD 1KX5D 5GXQD 1P3BC 2NQBC 2FFFB 4R8PD 4YM6A 5GSUA 5AV5B 4YS3D 1P3FC 3AZIC 1EQZD 2PYOB 5BT1C 2CV5B 1N1JA 4XZQB 2FJ7B 1P3OD 3AZND 4J8UD 1KX3D 3AN2B 5BNXB 3KWQA 2Y2NA 5B2ID 4HGAC 3X1VA 3AV2B 1ID3A 2IO5B 1P3KB 4XUJB 2F8ND 3KUYA 5B33D 5AV6D 3W98D 3AYWC 3AZKD 2AROB 4DQYB 1KX4C 1P3LD 5BO0B 4J8WC 1U35A 3AV1C 1P3FB 3AZIB 2CV5A 4XZQA 2FJ7A 4CAYB 4EO5C 3B6GC 2ZY5A 1P3PB 3AN2A 3X1TC 2BYMB 5BNXA 4WU8D 2JCHA 5B24B 5AVBD 1P3MC 4KUDD 4Z5TB 5B2JC 3EPHA 4QLCC 3AV2A 4HGAB 1P3KA 4XUJA 3WA9C 3AZJD 4KGCC 2Y2KA 2Y2MA 4NE5A 3AYWB 2NZDC 5B0YD 1F66C 3X1SB 5BO0A 5JRGB 4J8WB 3AZED 1P3FA 3AZIA 3AV1B 5AY8D 5DNMB 4CAYA 5C3IB 5B32C 4EO5B 4J8VC 2BYMA 3B0BA 3B6GB 5B24A 3LZ1D 4Z5TA 1P3MB 3AZGD 3WAAC 3KXBD 4YS3B 3WA9B 4KGCB 3MGQC 5CHLB 3AYWA 5AV9D 3X1SA 3MVDB 2NZDB 5JRGA 4J8WA 3LELB 4Z2MH 1P3ID 3AV1A 3X1UC 5DNMA 3W99B 3AZMD 2Y2LA 3UTAD 2DF4C 2ZY2A 3WTPC 3TU4C 1P3GB 3WKJD 5B33B 3B6GA 3X1TA 2HUEC 1P3MA 3B6FD 5BS7C 3WA9A 4KGCA 4ZBJB 3W97C 4YM6C 4H9RB 3MNNC 3MVDA 4WU9C 2NZDA 3C1BD 3LELA 3UT9B 2JE5A 3B0DC 5E5AD 5B0ZD 5AVCC 1M18D 3W99A 3X1UB 2HIOD 5B31C 1P3GA 5CPJC 3KWQC 3WTPB 3AZHC 4Z66D 2F2AC 1P34D 1M1AB 3REID 4ZUXD 3O62C 3MGSD 3KUYC 1TZYD 5CPIB 2G5HC 1S32B 4LD9D 4H9RA 5AV5C 5GT3B 5CP6D 3MNNB 1M19D 2Y2HA 4WU9B 2PYOC 2DQNC 3UT9A 4G92C 3W96B 3B0DB 4X23B 1P3BD 3X1UA 5AVCB 3AN2C 3FDDA 2YFWB 5B31B 3WTPA 3LZ0B 3TU4A 5CPJB 5B40D 3AZHB 1M1AA 3F6TA 4XUJC 3P5JB 5GT0D 3O62B 5BS7A 3A6NC 5CPIA 1Q9CA 5G49B 2AROC 1S32A 3VH6T 3W97A 5GT3A 3MNNA 4WU9A 3RELC 3REHB 5AV8D 4KHAB 5B31G 4NFTA 3W96A 4G92B 4X23A 3B6FB 1KX4D 1P3PC 5AVCA 3MGPD 5B24C 2YFWA 5B31A 3LZ0A 4Z5TC 5CPJA 3AZHA 2LY8A 4NE6A 3O62A 3H0MC 2F8NK 5CPKD 3A6NB 5G49A 5B1MD 3AZLB 3X1SC 5B0ZB 5B2JD 4QLCD 5JRGC 2HIOB 5AV5A 1AOID 4H9SA 3REHA 3UTBB 1KU5A 4KHAA 2PYOA 5F99C 3RELB 5DNMC 5C3IC 3AZFB 1HQ3B 1F66D 3MGRC 1ZLAB 5GXQC 4R8PC 1W2EA 4YS3C 4WV4B 5B32D 1EQZC 1WWIA 4J8VD 3R45B 3A6NA 3REKD 3AZLA 3LJAD 5B1LB 3MVDC 2AROA 3VH6A 1P3OC 3WAAD 1KX3C 1BH8B 2HIOA 4WNNB 3LELC 3EPKA 3C1CD 5JA4B 3AFAD 3UTBA 3AL0C 3RELA 3W99C 5B2IC 5F99B 3MGQD 4J8XD 3AZFA 1HQ3A 1P3GC 5B33C 1P3PA 1P3AB 1ZLAA 5DNNB 1R4VA 2L5AA 3MGRB 1KX5B 3W98C 3REJD 2RIQA 5GXQB 2ZY4A 3KSYA 4R8PB 1JFIB 3A1KA 3VH5W 3R45A 2UWXA 1EQZB 4ZBJC 5B1LA 1BH9B 3MGPB 1P3OB 4WNNA 3AZNB 4J8UB 3UT9C 1KX3B 5JA4A 4WZSB 5F99A 1WWSA 5B2IB 2ZM5A 4YM6D 5GSUD 4UPKA 2RVQD 1P3AA 2F8NB 5DNNA 3MGRA 5BNVB 5AV6B 1KX5A 3W98B 5GXQA 1M1AC 3B0CW 4G91B 4R8PA 3AZKB 1P3LB 1JFIA 5CPIC 4JJND 3AZEC 4YS3A 1EQZA 3KWQD 1S32C 5AY8C 5GT3C 3X1VD 1ID3D 1BH9A 1P3OA 3KUYD 3AZNA 4J8UA 1KX3A 4WU8B 2F8NG 3W96C 3LZ1C 4H9PB 4KUDB 5AVBB 4X23C 3KXBC 5B2IA 2XD1A 2F8NA 3LZ0C 1U35D 2CWEA 5B33A 5BNVA 5AV6A 3AZJB 1BFMA 3W98A 2CV5D 4H9QB 4XZQD 2FJ7D 2ZY3A 5AV9C 3AZKA 5B0YB 3EPJA 1P3LA 2Y2PA 3AN2D 3AZEB 1P3IC 3AZMC 5AY8B 3AV2D 4H9SC 1P3KD 4XUJD 3REHC
chains in the Genus database with same CATH topology
4WU8A 4H9PA 4KUDA 5AVBA 3B6FC 3LZ1B 3WTPE 3A1IA 2NQBD 3AZGB 3EPLA 3KXBB 3AZJA 1P3FD 3AZID 3V9RB 5BT1D 4H9QA 5B0YA 5AV9B 2XD5A 4M6BA 5KDMB 2Y2OA 3C1BC 1HTAA 4E45A 3AZEA 5B24D 3AZLC 1P3IB 4Z5TD 5B0ZC 4H9OB 2VQRA 5AY8A 2HIOC 3AZMB 3EG5B 5FUGB 3UTAB 3UTBC 3WKJB 3REIC 3LZ1A 4ZUXC 3AZFC 3AYWD 1HQ3C 3AZGA 3X1SD 3KXBA 1TZYC 1ZLAC 5JRGD 4J8WD 4JJNB 3V9RA 3AV1D 5CP6C 1M19C 1B6WA 5AV9A 5KDMA 1TAFB 3B6GD 3C1BB 3X1TD 5B1LC 1P3IA 5E5AB 1P3MD 4H9OA 1M18B 3AZMA 3UTAA 5FUGA 1U35B 4E44A 3WKJA 3WA9D 3KFUG 4KGCD 5B40C 4Z66B 1P34B 3REIB 3B6FA 4ZUXB 5GT0C 3MVDD 3MGSB 1P3AC 5DNNC 2NZDD 1KX5C 1TZYB 1H3OB 3LELD 4JJNA 1PZRA 4LD9B 3W99D 1A7WA 2BYKB 5CP6B 1M19B 1P3GD 1TAFA 5AV8C 3C1BA 5E5AA 4DRBA 1P3BB 4Z2MG 5B0ZA 3MGPC 3AZNC 4J8UC 1M18A 2NQBB 4Z66A 1B67A 4DRAA 5B40B 1P34A 3REIA 4ZUXA 3MGSA 4CSRB 5AV6C 5GT0B 1H3OA 1TZYA 5CPKC 3UT9D 5B1MC 4G91C 3AZKC 4LD9A 1P3LC 3X1UD 1AOIC 2BYKA 2JSSA 5CP6A 1M19A 4UUZB 3H0RC 3WTPD 3TU4D 5AV8B 1M1AD 1ULYA 1P3BA 2NQBA 1KX4B 1BH8A 4WU8C 5CPID 4KUDC 5AVBC 1F1EA 1S32D 5B40A 5GT3D 3MNND 3W97D 4CSRA 3AZJC 5GT0A 4WU9D 3REKC 3X1TB 5CPKB 3LJAC 5B1MB 3W96D 4X23D 5B0YC 5B2JB 1T3UA 5AVCD 4QLCB 3C1CC 1AOIB 3NQJB 3AFAC 5B31D 4UUZA 3VH5T 3LZ0D 5CPJD 5AV8A 4J8XC 3AZHD 3NQUB 1KX4A 3O62D 3MGPA 1F66B 1Z2CB 4H9NB 3REJC 3AZGC 5AV5D 5B32B 3REHD 4J8VB 2PYOD 5CPKA 3REKB 5B1MA 3LJAB 3B0CT 5B2JA 3WAAB 4QLCA 1AOIA 3NQJA 2Y2QA 2Y2JA 3C1CB 3AFAB 3NQUA 4J8XB 3MGQB 5GSUC 3UTAC 2G5IC 2RVQC 3WKJC 1F66A 3H0LC 2Y2IA 4H9NA 3A6ND 5B32G 3REJB 2J8PA 3AZLD 2AROD 4JJNC 4AWLC 5B32A 2Y2GA 4J8VA 3UTBD 3TU4B 3RELD 2YFVB 2BG1A 3X1VC 3REKA 1ID3C 3LJAA 2HUEB 3AZFD 1HQ3D 3WAAA 4WJ3C 1P3PD 1ZLAD 3C1CA 3VH5A 3AFAA 5E5AC 3VH6W 1M18C 4J8XA 3MGQA 2W8SA 3W97B 4YM6B 5GSUB 1U35C 4Z66C 2CV5C 4XZQC 3REJA 1P34C 2FJ7C 1N1JB 5B1LD 3MGSC 2F8NH 4NE3A 4AWLB 3IP4C 3KWQB 4LD9C 2YFVA 5F99D 5DNMD 3AV2C 2IO5C 3X1VB 1P3KC 1ID3B 1P3AD 3KUYB 5DNND 3MGRD 1KX5D 5GXQD 1P3BC 2NQBC 2FFFB 4R8PD 4YM6A 5GSUA 5AV5B 4YS3D 1P3FC 3AZIC 1EQZD 2PYOB 5BT1C 2CV5B 1N1JA 4XZQB 2FJ7B 1P3OD 3AZND 4J8UD 1KX3D 3AN2B 5BNXB 3KWQA 2Y2NA 5B2ID 4HGAC 3X1VA 3AV2B 1ID3A 2IO5B 1P3KB 4XUJB 2F8ND 3KUYA 5B33D 5AV6D 3W98D 3AYWC 3AZKD 2AROB 4DQYB 1KX4C 1P3LD 5BO0B 4J8WC 1U35A 3AV1C 1P3FB 3AZIB 2CV5A 4XZQA 2FJ7A 4CAYB 4EO5C 3B6GC 2ZY5A 1P3PB 3AN2A 3X1TC 2BYMB 5BNXA 4WU8D 2JCHA 5B24B 5AVBD 1P3MC 4KUDD 4Z5TB 5B2JC 3EPHA 4QLCC 3AV2A 4HGAB 1P3KA 4XUJA 3WA9C 3AZJD 4KGCC 2Y2KA 2Y2MA 4NE5A 3AYWB 2NZDC 5B0YD 1F66C 3X1SB 5BO0A 5JRGB 4J8WB 3AZED 1P3FA 3AZIA 3AV1B 5AY8D 5DNMB 4CAYA 5C3IB 5B32C 4EO5B 4J8VC 2BYMA 3B0BA 3B6GB 5B24A 3LZ1D 4Z5TA 1P3MB 3AZGD 3WAAC 3KXBD 4YS3B 3WA9B 4KGCB 3MGQC 5CHLB 3AYWA 5AV9D 3X1SA 3MVDB 2NZDB 5JRGA 4J8WA 3LELB 4Z2MH 1P3ID 3AV1A 3X1UC 5DNMA 3W99B 3AZMD 2Y2LA 3UTAD 2DF4C 2ZY2A 3WTPC 3TU4C 1P3GB 3WKJD 5B33B 3B6GA 3X1TA 2HUEC 1P3MA 3B6FD 5BS7C 3WA9A 4KGCA 4ZBJB 3W97C 4YM6C 4H9RB 3MNNC 3MVDA 4WU9C 2NZDA 3C1BD 3LELA 3UT9B 2JE5A 3B0DC 5E5AD 5B0ZD 5AVCC 1M18D 3W99A 3X1UB 2HIOD 5B31C 1P3GA 5CPJC 3KWQC 3WTPB 3AZHC 4Z66D 2F2AC 1P34D 1M1AB 3REID 4ZUXD 3O62C 3MGSD 3KUYC 1TZYD 5CPIB 2G5HC 1S32B 4LD9D 4H9RA 5AV5C 5GT3B 5CP6D 3MNNB 1M19D 2Y2HA 4WU9B 2PYOC 2DQNC 3UT9A 4G92C 3W96B 3B0DB 4X23B 1P3BD 3X1UA 5AVCB 3AN2C 3FDDA 2YFWB 5B31B 3WTPA 3LZ0B 3TU4A 5CPJB 5B40D 3AZHB 1M1AA 3F6TA 4XUJC 3P5JB 5GT0D 3O62B 5BS7A 3A6NC 5CPIA 1Q9CA 5G49B 2AROC 1S32A 3VH6T 3W97A 5GT3A 3MNNA 4WU9A 3RELC 3REHB 5AV8D 4KHAB 5B31G 4NFTA 3W96A 4G92B 4X23A 3B6FB 1KX4D 1P3PC 5AVCA 3MGPD 5B24C 2YFWA 5B31A 3LZ0A 4Z5TC 5CPJA 3AZHA 2LY8A 4NE6A 3O62A 3H0MC 2F8NK 5CPKD 3A6NB 5G49A 5B1MD 3AZLB 3X1SC 5B0ZB 5B2JD 4QLCD 5JRGC 2HIOB 5AV5A 1AOID 4H9SA 3REHA 3UTBB 1KU5A 4KHAA 2PYOA 5F99C 3RELB 5DNMC 5C3IC 3AZFB 1HQ3B 1F66D 3MGRC 1ZLAB 5GXQC 4R8PC 1W2EA 4YS3C 4WV4B 5B32D 1EQZC 1WWIA 4J8VD 3R45B 3A6NA 3REKD 3AZLA 3LJAD 5B1LB 3MVDC 2AROA 3VH6A 1P3OC 3WAAD 1KX3C 1BH8B 2HIOA 4WNNB 3LELC 3EPKA 3C1CD 5JA4B 3AFAD 3UTBA 3AL0C 3RELA 3W99C 5B2IC 5F99B 3MGQD 4J8XD 3AZFA 1HQ3A 1P3GC 5B33C 1P3PA 1P3AB 1ZLAA 5DNNB 1R4VA 2L5AA 3MGRB 1KX5B 3W98C 3REJD 2RIQA 5GXQB 2ZY4A 3KSYA 4R8PB 1JFIB 3A1KA 3VH5W 3R45A 2UWXA 1EQZB 4ZBJC 5B1LA 1BH9B 3MGPB 1P3OB 4WNNA 3AZNB 4J8UB 3UT9C 1KX3B 5JA4A 4WZSB 5F99A 1WWSA 5B2IB 2ZM5A 4YM6D 5GSUD 4UPKA 2RVQD 1P3AA 2F8NB 5DNNA 3MGRA 5BNVB 5AV6B 1KX5A 3W98B 5GXQA 1M1AC 3B0CW 4G91B 4R8PA 3AZKB 1P3LB 1JFIA 5CPIC 4JJND 3AZEC 4YS3A 1EQZA 3KWQD 1S32C 5AY8C 5GT3C 3X1VD 1ID3D 1BH9A 1P3OA 3KUYD 3AZNA 4J8UA 1KX3A 4WU8B 2F8NG 3W96C 3LZ1C 4H9PB 4KUDB 5AVBB 4X23C 3KXBC 5B2IA 2XD1A 2F8NA 3LZ0C 1U35D 2CWEA 5B33A 5BNVA 5AV6A 3AZJB 1BFMA 3W98A 2CV5D 4H9QB 4XZQD 2FJ7D 2ZY3A 5AV9C 3AZKA 5B0YB 3EPJA 1P3LA 2Y2PA 3AN2D 3AZEB 1P3IC 3AZMC 5AY8B 3AV2D 4H9SC 1P3KD 4XUJD 3REHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 A;  4H9P A;  4KUD A;  5AVB A;  3B6F C;  3LZ1 B;  3WTP E;  2NQB D;  3AZG B;  3KXB B;  3AZJ A;  1P3F D;  3AZI D;  3V9R B;  5BT1 D;  4H9Q A;  5B0Y A;  5AV9 B;  4M6B A;  5KDM B;  3C1B C;  1HTA A;  4E45 A;  3AZE A;  5B24 D;  3AZL C;  1P3I B;  4Z5T D;  5B0Z C;  4H9O B;  5AY8 A;  2HIO C;  3AZM B;  3UTA B;  5FUG B;  3UTB C;  3WKJ B;  3REI C;  3LZ1 A;  4ZUX C;  3AZF C;  3AYW D;  1HQ3 C;  3AZG A;  3X1S D;  3KXB A;  1TZY C;  1ZLA C;  5JRG D;  4J8W D;  4JJN B;  3V9R A;  3AV1 D;  5CP6 C;  1M19 C;  1B6W A;  5AV9 A;  5KDM A;  1TAF B;  3B6G D;  3C1B B;  3X1T D;  5B1L C;  1P3I A;  5E5A B;  1P3M D;  4H9O A;  1M18 B;  3AZM A;  3UTA A;  5FUG A;  1U35 B;  4E44 A;  3WKJ A;  3WA9 D;  4KGC D;  5B40 C;  4Z66 B;  1P34 B;  3REI B;  3B6F A;  4ZUX B;  5GT0 C;  3MVD D;  3MGS B;  1P3A C;  5DNN C;  2NZD D;  1KX5 C;  1TZY B;  1H3O B;  3LEL D;  4JJN A;  4LD9 B;  3W99 D;  1A7W A;  2BYK B;  5CP6 B;  1M19 B;  1P3G D;  1TAF A;  5AV8 C;  3C1B A;  5E5A A;  4DRB A;  1P3B B;  4Z2M G;  5B0Z A;  3MGP C;  3AZN C;  4J8U C;  1M18 A;  2NQB B;  4Z66 A;  1B67 A;  4DRA A;  5B40 B;  1P34 A;  3REI A;  4ZUX A;  3MGS A;  4CSR B;  5AV6 C;  5GT0 B;  1H3O A;  1TZY A;  5CPK C;  3UT9 D;  5B1M C;  4G91 C;  3AZK C;  4LD9 A;  1P3L C;  3X1U D;  1AOI C;  2BYK A;  2JSS A;  5CP6 A;  1M19 A;  4UUZ B;  3WTP D;  3TU4 D;  5AV8 B;  1M1A D;  1ULY A;  1P3B A;  2NQB A;  1KX4 B;  1BH8 A;  4WU8 C;  5CPI D;  4KUD C;  5AVB C;  1F1E A;  1S32 D;  5B40 A;  5GT3 D;  3MNN D;  3W97 D;  4CSR A;  3AZJ C;  5GT0 A;  4WU9 D;  3REK C;  3X1T B;  5CPK B;  3LJA C;  5B1M B;  3W96 D;  4X23 D;  5B0Y C;  5B2J B;  5AVC D;  4QLC B;  3C1C C;  1AOI B;  3NQJ B;  3AFA C;  5B31 D;  4UUZ A;  3VH5 T;  3LZ0 D;  5CPJ D;  5AV8 A;  4J8X C;  3AZH D;  3NQU B;  1KX4 A;  3O62 D;  3MGP A;  1F66 B;  4H9N B;  3REJ C;  3AZG C;  5AV5 D;  5B32 B;  3REH D;  4J8V B;  2PYO D;  5CPK A;  3REK B;  5B1M A;  3LJA B;  3B0C T;  5B2J A;  3WAA B;  4QLC A;  1AOI A;  3NQJ A;  3C1C B;  3AFA B;  3NQU A;  4J8X B;  3MGQ B;  5GSU C;  3UTA C;  2RVQ C;  3WKJ C;  1F66 A;  4H9N A;  3A6N D;  5B32 G;  3REJ B;  3AZL D;  2ARO D;  4JJN C;  4AWL C;  5B32 A;  3UTB D;  4J8V A;  3TU4 B;  3REL D;  2YFV B;  3X1V C;  3REK A;  1ID3 C;  3LJA A;  2HUE B;  3AZF D;  1HQ3 D;  3WAA A;  1P3P D;  1ZLA D;  3C1C A;  3VH5 A;  3AFA A;  5E5A C;  3VH6 W;  1M18 C;  4J8X A;  3MGQ A;  3W97 B;  4YM6 B;  5GSU B;  1U35 C;  4Z66 C;  2CV5 C;  4XZQ C;  3REJ A;  1P34 C;  2FJ7 C;  1N1J B;  5B1L D;  3MGS C;  2F8N H;  4NE3 A;  4AWL B;  3KWQ B;  4LD9 C;  2YFV A;  5F99 D;  5DNM D;  3AV2 C;  2IO5 C;  3X1V B;  1P3K C;  1ID3 B;  1P3A D;  3KUY B;  5DNN D;  3MGR D;  1KX5 D;  5GXQ D;  1P3B C;  2NQB C;  4R8P D;  4YM6 A;  5GSU A;  5AV5 B;  4YS3 D;  1P3F C;  3AZI C;  1EQZ D;  2PYO B;  5BT1 C;  2CV5 B;  1N1J A;  4XZQ B;  2FJ7 B;  1P3O D;  3AZN D;  4J8U D;  1KX3 D;  3AN2 B;  5BNX B;  3KWQ A;  5B2I D;  4HGA C;  3X1V A;  3AV2 B;  1ID3 A;  2IO5 B;  1P3K B;  4XUJ B;  2F8N D;  3KUY A;  5B33 D;  5AV6 D;  3W98 D;  3AYW C;  3AZK D;  2ARO B;  1KX4 C;  1P3L D;  5BO0 B;  4J8W C;  1U35 A;  3AV1 C;  1P3F B;  3AZI B;  2CV5 A;  4XZQ A;  2FJ7 A;  4CAY B;  4EO5 C;  3B6G C;  1P3P B;  3AN2 A;  3X1T C;  2BYM B;  5BNX A;  4WU8 D;  5B24 B;  5AVB D;  1P3M C;  4KUD D;  4Z5T B;  5B2J C;  4QLC C;  3AV2 A;  4HGA B;  1P3K A;  4XUJ A;  3WA9 C;  3AZJ D;  4KGC C;  4NE5 A;  3AYW B;  2NZD C;  5B0Y D;  1F66 C;  3X1S B;  5BO0 A;  5JRG B;  4J8W B;  3AZE D;  1P3F A;  3AZI A;  3AV1 B;  5AY8 D;  5DNM B;  4CAY A;  5C3I B;  5B32 C;  4EO5 B;  4J8V C;  2BYM A;  3B0B A;  3B6G B;  5B24 A;  3LZ1 D;  4Z5T A;  1P3M B;  3AZG D;  3WAA C;  3KXB D;  4YS3 B;  3WA9 B;  4KGC B;  3MGQ C;  5CHL B;  3AYW A;  5AV9 D;  3X1S A;  3MVD B;  2NZD B;  5JRG A;  4J8W A;  3LEL B;  4Z2M H;  1P3I D;  3AV1 A;  3X1U C;  5DNM A;  3W99 B;  3AZM D;  3UTA D;  3WTP C;  3TU4 C;  1P3G B;  3WKJ D;  5B33 B;  3B6G A;  3X1T A;  2HUE C;  1P3M A;  3B6F D;  5BS7 C;  3WA9 A;  4KGC A;  4ZBJ B;  3W97 C;  4YM6 C;  4H9R B;  3MNN C;  3MVD A;  4WU9 C;  2NZD A;  3C1B D;  3LEL A;  3UT9 B;  3B0D C;  5E5A D;  5B0Z D;  5AVC C;  1M18 D;  3W99 A;  3X1U B;  2HIO D;  5B31 C;  1P3G A;  5CPJ C;  3KWQ C;  3WTP B;  3AZH C;  4Z66 D;  1P34 D;  1M1A B;  3REI D;  4ZUX D;  3O62 C;  3MGS D;  3KUY C;  1TZY D;  5CPI B;  1S32 B;  4LD9 D;  4H9R A;  5AV5 C;  5GT3 B;  5CP6 D;  3MNN B;  1M19 D;  4WU9 B;  2PYO C;  3UT9 A;  4G92 C;  3W96 B;  3B0D B;  4X23 B;  1P3B D;  3X1U A;  5AVC B;  3AN2 C;  2YFW B;  5B31 B;  3WTP A;  3LZ0 B;  3TU4 A;  5CPJ B;  5B40 D;  3AZH B;  1M1A A;  4XUJ C;  5GT0 D;  3O62 B;  5BS7 A;  3A6N C;  5CPI A;  1Q9C A;  5G49 B;  2ARO C;  1S32 A;  3VH6 T;  3W97 A;  5GT3 A;  3MNN A;  4WU9 A;  3REL C;  3REH B;  4KHA B;  5AV8 D;  5B31 G;  4NFT A;  3W96 A;  4G92 B;  4X23 A;  3B6F B;  1KX4 D;  1P3P C;  5AVC A;  3MGP D;  5B24 C;  2YFW A;  5B31 A;  3LZ0 A;  4Z5T C;  5CPJ A;  3AZH A;  2LY8 A;  4NE6 A;  3O62 A;  2F8N K;  5CPK D;  3A6N B;  5G49 A;  5B1M D;  3AZL B;  3X1S C;  5B0Z B;  5B2J D;  4QLC D;  5JRG C;  2HIO B;  5AV5 A;  1AOI D;  4H9S A;  3REH A;  3UTB B;  1KU5 A;  4KHA A;  2PYO A;  5F99 C;  3REL B;  5DNM C;  5C3I C;  3AZF B;  1HQ3 B;  1F66 D;  3MGR C;  1ZLA B;  5GXQ C;  4R8P C;  4YS3 C;  4WV4 B;  5B32 D;  1EQZ C;  1WWI A;  4J8V D;  3R45 B;  3A6N A;  3REK D;  3AZL A;  3LJA D;  5B1L B;  3MVD C;  2ARO A;  3VH6 A;  1P3O C;  3WAA D;  1KX3 C;  1BH8 B;  2HIO A;  4WNN B;  3LEL C;  3C1C D;  5JA4 B;  3AFA D;  3UTB A;  3REL A;  3W99 C;  5B2I C;  5F99 B;  3MGQ D;  4J8X D;  3AZF A;  1HQ3 A;  1P3G C;  5B33 C;  1P3P A;  1P3A B;  1ZLA A;  5DNN B;  1R4V A;  2L5A A;  3MGR B;  1KX5 B;  3W98 C;  3REJ D;  5GXQ B;  3KSY A;  4R8P B;  1JFI B;  3VH5 W;  3R45 A;  1EQZ B;  4ZBJ C;  5B1L A;  1BH9 B;  3MGP B;  1P3O B;  4WNN A;  3AZN B;  4J8U B;  3UT9 C;  1KX3 B;  5JA4 A;  4WZS B;  5F99 A;  1WWS A;  5B2I B;  4YM6 D;  5GSU D;  2RVQ D;  1P3A A;  2F8N B;  5DNN A;  3MGR A;  5BNV B;  5AV6 B;  1KX5 A;  3W98 B;  5GXQ A;  1M1A C;  3B0C W;  4G91 B;  4R8P A;  3AZK B;  1P3L B;  1JFI A;  5CPI C;  4JJN D;  3AZE C;  4YS3 A;  1EQZ A;  3KWQ D;  1S32 C;  5AY8 C;  5GT3 C;  3X1V D;  1ID3 D;  1BH9 A;  1P3O A;  3KUY D;  3AZN A;  4J8U A;  1KX3 A;  4WU8 B;  2F8N G;  3W96 C;  3LZ1 C;  4H9P B;  4KUD B;  5AVB B;  4X23 C;  3KXB C;  5B2I A;  2F8N A;  3LZ0 C;  1U35 D;  2CWE A;  5B33 A;  5BNV A;  5AV6 A;  3AZJ B;  1BFM A;  3W98 A;  2CV5 D;  4H9Q B;  4XZQ D;  2FJ7 D;  5AV9 C;  3AZK A;  5B0Y B;  1P3L A;  3AN2 D;  3AZE B;  1P3I C;  3AZM C;  5AY8 B;  3AV2 D;  4H9S C;  1P3K D;  4XUJ D;  3REH C; 
#chains in the Genus database with same CATH topology
 4WU8 A;  4H9P A;  4KUD A;  5AVB A;  3B6F C;  3LZ1 B;  3WTP E;  3A1I A;  2NQB D;  3AZG B;  3EPL A;  3KXB B;  3AZJ A;  1P3F D;  3AZI D;  3V9R B;  5BT1 D;  4H9Q A;  5B0Y A;  5AV9 B;  2XD5 A;  4M6B A;  5KDM B;  2Y2O A;  3C1B C;  1HTA A;  4E45 A;  3AZE A;  5B24 D;  3AZL C;  1P3I B;  4Z5T D;  5B0Z C;  4H9O B;  2VQR A;  5AY8 A;  2HIO C;  3AZM B;  3EG5 B;  5FUG B;  3UTA B;  3UTB C;  3WKJ B;  3REI C;  3LZ1 A;  4ZUX C;  3AZF C;  3AYW D;  1HQ3 C;  3AZG A;  3X1S D;  3KXB A;  1TZY C;  1ZLA C;  5JRG D;  4J8W D;  4JJN B;  3V9R A;  3AV1 D;  5CP6 C;  1M19 C;  1B6W A;  5AV9 A;  5KDM A;  1TAF B;  3B6G D;  3C1B B;  3X1T D;  5B1L C;  1P3I A;  5E5A B;  1P3M D;  4H9O A;  1M18 B;  3AZM A;  3UTA A;  5FUG A;  1U35 B;  4E44 A;  3WKJ A;  3WA9 D;  3KFU G;  4KGC D;  5B40 C;  4Z66 B;  1P34 B;  3REI B;  3B6F A;  4ZUX B;  5GT0 C;  3MVD D;  3MGS B;  1P3A C;  5DNN C;  2NZD D;  1KX5 C;  1TZY B;  1H3O B;  3LEL D;  4JJN A;  1PZR A;  4LD9 B;  3W99 D;  1A7W A;  2BYK B;  5CP6 B;  1M19 B;  1P3G D;  1TAF A;  5AV8 C;  3C1B A;  5E5A A;  4DRB A;  1P3B B;  4Z2M G;  5B0Z A;  3MGP C;  3AZN C;  4J8U C;  1M18 A;  2NQB B;  4Z66 A;  1B67 A;  4DRA A;  5B40 B;  1P34 A;  3REI A;  4ZUX A;  3MGS A;  4CSR B;  5AV6 C;  5GT0 B;  1H3O A;  1TZY A;  5CPK C;  3UT9 D;  5B1M C;  4G91 C;  3AZK C;  4LD9 A;  1P3L C;  3X1U D;  1AOI C;  2BYK A;  2JSS A;  5CP6 A;  1M19 A;  4UUZ B;  3H0R C;  3WTP D;  3TU4 D;  5AV8 B;  1M1A D;  1ULY A;  1P3B A;  2NQB A;  1KX4 B;  1BH8 A;  4WU8 C;  5CPI D;  4KUD C;  5AVB C;  1F1E A;  1S32 D;  5B40 A;  5GT3 D;  3MNN D;  3W97 D;  4CSR A;  3AZJ C;  5GT0 A;  4WU9 D;  3REK C;  3X1T B;  5CPK B;  3LJA C;  5B1M B;  3W96 D;  4X23 D;  5B0Y C;  5B2J B;  1T3U A;  5AVC D;  4QLC B;  3C1C C;  1AOI B;  3NQJ B;  3AFA C;  5B31 D;  4UUZ A;  3VH5 T;  3LZ0 D;  5CPJ D;  5AV8 A;  4J8X C;  3AZH D;  3NQU B;  1KX4 A;  3O62 D;  3MGP A;  1F66 B;  1Z2C B;  4H9N B;  3REJ C;  3AZG C;  5AV5 D;  5B32 B;  3REH D;  4J8V B;  2PYO D;  5CPK A;  3REK B;  5B1M A;  3LJA B;  3B0C T;  5B2J A;  3WAA B;  4QLC A;  1AOI A;  3NQJ A;  2Y2Q A;  2Y2J A;  3C1C B;  3AFA B;  3NQU A;  4J8X B;  3MGQ B;  5GSU C;  3UTA C;  2G5I C;  2RVQ C;  3WKJ C;  1F66 A;  3H0L C;  2Y2I A;  4H9N A;  3A6N D;  5B32 G;  3REJ B;  2J8P A;  3AZL D;  2ARO D;  4JJN C;  4AWL C;  5B32 A;  2Y2G A;  4J8V A;  3UTB D;  3TU4 B;  3REL D;  2YFV B;  2BG1 A;  3X1V C;  3REK A;  1ID3 C;  3LJA A;  2HUE B;  3AZF D;  1HQ3 D;  3WAA A;  4WJ3 C;  1P3P D;  1ZLA D;  3C1C A;  3VH5 A;  3AFA A;  5E5A C;  3VH6 W;  1M18 C;  4J8X A;  3MGQ A;  2W8S A;  3W97 B;  4YM6 B;  5GSU B;  1U35 C;  4Z66 C;  2CV5 C;  4XZQ C;  3REJ A;  1P34 C;  2FJ7 C;  1N1J B;  5B1L D;  3MGS C;  2F8N H;  4NE3 A;  4AWL B;  3IP4 C;  3KWQ B;  4LD9 C;  2YFV A;  5F99 D;  5DNM D;  3AV2 C;  2IO5 C;  3X1V B;  1P3K C;  1ID3 B;  1P3A D;  3KUY B;  5DNN D;  3MGR D;  1KX5 D;  5GXQ D;  1P3B C;  2NQB C;  2FFF B;  4R8P D;  4YM6 A;  5GSU A;  5AV5 B;  4YS3 D;  1P3F C;  3AZI C;  1EQZ D;  2PYO B;  5BT1 C;  2CV5 B;  1N1J A;  4XZQ B;  2FJ7 B;  1P3O D;  3AZN D;  4J8U D;  1KX3 D;  3AN2 B;  5BNX B;  3KWQ A;  2Y2N A;  5B2I D;  4HGA C;  3X1V A;  3AV2 B;  1ID3 A;  2IO5 B;  1P3K B;  4XUJ B;  2F8N D;  3KUY A;  5B33 D;  5AV6 D;  3W98 D;  3AYW C;  3AZK D;  2ARO B;  4DQY B;  1KX4 C;  1P3L D;  5BO0 B;  4J8W C;  1U35 A;  3AV1 C;  1P3F B;  3AZI B;  2CV5 A;  4XZQ A;  2FJ7 A;  4CAY B;  4EO5 C;  3B6G C;  2ZY5 A;  1P3P B;  3AN2 A;  3X1T C;  2BYM B;  5BNX A;  4WU8 D;  2JCH A;  5B24 B;  5AVB D;  1P3M C;  4KUD D;  4Z5T B;  5B2J C;  3EPH A;  4QLC C;  3AV2 A;  4HGA B;  1P3K A;  4XUJ A;  3WA9 C;  3AZJ D;  4KGC C;  2Y2K A;  2Y2M A;  4NE5 A;  3AYW B;  2NZD C;  5B0Y D;  1F66 C;  3X1S B;  5BO0 A;  5JRG B;  4J8W B;  3AZE D;  1P3F A;  3AZI A;  3AV1 B;  5AY8 D;  5DNM B;  4CAY A;  5C3I B;  5B32 C;  4EO5 B;  4J8V C;  2BYM A;  3B0B A;  3B6G B;  5B24 A;  3LZ1 D;  4Z5T A;  1P3M B;  3AZG D;  3WAA C;  3KXB D;  4YS3 B;  3WA9 B;  4KGC B;  3MGQ C;  5CHL B;  3AYW A;  5AV9 D;  3X1S A;  3MVD B;  2NZD B;  5JRG A;  4J8W A;  3LEL B;  4Z2M H;  1P3I D;  3AV1 A;  3X1U C;  5DNM A;  3W99 B;  3AZM D;  2Y2L A;  3UTA D;  2DF4 C;  2ZY2 A;  3WTP C;  3TU4 C;  1P3G B;  3WKJ D;  5B33 B;  3B6G A;  3X1T A;  2HUE C;  1P3M A;  3B6F D;  5BS7 C;  3WA9 A;  4KGC A;  4ZBJ B;  3W97 C;  4YM6 C;  4H9R B;  3MNN C;  3MVD A;  4WU9 C;  2NZD A;  3C1B D;  3LEL A;  3UT9 B;  2JE5 A;  3B0D C;  5E5A D;  5B0Z D;  5AVC C;  1M18 D;  3W99 A;  3X1U B;  2HIO D;  5B31 C;  1P3G A;  5CPJ C;  3KWQ C;  3WTP B;  3AZH C;  4Z66 D;  2F2A C;  1P34 D;  1M1A B;  3REI D;  4ZUX D;  3O62 C;  3MGS D;  3KUY C;  1TZY D;  5CPI B;  2G5H C;  1S32 B;  4LD9 D;  4H9R A;  5AV5 C;  5GT3 B;  5CP6 D;  3MNN B;  1M19 D;  2Y2H A;  4WU9 B;  2PYO C;  2DQN C;  3UT9 A;  4G92 C;  3W96 B;  3B0D B;  4X23 B;  1P3B D;  3X1U A;  5AVC B;  3AN2 C;  3FDD A;  2YFW B;  5B31 B;  3WTP A;  3LZ0 B;  3TU4 A;  5CPJ B;  5B40 D;  3AZH B;  1M1A A;  3F6T A;  4XUJ C;  3P5J B;  5GT0 D;  3O62 B;  5BS7 A;  3A6N C;  5CPI A;  1Q9C A;  5G49 B;  2ARO C;  1S32 A;  3VH6 T;  3W97 A;  5GT3 A;  3MNN A;  4WU9 A;  3REL C;  3REH B;  5AV8 D;  4KHA B;  5B31 G;  4NFT A;  3W96 A;  4G92 B;  4X23 A;  3B6F B;  1KX4 D;  1P3P C;  5AVC A;  3MGP D;  5B24 C;  2YFW A;  5B31 A;  3LZ0 A;  4Z5T C;  5CPJ A;  3AZH A;  2LY8 A;  4NE6 A;  3O62 A;  3H0M C;  2F8N K;  5CPK D;  3A6N B;  5G49 A;  5B1M D;  3AZL B;  3X1S C;  5B0Z B;  5B2J D;  4QLC D;  5JRG C;  2HIO B;  5AV5 A;  1AOI D;  4H9S A;  3REH A;  3UTB B;  1KU5 A;  4KHA A;  2PYO A;  5F99 C;  3REL B;  5DNM C;  5C3I C;  3AZF B;  1HQ3 B;  1F66 D;  3MGR C;  1ZLA B;  5GXQ C;  4R8P C;  1W2E A;  4YS3 C;  4WV4 B;  5B32 D;  1EQZ C;  1WWI A;  4J8V D;  3R45 B;  3A6N A;  3REK D;  3AZL A;  3LJA D;  5B1L B;  3MVD C;  2ARO A;  3VH6 A;  1P3O C;  3WAA D;  1KX3 C;  1BH8 B;  2HIO A;  4WNN B;  3LEL C;  3EPK A;  3C1C D;  5JA4 B;  3AFA D;  3UTB A;  3AL0 C;  3REL A;  3W99 C;  5B2I C;  5F99 B;  3MGQ D;  4J8X D;  3AZF A;  1HQ3 A;  1P3G C;  5B33 C;  1P3P A;  1P3A B;  1ZLA A;  5DNN B;  1R4V A;  2L5A A;  3MGR B;  1KX5 B;  3W98 C;  3REJ D;  2RIQ A;  5GXQ B;  2ZY4 A;  3KSY A;  4R8P B;  1JFI B;  3A1K A;  3VH5 W;  3R45 A;  2UWX A;  1EQZ B;  4ZBJ C;  5B1L A;  1BH9 B;  3MGP B;  1P3O B;  4WNN A;  3AZN B;  4J8U B;  3UT9 C;  1KX3 B;  5JA4 A;  4WZS B;  5F99 A;  1WWS A;  5B2I B;  2ZM5 A;  4YM6 D;  5GSU D;  4UPK A;  2RVQ D;  1P3A A;  2F8N B;  5DNN A;  3MGR A;  5BNV B;  5AV6 B;  1KX5 A;  3W98 B;  5GXQ A;  1M1A C;  3B0C W;  4G91 B;  4R8P A;  3AZK B;  1P3L B;  1JFI A;  5CPI C;  4JJN D;  3AZE C;  4YS3 A;  1EQZ A;  3KWQ D;  1S32 C;  5AY8 C;  5GT3 C;  3X1V D;  1ID3 D;  1BH9 A;  1P3O A;  3KUY D;  3AZN A;  4J8U A;  1KX3 A;  4WU8 B;  2F8N G;  3W96 C;  3LZ1 C;  4H9P B;  4KUD B;  5AVB B;  4X23 C;  3KXB C;  5B2I A;  2XD1 A;  2F8N A;  3LZ0 C;  1U35 D;  2CWE A;  5B33 A;  5BNV A;  5AV6 A;  3AZJ B;  1BFM A;  3W98 A;  2CV5 D;  4H9Q B;  4XZQ D;  2FJ7 D;  2ZY3 A;  5AV9 C;  3AZK A;  5B0Y B;  3EPJ A;  1P3L A;  2Y2P A;  3AN2 D;  3AZE B;  1P3I C;  3AZM C;  5AY8 B;  3AV2 D;  4H9S C;  1P3K D;  4XUJ D;  3REH C; 
#chains in the Genus database with same CATH homology
 4WU8 A;  4H9P A;  4KUD A;  5AVB A;  3B6F C;  3LZ1 B;  3WTP E;  3A1I A;  2NQB D;  3AZG B;  3EPL A;  3KXB B;  3AZJ A;  1P3F D;  3AZI D;  3V9R B;  5BT1 D;  4H9Q A;  5B0Y A;  5AV9 B;  2XD5 A;  4M6B A;  5KDM B;  2Y2O A;  3C1B C;  1HTA A;  4E45 A;  3AZE A;  5B24 D;  3AZL C;  1P3I B;  4Z5T D;  5B0Z C;  4H9O B;  2VQR A;  5AY8 A;  2HIO C;  3AZM B;  3EG5 B;  5FUG B;  3UTA B;  3UTB C;  3WKJ B;  3REI C;  3LZ1 A;  4ZUX C;  3AZF C;  3AYW D;  1HQ3 C;  3AZG A;  3X1S D;  3KXB A;  1TZY C;  1ZLA C;  5JRG D;  4J8W D;  4JJN B;  3V9R A;  3AV1 D;  5CP6 C;  1M19 C;  1B6W A;  5AV9 A;  5KDM A;  1TAF B;  3B6G D;  3C1B B;  3X1T D;  5B1L C;  1P3I A;  5E5A B;  1P3M D;  4H9O A;  1M18 B;  3AZM A;  3UTA A;  5FUG A;  1U35 B;  4E44 A;  3WKJ A;  3WA9 D;  3KFU G;  4KGC D;  5B40 C;  4Z66 B;  1P34 B;  3REI B;  3B6F A;  4ZUX B;  5GT0 C;  3MVD D;  3MGS B;  1P3A C;  5DNN C;  2NZD D;  1KX5 C;  1TZY B;  1H3O B;  3LEL D;  4JJN A;  1PZR A;  4LD9 B;  3W99 D;  1A7W A;  2BYK B;  5CP6 B;  1M19 B;  1P3G D;  1TAF A;  5AV8 C;  3C1B A;  5E5A A;  4DRB A;  1P3B B;  4Z2M G;  5B0Z A;  3MGP C;  3AZN C;  4J8U C;  1M18 A;  2NQB B;  4Z66 A;  1B67 A;  4DRA A;  5B40 B;  1P34 A;  3REI A;  4ZUX A;  3MGS A;  4CSR B;  5AV6 C;  5GT0 B;  1H3O A;  1TZY A;  5CPK C;  3UT9 D;  5B1M C;  4G91 C;  3AZK C;  4LD9 A;  1P3L C;  3X1U D;  1AOI C;  2BYK A;  2JSS A;  5CP6 A;  1M19 A;  4UUZ B;  3H0R C;  3WTP D;  3TU4 D;  5AV8 B;  1M1A D;  1ULY A;  1P3B A;  2NQB A;  1KX4 B;  1BH8 A;  4WU8 C;  5CPI D;  4KUD C;  5AVB C;  1F1E A;  1S32 D;  5B40 A;  5GT3 D;  3MNN D;  3W97 D;  4CSR A;  3AZJ C;  5GT0 A;  4WU9 D;  3REK C;  3X1T B;  5CPK B;  3LJA C;  5B1M B;  3W96 D;  4X23 D;  5B0Y C;  5B2J B;  1T3U A;  5AVC D;  4QLC B;  3C1C C;  1AOI B;  3NQJ B;  3AFA C;  5B31 D;  4UUZ A;  3VH5 T;  3LZ0 D;  5CPJ D;  5AV8 A;  4J8X C;  3AZH D;  3NQU B;  1KX4 A;  3O62 D;  3MGP A;  1F66 B;  1Z2C B;  4H9N B;  3REJ C;  3AZG C;  5AV5 D;  5B32 B;  3REH D;  4J8V B;  2PYO D;  5CPK A;  3REK B;  5B1M A;  3LJA B;  3B0C T;  5B2J A;  3WAA B;  4QLC A;  1AOI A;  3NQJ A;  2Y2Q A;  2Y2J A;  3C1C B;  3AFA B;  3NQU A;  4J8X B;  3MGQ B;  5GSU C;  3UTA C;  2G5I C;  2RVQ C;  3WKJ C;  1F66 A;  3H0L C;  2Y2I A;  4H9N A;  3A6N D;  5B32 G;  3REJ B;  2J8P A;  3AZL D;  2ARO D;  4JJN C;  4AWL C;  5B32 A;  2Y2G A;  4J8V A;  3UTB D;  3TU4 B;  3REL D;  2YFV B;  2BG1 A;  3X1V C;  3REK A;  1ID3 C;  3LJA A;  2HUE B;  3AZF D;  1HQ3 D;  3WAA A;  4WJ3 C;  1P3P D;  1ZLA D;  3C1C A;  3VH5 A;  3AFA A;  5E5A C;  3VH6 W;  1M18 C;  4J8X A;  3MGQ A;  2W8S A;  3W97 B;  4YM6 B;  5GSU B;  1U35 C;  4Z66 C;  2CV5 C;  4XZQ C;  3REJ A;  1P34 C;  2FJ7 C;  1N1J B;  5B1L D;  3MGS C;  2F8N H;  4NE3 A;  4AWL B;  3IP4 C;  3KWQ B;  4LD9 C;  2YFV A;  5F99 D;  5DNM D;  3AV2 C;  2IO5 C;  3X1V B;  1P3K C;  1ID3 B;  1P3A D;  3KUY B;  5DNN D;  3MGR D;  1KX5 D;  5GXQ D;  1P3B C;  2NQB C;  2FFF B;  4R8P D;  4YM6 A;  5GSU A;  5AV5 B;  4YS3 D;  1P3F C;  3AZI C;  1EQZ D;  2PYO B;  5BT1 C;  2CV5 B;  1N1J A;  4XZQ B;  2FJ7 B;  1P3O D;  3AZN D;  4J8U D;  1KX3 D;  3AN2 B;  5BNX B;  3KWQ A;  2Y2N A;  5B2I D;  4HGA C;  3X1V A;  3AV2 B;  1ID3 A;  2IO5 B;  1P3K B;  4XUJ B;  2F8N D;  3KUY A;  5B33 D;  5AV6 D;  3W98 D;  3AYW C;  3AZK D;  2ARO B;  4DQY B;  1KX4 C;  1P3L D;  5BO0 B;  4J8W C;  1U35 A;  3AV1 C;  1P3F B;  3AZI B;  2CV5 A;  4XZQ A;  2FJ7 A;  4CAY B;  4EO5 C;  3B6G C;  2ZY5 A;  1P3P B;  3AN2 A;  3X1T C;  2BYM B;  5BNX A;  4WU8 D;  2JCH A;  5B24 B;  5AVB D;  1P3M C;  4KUD D;  4Z5T B;  5B2J C;  3EPH A;  4QLC C;  3AV2 A;  4HGA B;  1P3K A;  4XUJ A;  3WA9 C;  3AZJ D;  4KGC C;  2Y2K A;  2Y2M A;  4NE5 A;  3AYW B;  2NZD C;  5B0Y D;  1F66 C;  3X1S B;  5BO0 A;  5JRG B;  4J8W B;  3AZE D;  1P3F A;  3AZI A;  3AV1 B;  5AY8 D;  5DNM B;  4CAY A;  5C3I B;  5B32 C;  4EO5 B;  4J8V C;  2BYM A;  3B0B A;  3B6G B;  5B24 A;  3LZ1 D;  4Z5T A;  1P3M B;  3AZG D;  3WAA C;  3KXB D;  4YS3 B;  3WA9 B;  4KGC B;  3MGQ C;  5CHL B;  3AYW A;  5AV9 D;  3X1S A;  3MVD B;  2NZD B;  5JRG A;  4J8W A;  3LEL B;  4Z2M H;  1P3I D;  3AV1 A;  3X1U C;  5DNM A;  3W99 B;  3AZM D;  2Y2L A;  3UTA D;  2DF4 C;  2ZY2 A;  3WTP C;  3TU4 C;  1P3G B;  3WKJ D;  5B33 B;  3B6G A;  3X1T A;  2HUE C;  1P3M A;  3B6F D;  5BS7 C;  3WA9 A;  4KGC A;  4ZBJ B;  3W97 C;  4YM6 C;  4H9R B;  3MNN C;  3MVD A;  4WU9 C;  2NZD A;  3C1B D;  3LEL A;  3UT9 B;  2JE5 A;  3B0D C;  5E5A D;  5B0Z D;  5AVC C;  1M18 D;  3W99 A;  3X1U B;  2HIO D;  5B31 C;  1P3G A;  5CPJ C;  3KWQ C;  3WTP B;  3AZH C;  4Z66 D;  2F2A C;  1P34 D;  1M1A B;  3REI D;  4ZUX D;  3O62 C;  3MGS D;  3KUY C;  1TZY D;  5CPI B;  2G5H C;  1S32 B;  4LD9 D;  4H9R A;  5AV5 C;  5GT3 B;  5CP6 D;  3MNN B;  1M19 D;  2Y2H A;  4WU9 B;  2PYO C;  2DQN C;  3UT9 A;  4G92 C;  3W96 B;  3B0D B;  4X23 B;  1P3B D;  3X1U A;  5AVC B;  3AN2 C;  3FDD A;  2YFW B;  5B31 B;  3WTP A;  3LZ0 B;  3TU4 A;  5CPJ B;  5B40 D;  3AZH B;  1M1A A;  3F6T A;  4XUJ C;  3P5J B;  5GT0 D;  3O62 B;  5BS7 A;  3A6N C;  5CPI A;  1Q9C A;  5G49 B;  2ARO C;  1S32 A;  3VH6 T;  3W97 A;  5GT3 A;  3MNN A;  4WU9 A;  3REL C;  3REH B;  5AV8 D;  4KHA B;  5B31 G;  4NFT A;  3W96 A;  4G92 B;  4X23 A;  3B6F B;  1KX4 D;  1P3P C;  5AVC A;  3MGP D;  5B24 C;  2YFW A;  5B31 A;  3LZ0 A;  4Z5T C;  5CPJ A;  3AZH A;  2LY8 A;  4NE6 A;  3O62 A;  3H0M C;  2F8N K;  5CPK D;  3A6N B;  5G49 A;  5B1M D;  3AZL B;  3X1S C;  5B0Z B;  5B2J D;  4QLC D;  5JRG C;  2HIO B;  5AV5 A;  1AOI D;  4H9S A;  3REH A;  3UTB B;  1KU5 A;  4KHA A;  2PYO A;  5F99 C;  3REL B;  5DNM C;  5C3I C;  3AZF B;  1HQ3 B;  1F66 D;  3MGR C;  1ZLA B;  5GXQ C;  4R8P C;  1W2E A;  4YS3 C;  4WV4 B;  5B32 D;  1EQZ C;  1WWI A;  4J8V D;  3R45 B;  3A6N A;  3REK D;  3AZL A;  3LJA D;  5B1L B;  3MVD C;  2ARO A;  3VH6 A;  1P3O C;  3WAA D;  1KX3 C;  1BH8 B;  2HIO A;  4WNN B;  3LEL C;  3EPK A;  3C1C D;  5JA4 B;  3AFA D;  3UTB A;  3AL0 C;  3REL A;  3W99 C;  5B2I C;  5F99 B;  3MGQ D;  4J8X D;  3AZF A;  1HQ3 A;  1P3G C;  5B33 C;  1P3P A;  1P3A B;  1ZLA A;  5DNN B;  1R4V A;  2L5A A;  3MGR B;  1KX5 B;  3W98 C;  3REJ D;  2RIQ A;  5GXQ B;  2ZY4 A;  3KSY A;  4R8P B;  1JFI B;  3A1K A;  3VH5 W;  3R45 A;  2UWX A;  1EQZ B;  4ZBJ C;  5B1L A;  1BH9 B;  3MGP B;  1P3O B;  4WNN A;  3AZN B;  4J8U B;  3UT9 C;  1KX3 B;  5JA4 A;  4WZS B;  5F99 A;  1WWS A;  5B2I B;  2ZM5 A;  4YM6 D;  5GSU D;  4UPK A;  2RVQ D;  1P3A A;  2F8N B;  5DNN A;  3MGR A;  5BNV B;  5AV6 B;  1KX5 A;  3W98 B;  5GXQ A;  1M1A C;  3B0C W;  4G91 B;  4R8P A;  3AZK B;  1P3L B;  1JFI A;  5CPI C;  4JJN D;  3AZE C;  4YS3 A;  1EQZ A;  3KWQ D;  1S32 C;  5AY8 C;  5GT3 C;  3X1V D;  1ID3 D;  1BH9 A;  1P3O A;  3KUY D;  3AZN A;  4J8U A;  1KX3 A;  4WU8 B;  2F8N G;  3W96 C;  3LZ1 C;  4H9P B;  4KUD B;  5AVB B;  4X23 C;  3KXB C;  5B2I A;  2XD1 A;  2F8N A;  3LZ0 C;  1U35 D;  2CWE A;  5B33 A;  5BNV A;  5AV6 A;  3AZJ B;  1BFM A;  3W98 A;  2CV5 D;  4H9Q B;  4XZQ D;  2FJ7 D;  2ZY3 A;  5AV9 C;  3AZK A;  5B0Y B;  3EPJ A;  1P3L A;  2Y2P A;  3AN2 D;  3AZE B;  1P3I C;  3AZM C;  5AY8 B;  3AV2 D;  4H9S C;  1P3K D;  4XUJ D;  3REH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...