1M1AD

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aD00
4J8VB 4XZQB 1EQZC 3AZEA 1KX4A 3AZMC 3AZKB 3LJAB 4XZQD 3AZND 4J8WA 1U35C 5B2ID 3MGQA 4J8VD 4WU9A 4ZUXC 3AV2B 1P3AD 3VH5A 3VH6T 3LZ0C 4J8XA 3KWQD 3KXBA 2RVQC 4UUZB 5B2IB 1JFIB 3AV1A 1KX3C 5AV9A 4YS3B 5GT3B 2FJ7C 3R45B 5CPJD 4XUJB 3MGRB 5F99D 3REHD 3W98A 3AZNA 1HQ3B 5B0YD 3LELA 3AZJA 3AZHB 3X1SA 2CWEA 3LJAD 4WNNB 3REHA 1P3LA 1F66D 3W98D 5GXQD 3WKJC 1P3BB 1TZYD 3KUYA 1F1EA 3AV1D 3LZ0B 4G91C 3MNNC 1AOID 1HQ3C 4YM6D 1B6WA 3KWQA 5B0ZA 1WWSA 5GT3C 1AOIA 3AZKC 4YS3C 1ID3D 4Z5TB 3NQJA 4H9QA 1H3OB 5JRGD 3AN2A 4WU8D 2L5AA 5CPIC 4Z66C 3MGSC 5B32C 3X1UA 5B1LD 3W97C 1ZLAD 5AY8C 3B6FC 1F66A 4AWLB 4J8WD 3VH6A 4YM6C 3AZJD 5B24C 4Z66B 3A6NA 5CPIB 1S32A 3W96A 1P3MB 1P3LD 3REIB 1M19D 4LD9C 1M19A 3AZGD 4H9NA 5AVCC 4Z5TC 4H9PA 4H9RA 5AV6C 4KUDC 3W97D 5DNMB 3C1BB 5CPKB 1ZLAC 4G91B 4WU8A 4H9SC 1P3KD 4JJNC 3MGPA 1M1AD 3WTPB 3VH5W 2LY8A 3X1TC 4J8VA 1P3PC 5B33A 5AVCD 3AN2C 5E5AB 4XZQA 3AYWC 5B40A 4CSRA 3AZHC 1P3GC 3AZKA 5AV6D 3LJAA 4KUDD 1A7WA 3AZIC 2YFWA 3TU4C 2F8NG 3AFAB 1ULYA 3UTAB 1TZYA 3AZFB 3AV2A 3VH6W 5BNVB 4CAYA 1P3PA 5E5AD 4KGCC 4UUZA 5CP6D 5B31D 4JJNA 1ID3B 5B0YA 3LELD 3KUYC 3UT9C 2BYMB 5DNND 2NQBC 1ZLAA 5F99A 4QLCB 4E44A 2HIOC 5BNXB 4XUJA 3AZNB 2AROD 3C1CA 4WU9D 3MGQD 5G49B 3LELB 3AZMB 3W99A 3X1SB 2FJ7A 5AV8A 3KXBD 4XZQC 3AYWA 4J8XD 3MVDC 4J8VC 5BS7A 3AZFC 5B32A 4ZUXD 4R8PB 4J8UC 1BH9A 3AFAC 2HUEC 3TU4B 3AZEB 1R4VA 5B1MB 3X1UD 5DNNB 3MGQC 4WU9C 1KX5D 4Z2MG 1P3FB 1N1JB 4Z5TA 3WA9A 5F99C 5B40D 2HUEB 5AV5D 5B0YC 2NZDD 4YM6A 1F66C 3WKJA 4Z66A 5CPIA 1S32B 1P3MA 4ZBJC 5GSUC 4LD9B 3W98B 3AZNC 1P3MC 1P3GA 3MNND 4NE5A 1P34A 3AZHA 1KX3A 2CV5D 3WTPE 3C1BD 5BO0A 3C1BA 3MVDB 5GT3D 4WU8B 1P3OC 5KDMB 3B0DC 3LZ0A 4WU8C 2F8NK 3MGSD 5B1MD 5FUGB 1P3MD 3KWQB 1P3IC 3B6FD 3X1VB 5B31G 5AVBD 3AZJC 2IO5B 5B1LB 2NQBB 1M19C 3W98C 4LD9D 4NE3A 1H3OA 3AFAA 3W96C 3AN2B 3UTAA 5BS7C 3AZFA 3X1UB 3O62C 3REID 4KGCB 3KSYA 1F66B 4H9OA 4G92C 2AROB 5AY8A 1KX4D 3LZ1C 2F8NH 2BYMA 3LZ0D 4X23D 2PYOD 3X1SD 4H9PB 3REKD 3REKB 1KX5B 3O62D 5B2JB 5G49A 3REIC 1M18B 3AZMA 1BH8A 2FJ7D 1KX4C 3W99B 3B6GD 3B0CW 3AZID 3TU4D 3WTPA 4AWLC 5AV9D 3AZLB 4ZUXB 4R8PD 3AV2C 5B32B 5AV6B 5B24D 4R8PA 5B33B 4KUDB 1U35B 4X23C 5CPJB 3TU4A 4KGCD 1P3LC 2YFVB 3LJAC 3X1SC 4EO5B 5B1MA 5GSUA 2YFWB 5B33C 3LZ1A 1P3FA 2HIOD 1P3KB 3MGRD 3B6FB 3MGPC 3O62A 3W97B 3W99C 2BYKB 3UTBA 5C3IC 3X1TD 3REJD 5BT1D 3WA9C 3KXBC 3WKJB 2F8ND 3AZFD 3B0CT 5B33D 1P3IA 4LD9A 3NQUA 5AY8D 3C1CB 5DNMD 5CPKD 3MGRC 1P3GB 5B24A 2JSSA 3A6NC 2NZDA 4G92B 3RELB 3W99D 1EQZD 2FJ7B 3AYWB 5E5AC 1KX3B 1P3OA 3REJC 5BO0B 5BT1C 3MVDA 3MGSA 4Z5TD 1BH9B 5KDMA 1U35D 2NQBD 5AV5C 3C1CC 5FUGA 5DNMC 5CPKC 5DNNA 3B6GB 4XUJC 3X1VD 2F8NA 3X1VA 4JJND 5GT0B 3WAAA 3MNNA 3X1TA 1N1JA 4WV4B 3B0DB 5B1LA 3WA9B 3AZGB 5B31B 5CP6B 5GT0D 3UT9A 5GXQB 3AN2D 2CV5A 5JRGA 4X23B 5CPJC 3MVDD 3AZHD 1Q9CA 4YM6B 4KGCA 3V9RA 2AROA 5AY8B 3C1CD 5AVCA 5GXQC 1KX5C 1P3BD 1S32C 5JA4B 3AZMD 4EO5C 4KHAA 1P34B 3RELD 1EQZB 5GT0C 1P3ID 3WTPD 1KX5A 4J8UA 5AVBB 1HQ3D 4M6BA 5AV5B 1BH8B 1WWIA 5AV8C 4H9SA 4YS3D 3AZLA 1P34D 2PYOA 1P3BC 3REJB 1S32D 5JRGC 1KX3D 5B0ZC 5GSUD 2YFVA 3RELC 2HIOA 5B1LC 3LZ1D 3AZEC 2NQBA 4J8WB 3LZ1B 2PYOC 1P3KA 3B6FA 4J8XB 3WKJD 3KXBB 3W97A 3O62B 3X1UC 4H9OB 1JFIA 1TZYC 3UTBB 4Z2MH 5C3IB 3AZIA 1M1AB 2IO5C 5AV9B 3AZLD 4YS3A 1P3KC 3AZED 3VH5T 5GT3A 4NE6A 1P3AB 1AOIC 1P3AC 5B40C 3R45A 1P3IB 3MGRA 1KU5A 3KWQC 3REKA 2RVQD 5B32G 5B2JD 1M18D 1P3FD 5B2JA 1M18A 1ID3C 1TAFB 3RELA 1P3LB 1P3OB 1P3BA 4Z66D 5CPID 5B32D 4ZUXA 5AV6A 4KUDA 3AZLC 1U35A 5CPJA 3REHC 4J8WC 3MGPD 1KX4B 5B2JC 1M18C 3B6GA 1P3FC 4ZBJB 5GSUB 5B0ZB 2F8NB 3REKC 5GT0A 3UT9D 3WAAB 5DNNC 3MGQB 4WU9B 3X1TB 4DRBA 3AV1C 4H9QB 4NFTA 5B2IA 5GXQA 2CV5B 2BYKA 4X23A 3A6ND 4R8PC 3B0BA 5AVBC 3AV2D 1B67A 2AROC 3AV1B 3UTBD 4E45A 3AZKD 1BFMA 3W96D 5AVCB 3W96B 3AYWD 3REIA 3NQUB 1M19B 1HQ3A 4HGAC 3UTAD 5CHLB 4J8UD 1P3GD 3AFAD 5B24B 3AZJB 4KHAB 2NZDB 4H9RB 3REHB 4WNNA 4XUJD 3X1VC 4J8UB 5DNMA 5CPKA 3MGSB 5AV5A 3KUYB 3UTBC 1HTAA 5B31C 5CP6C 3AZGC 3WA9D 3LELC 2PYOB 3REJA 3UTAC 5E5AA 5B40B 4CSRB 3B6GC 2NZDC 2HIOB 1AOIB 3MNNB 5AV9C 4QLCC 4HGAB 1M1AC 3AZGA 3NQJB 5B31A 5CP6A 3UT9B 3WAAD 5JRGB 1TZYB 1P3PD 5BNVA 4CAYB 1P3PB 4J8XC 3V9RB 3WTPC 4JJNB 4DRAA 3A6NB 1ID3A 5B0YB 2CV5C 3AZIB 3C1BC 1M1AA 1ZLAB 5AV8D 5F99B 4WZSB 4QLCA 4H9NB 4QLCD 5JA4A 1P3OD 1P3AA 1P34C 5BNXA 1EQZA 3WAAC 5B0ZD 5AVBA 5B1MC 3KUYD 1TAFA 5B2IC 5AV8B 3MGPB
chains in the Genus database with same CATH superfamily
4J8VB 4XZQB 1EQZC 3AZEA 1KX4A 3H0RC 3AZMC 3AZKB 3LJAB 4XZQD 3AZND 4J8WA 1U35C 5B2ID 3MGQA 4J8VD 4WU9A 4ZUXC 3AV2B 1P3AD 3VH5A 3VH6T 3LZ0C 4J8XA 3KWQD 3KXBA 2RVQC 4UUZB 5B2IB 1Z2CB 1JFIB 2Y2MA 3AV1A 1KX3C 2ZY4A 5AV9A 4YS3B 5GT3B 2FJ7C 3R45B 5CPJD 4XUJB 3MGRB 5F99D 3REHD 3W98A 3AZNA 1HQ3B 5B0YD 3LELA 3AZJA 3AZHB 3X1SA 2CWEA 3LJAD 4WNNB 3REHA 1P3LA 1F66D 3W98D 5GXQD 3WKJC 3EG5B 1P3BB 1TZYD 3KUYA 1F1EA 3AV1D 3LZ0B 2FFFB 4G91C 3MNNC 1AOID 1HQ3C 4YM6D 2UWXA 1B6WA 3KWQA 5B0ZA 1WWSA 5GT3C 1AOIA 3AZKC 4YS3C 1ID3D 4Z5TB 3NQJA 4H9QA 1H3OB 5JRGD 2Y2NA 3AN2A 4WU8D 2L5AA 5CPIC 4Z66C 3MGSC 5B32C 3X1UA 5B1LD 2Y2IA 1ZLAD 5AY8C 3W97C 3B6FC 1F66A 4AWLB 1PZRA 4J8WD 3VH6A 4YM6C 3AZJD 5B24C 4Z66B 3A6NA 5CPIB 1S32A 3W96A 1P3MB 1P3LD 3REIB 2JCHA 1M19D 4LD9C 1M19A 3AZGD 4H9NA 5AVCC 2ZY3A 4Z5TC 4H9PA 4H9RA 2ZY2A 5AV6C 4KUDC 3W97D 5DNMB 3C1BB 5CPKB 1ZLAC 4G91B 4WU8A 4H9SC 1P3KD 4JJNC 3MGPA 1M1AD 3WTPB 3VH5W 2LY8A 3X1TC 4J8VA 1P3PC 5B33A 5AVCD 3AN2C 2Y2HA 5E5AB 2DQNC 4XZQA 3AYWC 5B40A 4CSRA 3AZHC 1P3GC 3AZKA 5AV6D 3LJAA 4KUDD 1A7WA 3AZIC 2YFWA 3TU4C 2F8NG 3AFAB 1ULYA 3UTAB 1TZYA 3AZFB 3AV2A 3VH6W 5BNVB 4CAYA 1P3PA 5E5AD 4KGCC 2J8PA 4UUZA 5CP6D 5B31D 4JJNA 1ID3B 5B0YA 3LELD 3KUYC 3UT9C 2BYMB 5DNND 2NQBC 1ZLAA 5F99A 4QLCB 4E44A 2HIOC 5BNXB 4XUJA 3AZNB 2AROD 3C1CA 4WU9D 3MGQD 5G49B 3LELB 3AZMB 3W99A 3X1SB 2FJ7A 5AV8A 3KXBD 4XZQC 3AYWA 4J8XD 3MVDC 4J8VC 5BS7A 3AZFC 5B32A 4ZUXD 4R8PB 4J8UC 1BH9A 3AFAC 2HUEC 3TU4B 2Y2OA 3AZEB 1R4VA 5B1MB 3X1UD 5DNNB 3MGQC 4WU9C 1KX5D 4Z2MG 1W2EA 1P3FB 1N1JB 2XD5A 4Z5TA 3F6TA 3WA9A 5F99C 2W8SA 5B40D 2HUEB 5AV5D 5B0YC 2NZDD 4YM6A 1F66C 3WKJA 4DQYB 4Z66A 5CPIA 1S32B 1P3MA 4ZBJC 5GSUC 4LD9B 3W98B 3AZNC 1P3MC 3A1IA 1P3GA 3MNND 4NE5A 1P34A 2VQRA 3AZHA 2JE5A 1KX3A 2CV5D 3WTPE 3C1BD 5BO0A 3C1BA 3MVDB 5GT3D 4WU8B 1P3OC 5KDMB 3B0DC 3LZ0A 4WU8C 2F8NK 3MGSD 5B1MD 5FUGB 1P3MD 3KWQB 1P3IC 3B6FD 3X1VB 5B31G 5AVBD 3AZJC 2IO5B 5B1LB 3P5JB 2NQBB 1M19C 3W98C 4LD9D 4NE3A 1H3OA 2Y2QA 3AFAA 3W96C 3AN2B 3UTAA 5BS7C 3AZFA 3X1UB 3O62C 3REID 4KGCB 3KSYA 1F66B 4H9OA 4G92C 2AROB 5AY8A 1KX4D 3LZ1C 2F8NH 2BYMA 3LZ0D 4X23D 2XD1A 3EPJA 2PYOD 3X1SD 4H9PB 3REKD 3REKB 1KX5B 3O62D 5B2JB 5G49A 3REIC 1M18B 3AZMA 1BH8A 2FJ7D 1KX4C 3W99B 3B6GD 3B0CW 3AZID 3TU4D 3WTPA 4AWLC 5AV9D 3AZLB 4ZUXB 4R8PD 3AV2C 5B32B 5AV6B 5B24D 4R8PA 5B33B 4KUDB 1U35B 4X23C 5CPJB 3TU4A 4KGCD 1P3LC 2YFVB 3LJAC 3X1SC 2BG1A 4EO5B 5B1MA 5GSUA 2YFWB 5B33C 3LZ1A 1P3FA 2HIOD 1P3KB 3MGRD 4WJ3C 3B6FB 3MGPC 3O62A 3W97B 3W99C 2BYKB 3UTBA 5C3IC 3X1TD 3REJD 2ZY5A 5BT1D 3WA9C 3KXBC 3WKJB 2F8ND 3AZFD 3B0CT 5B33D 1P3IA 4LD9A 3NQUA 5AY8D 3C1CB 5DNMD 5CPKD 3MGRC 1P3GB 5B24A 2JSSA 3A6NC 3KFUG 4G92B 3RELB 3W99D 1EQZD 2FJ7B 2NZDA 3AYWB 5E5AC 1KX3B 1P3OA 3REJC 2G5IC 5BO0B 5BT1C 3MVDA 3MGSA 4Z5TD 1BH9B 5KDMA 1U35D 2NQBD 5AV5C 3C1CC 5FUGA 5DNMC 5CPKC 5DNNA 3B6GB 2Y2KA 4XUJC 3X1VD 2F8NA 3X1VA 4JJND 5GT0B 3WAAA 3MNNA 3X1TA 1N1JA 4WV4B 3B0DB 5B1LA 3WA9B 3AZGB 5B31B 5CP6B 5GT0D 3UT9A 5GXQB 3AN2D 2CV5A 5JRGA 4X23B 5CPJC 3MVDD 3AZHD 1Q9CA 4YM6B 4KGCA 3V9RA 2AROA 5AY8B 3C1CD 5AVCA 5GXQC 1KX5C 1P3BD 1S32C 5JA4B 3AZMD 4EO5C 4KHAA 1P34B 3RELD 1EQZB 5GT0C 1P3ID 3WTPD 1KX5A 2RIQA 4J8UA 5AVBB 1HQ3D 4M6BA 2G5HC 5AV5B 1BH8B 4UPKA 1WWIA 5AV8C 4H9SA 4YS3D 3AZLA 1P34D 2PYOA 1P3BC 3REJB 1S32D 5JRGC 1KX3D 5B0ZC 5GSUD 2YFVA 3RELC 2HIOA 5B1LC 3A1KA 3LZ1D 3AZEC 2Y2LA 2NQBA 4J8WB 3LZ1B 2Y2JA 2PYOC 1P3KA 3B6FA 4J8XB 3WKJD 3KXBB 3W97A 3X1UC 4H9OB 3O62B 1JFIA 1TZYC 3UTBB 4Z2MH 5C3IB 3AZIA 1M1AB 2IO5C 5AV9B 3AZLD 4YS3A 2F2AC 1P3KC 3FDDA 3VH5T 5GT3A 4NE6A 3AZED 1P3AB 1P3AC 1AOIC 5B40C 3R45A 1P3IB 3MGRA 1KU5A 3KWQC 3REKA 2RVQD 5B32G 5B2JD 1M18D 1P3FD 5B2JA 1M18A 1ID3C 1TAFB 3RELA 1P3LB 1P3OB 2DF4C 1P3BA 4Z66D 5CPID 5B32D 4ZUXA 5AV6A 4KUDA 3AZLC 1U35A 5CPJA 3REHC 4J8WC 3AL0C 3MGPD 1T3UA 1KX4B 5B2JC 1M18C 3B6GA 1P3FC 4ZBJB 5GSUB 5B0ZB 2F8NB 3REKC 5GT0A 3UT9D 3WAAB 5DNNC 3MGQB 4WU9B 3X1TB 2Y2GA 4DRBA 3AV1C 4H9QB 4NFTA 5B2IA 5GXQA 2CV5B 2BYKA 4X23A 3A6ND 4R8PC 3B0BA 5AVBC 3AV2D 1B67A 2AROC 3AV1B 3UTBD 4E45A 3AZKD 1BFMA 3W96D 5AVCB 3W96B 3AYWD 3REIA 3NQUB 1M19B 1HQ3A 4HGAC 3UTAD 5CHLB 4J8UD 1P3GD 3AFAD 5B24B 3AZJB 4KHAB 2NZDB 4H9RB 3REHB 4WNNA 3X1VC 3H0LC 4XUJD 4J8UB 5DNMA 5CPKA 3MGSB 5AV5A 3KUYB 3UTBC 1HTAA 5B31C 5CP6C 3AZGC 3WA9D 3IP4C 3LELC 2PYOB 3REJA 3UTAC 5E5AA 5B40B 4CSRB 3B6GC 2NZDC 2HIOB 1AOIB 3MNNB 5AV9C 4QLCC 4HGAB 1M1AC 3AZGA 3NQJB 5B31A 5CP6A 3UT9B 3WAAD 5JRGB 1TZYB 2ZM5A 1P3PD 5BNVA 4CAYB 1P3PB 4J8XC 3V9RB 3WTPC 4JJNB 4DRAA 3A6NB 1ID3A 5B0YB 3EPLA 2CV5C 3AZIB 3C1BC 1M1AA 1ZLAB 5AV8D 3EPKA 5F99B 4WZSB 4QLCA 4H9NB 4QLCD 5JA4A 1P3OD 1P3AA 1P34C 5BNXA 1EQZA 3WAAC 5B0ZD 5AVBA 5B1MC 3EPHA 3KUYD 1TAFA 5B2IC 5AV8B 3MGPB 3H0MC 2Y2PA
chains in the Genus database with same CATH topology
4J8VB 4XZQB 1EQZC 3AZEA 1KX4A 3H0RC 3AZMC 3AZKB 3LJAB 4XZQD 3AZND 4J8WA 1U35C 5B2ID 3MGQA 4J8VD 4WU9A 4ZUXC 3AV2B 1P3AD 3VH5A 3VH6T 3LZ0C 4J8XA 3KWQD 3KXBA 2RVQC 4UUZB 5B2IB 1Z2CB 1JFIB 2Y2MA 3AV1A 1KX3C 2ZY4A 5AV9A 4YS3B 5GT3B 2FJ7C 3R45B 5CPJD 4XUJB 3MGRB 5F99D 3REHD 3W98A 3AZNA 1HQ3B 5B0YD 3LELA 3AZJA 3AZHB 3X1SA 2CWEA 3LJAD 4WNNB 3REHA 1P3LA 1F66D 3W98D 5GXQD 3WKJC 3EG5B 1P3BB 1TZYD 3KUYA 1F1EA 3AV1D 3LZ0B 2FFFB 4G91C 3MNNC 1AOID 1HQ3C 4YM6D 2UWXA 1B6WA 3KWQA 5B0ZA 1WWSA 5GT3C 1AOIA 3AZKC 4YS3C 1ID3D 4Z5TB 3NQJA 4H9QA 1H3OB 5JRGD 2Y2NA 3AN2A 4WU8D 2L5AA 5CPIC 4Z66C 3MGSC 5B32C 3X1UA 5B1LD 2Y2IA 1ZLAD 5AY8C 3W97C 3B6FC 1F66A 4AWLB 1PZRA 4J8WD 3VH6A 4YM6C 3AZJD 5B24C 4Z66B 3A6NA 5CPIB 1S32A 3W96A 1P3MB 1P3LD 3REIB 2JCHA 1M19D 4LD9C 1M19A 3AZGD 4H9NA 5AVCC 2ZY3A 4Z5TC 4H9PA 4H9RA 2ZY2A 5AV6C 4KUDC 3W97D 5DNMB 3C1BB 5CPKB 1ZLAC 4G91B 4WU8A 4H9SC 1P3KD 4JJNC 3MGPA 1M1AD 3WTPB 3VH5W 2LY8A 3X1TC 4J8VA 1P3PC 5B33A 5AVCD 3AN2C 2Y2HA 5E5AB 2DQNC 4XZQA 3AYWC 5B40A 4CSRA 3AZHC 1P3GC 3AZKA 5AV6D 3LJAA 4KUDD 1A7WA 3AZIC 2YFWA 3TU4C 2F8NG 3AFAB 1ULYA 3UTAB 1TZYA 3AZFB 3AV2A 3VH6W 5BNVB 4CAYA 1P3PA 5E5AD 4KGCC 2J8PA 4UUZA 5CP6D 5B31D 4JJNA 1ID3B 5B0YA 3LELD 3KUYC 3UT9C 2BYMB 5DNND 2NQBC 1ZLAA 5F99A 4QLCB 4E44A 2HIOC 5BNXB 4XUJA 3AZNB 2AROD 3C1CA 4WU9D 3MGQD 5G49B 3LELB 3AZMB 3W99A 3X1SB 2FJ7A 5AV8A 3KXBD 4XZQC 3AYWA 4J8XD 3MVDC 4J8VC 5BS7A 3AZFC 5B32A 4ZUXD 4R8PB 4J8UC 1BH9A 3AFAC 2HUEC 3TU4B 2Y2OA 3AZEB 1R4VA 5B1MB 3X1UD 5DNNB 3MGQC 4WU9C 1KX5D 4Z2MG 1W2EA 1P3FB 1N1JB 2XD5A 4Z5TA 3F6TA 3WA9A 5F99C 2W8SA 5B40D 2HUEB 5AV5D 5B0YC 2NZDD 4YM6A 1F66C 3WKJA 4DQYB 4Z66A 5CPIA 1S32B 1P3MA 4ZBJC 5GSUC 4LD9B 3W98B 3AZNC 1P3MC 3A1IA 1P3GA 3MNND 4NE5A 1P34A 2VQRA 3AZHA 2JE5A 1KX3A 2CV5D 3WTPE 3C1BD 5BO0A 3C1BA 3MVDB 5GT3D 4WU8B 1P3OC 5KDMB 3B0DC 3LZ0A 4WU8C 2F8NK 3MGSD 5B1MD 5FUGB 1P3MD 3KWQB 1P3IC 3B6FD 3X1VB 5B31G 5AVBD 3AZJC 2IO5B 5B1LB 3P5JB 2NQBB 1M19C 3W98C 4LD9D 4NE3A 1H3OA 2Y2QA 3AFAA 3W96C 3AN2B 3UTAA 5BS7C 3AZFA 3X1UB 3O62C 3REID 4KGCB 3KSYA 1F66B 4H9OA 4G92C 2AROB 5AY8A 1KX4D 3LZ1C 2F8NH 2BYMA 3LZ0D 4X23D 2XD1A 3EPJA 2PYOD 3X1SD 4H9PB 3REKD 3REKB 1KX5B 3O62D 5B2JB 5G49A 3REIC 1M18B 3AZMA 1BH8A 2FJ7D 1KX4C 3W99B 3B6GD 3B0CW 3AZID 3TU4D 3WTPA 4AWLC 5AV9D 3AZLB 4ZUXB 4R8PD 3AV2C 5B32B 5AV6B 5B24D 4R8PA 5B33B 4KUDB 1U35B 4X23C 5CPJB 3TU4A 4KGCD 1P3LC 2YFVB 3LJAC 3X1SC 2BG1A 4EO5B 5B1MA 5GSUA 2YFWB 5B33C 3LZ1A 1P3FA 2HIOD 1P3KB 3MGRD 4WJ3C 3B6FB 3MGPC 3O62A 3W97B 3W99C 2BYKB 3UTBA 5C3IC 3X1TD 3REJD 2ZY5A 5BT1D 3WA9C 3KXBC 3WKJB 2F8ND 3AZFD 3B0CT 5B33D 1P3IA 4LD9A 3NQUA 5AY8D 3C1CB 5DNMD 5CPKD 3MGRC 1P3GB 5B24A 2JSSA 3A6NC 3KFUG 4G92B 3RELB 3W99D 1EQZD 2FJ7B 2NZDA 3AYWB 5E5AC 1KX3B 1P3OA 3REJC 2G5IC 5BO0B 5BT1C 3MVDA 3MGSA 4Z5TD 1BH9B 5KDMA 1U35D 2NQBD 5AV5C 3C1CC 5FUGA 5DNMC 5CPKC 5DNNA 3B6GB 2Y2KA 4XUJC 3X1VD 2F8NA 3X1VA 4JJND 5GT0B 3WAAA 3MNNA 3X1TA 1N1JA 4WV4B 3B0DB 5B1LA 3WA9B 3AZGB 5B31B 5CP6B 5GT0D 3UT9A 5GXQB 3AN2D 2CV5A 5JRGA 4X23B 5CPJC 3MVDD 3AZHD 1Q9CA 4YM6B 4KGCA 3V9RA 2AROA 5AY8B 3C1CD 5AVCA 5GXQC 1KX5C 1P3BD 1S32C 5JA4B 3AZMD 4EO5C 4KHAA 1P34B 3RELD 1EQZB 5GT0C 1P3ID 3WTPD 1KX5A 2RIQA 4J8UA 5AVBB 1HQ3D 4M6BA 2G5HC 5AV5B 1BH8B 4UPKA 1WWIA 5AV8C 4H9SA 4YS3D 3AZLA 1P34D 2PYOA 1P3BC 3REJB 1S32D 5JRGC 1KX3D 5B0ZC 5GSUD 2YFVA 3RELC 2HIOA 5B1LC 3A1KA 3LZ1D 3AZEC 2Y2LA 2NQBA 4J8WB 3LZ1B 2Y2JA 2PYOC 1P3KA 3B6FA 4J8XB 3WKJD 3KXBB 3W97A 3X1UC 4H9OB 3O62B 1JFIA 1TZYC 3UTBB 4Z2MH 5C3IB 3AZIA 1M1AB 2IO5C 5AV9B 3AZLD 4YS3A 2F2AC 1P3KC 3FDDA 3VH5T 5GT3A 4NE6A 3AZED 1P3AB 1P3AC 1AOIC 5B40C 3R45A 1P3IB 3MGRA 1KU5A 3KWQC 3REKA 2RVQD 5B32G 5B2JD 1M18D 1P3FD 5B2JA 1M18A 1ID3C 1TAFB 3RELA 1P3LB 1P3OB 2DF4C 1P3BA 4Z66D 5CPID 5B32D 4ZUXA 5AV6A 4KUDA 3AZLC 1U35A 5CPJA 3REHC 4J8WC 3AL0C 3MGPD 1T3UA 1KX4B 5B2JC 1M18C 3B6GA 1P3FC 4ZBJB 5GSUB 5B0ZB 2F8NB 3REKC 5GT0A 3UT9D 3WAAB 5DNNC 3MGQB 4WU9B 3X1TB 2Y2GA 4DRBA 3AV1C 4H9QB 4NFTA 5B2IA 5GXQA 2CV5B 2BYKA 4X23A 3A6ND 4R8PC 3B0BA 5AVBC 3AV2D 1B67A 2AROC 3AV1B 3UTBD 4E45A 3AZKD 1BFMA 3W96D 5AVCB 3W96B 3AYWD 3REIA 3NQUB 1M19B 1HQ3A 4HGAC 3UTAD 5CHLB 4J8UD 1P3GD 3AFAD 5B24B 3AZJB 4KHAB 2NZDB 4H9RB 3REHB 4WNNA 3X1VC 3H0LC 4XUJD 4J8UB 5DNMA 5CPKA 3MGSB 5AV5A 3KUYB 3UTBC 1HTAA 5B31C 5CP6C 3AZGC 3WA9D 3IP4C 3LELC 2PYOB 3REJA 3UTAC 5E5AA 5B40B 4CSRB 3B6GC 2NZDC 2HIOB 1AOIB 3MNNB 5AV9C 4QLCC 4HGAB 1M1AC 3AZGA 3NQJB 5B31A 5CP6A 3UT9B 3WAAD 5JRGB 1TZYB 2ZM5A 1P3PD 5BNVA 4CAYB 1P3PB 4J8XC 3V9RB 3WTPC 4JJNB 4DRAA 3A6NB 1ID3A 5B0YB 3EPLA 2CV5C 3AZIB 3C1BC 1M1AA 1ZLAB 5AV8D 3EPKA 5F99B 4WZSB 4QLCA 4H9NB 4QLCD 5JA4A 1P3OD 1P3AA 1P34C 5BNXA 1EQZA 3WAAC 5B0ZD 5AVBA 5B1MC 3EPHA 3KUYD 1TAFA 5B2IC 5AV8B 3MGPB 3H0MC 2Y2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  4XZQ B;  1EQZ C;  3AZE A;  1KX4 A;  3AZM C;  3AZK B;  3LJA B;  4XZQ D;  3AZN D;  4J8W A;  1U35 C;  5B2I D;  3MGQ A;  4J8V D;  4WU9 A;  4ZUX C;  3AV2 B;  1P3A D;  3VH5 A;  3VH6 T;  3LZ0 C;  4J8X A;  3KWQ D;  3KXB A;  2RVQ C;  4UUZ B;  5B2I B;  1JFI B;  3AV1 A;  1KX3 C;  5AV9 A;  4YS3 B;  5GT3 B;  2FJ7 C;  3R45 B;  5CPJ D;  4XUJ B;  3MGR B;  5F99 D;  3REH D;  3W98 A;  3AZN A;  1HQ3 B;  5B0Y D;  3LEL A;  3AZJ A;  3AZH B;  3X1S A;  2CWE A;  3LJA D;  4WNN B;  3REH A;  1P3L A;  1F66 D;  3W98 D;  5GXQ D;  3WKJ C;  1P3B B;  1TZY D;  3KUY A;  1F1E A;  3AV1 D;  3LZ0 B;  4G91 C;  3MNN C;  1AOI D;  1HQ3 C;  4YM6 D;  1B6W A;  3KWQ A;  5B0Z A;  1WWS A;  5GT3 C;  1AOI A;  3AZK C;  4YS3 C;  1ID3 D;  4Z5T B;  3NQJ A;  4H9Q A;  1H3O B;  5JRG D;  3AN2 A;  4WU8 D;  2L5A A;  5CPI C;  4Z66 C;  3MGS C;  5B32 C;  3X1U A;  5B1L D;  3W97 C;  1ZLA D;  5AY8 C;  3B6F C;  1F66 A;  4AWL B;  4J8W D;  3VH6 A;  4YM6 C;  3AZJ D;  5B24 C;  4Z66 B;  3A6N A;  5CPI B;  1S32 A;  3W96 A;  1P3M B;  1P3L D;  3REI B;  1M19 D;  4LD9 C;  1M19 A;  3AZG D;  4H9N A;  5AVC C;  4Z5T C;  4H9P A;  4H9R A;  5AV6 C;  4KUD C;  3W97 D;  5DNM B;  3C1B B;  5CPK B;  1ZLA C;  4G91 B;  4WU8 A;  4H9S C;  1P3K D;  4JJN C;  3MGP A;  1M1A D;  3WTP B;  3VH5 W;  2LY8 A;  3X1T C;  4J8V A;  1P3P C;  5B33 A;  5AVC D;  3AN2 C;  5E5A B;  4XZQ A;  3AYW C;  5B40 A;  4CSR A;  3AZH C;  1P3G C;  3AZK A;  5AV6 D;  3LJA A;  4KUD D;  1A7W A;  3AZI C;  2YFW A;  3TU4 C;  2F8N G;  3AFA B;  1ULY A;  3UTA B;  1TZY A;  3AZF B;  3AV2 A;  3VH6 W;  5BNV B;  4CAY A;  1P3P A;  5E5A D;  4KGC C;  4UUZ A;  5CP6 D;  5B31 D;  4JJN A;  1ID3 B;  5B0Y A;  3LEL D;  3KUY C;  3UT9 C;  2BYM B;  5DNN D;  2NQB C;  1ZLA A;  5F99 A;  4QLC B;  4E44 A;  2HIO C;  5BNX B;  4XUJ A;  3AZN B;  2ARO D;  3C1C A;  4WU9 D;  3MGQ D;  5G49 B;  3LEL B;  3AZM B;  3W99 A;  3X1S B;  2FJ7 A;  5AV8 A;  3KXB D;  4XZQ C;  3AYW A;  4J8X D;  3MVD C;  4J8V C;  5BS7 A;  3AZF C;  5B32 A;  4ZUX D;  4R8P B;  4J8U C;  1BH9 A;  3AFA C;  2HUE C;  3TU4 B;  3AZE B;  1R4V A;  5B1M B;  3X1U D;  5DNN B;  3MGQ C;  4WU9 C;  1KX5 D;  4Z2M G;  1P3F B;  1N1J B;  4Z5T A;  3WA9 A;  5F99 C;  5B40 D;  2HUE B;  5AV5 D;  5B0Y C;  2NZD D;  4YM6 A;  1F66 C;  3WKJ A;  4Z66 A;  5CPI A;  1S32 B;  1P3M A;  4ZBJ C;  5GSU C;  4LD9 B;  3W98 B;  3AZN C;  1P3M C;  1P3G A;  3MNN D;  4NE5 A;  1P34 A;  3AZH A;  1KX3 A;  2CV5 D;  3WTP E;  3C1B D;  5BO0 A;  3C1B A;  3MVD B;  5GT3 D;  4WU8 B;  1P3O C;  5KDM B;  3B0D C;  3LZ0 A;  4WU8 C;  2F8N K;  3MGS D;  5B1M D;  5FUG B;  1P3M D;  3KWQ B;  1P3I C;  3B6F D;  3X1V B;  5B31 G;  5AVB D;  3AZJ C;  2IO5 B;  5B1L B;  2NQB B;  1M19 C;  3W98 C;  4LD9 D;  4NE3 A;  1H3O A;  3AFA A;  3W96 C;  3AN2 B;  3UTA A;  5BS7 C;  3AZF A;  3X1U B;  3O62 C;  3REI D;  4KGC B;  3KSY A;  1F66 B;  4H9O A;  4G92 C;  2ARO B;  5AY8 A;  1KX4 D;  3LZ1 C;  2F8N H;  2BYM A;  3LZ0 D;  4X23 D;  2PYO D;  3X1S D;  4H9P B;  3REK D;  3REK B;  1KX5 B;  3O62 D;  5B2J B;  5G49 A;  3REI C;  1M18 B;  3AZM A;  1BH8 A;  2FJ7 D;  1KX4 C;  3W99 B;  3B6G D;  3B0C W;  3AZI D;  3TU4 D;  3WTP A;  4AWL C;  5AV9 D;  3AZL B;  4ZUX B;  4R8P D;  3AV2 C;  5B32 B;  5AV6 B;  5B24 D;  4R8P A;  5B33 B;  4KUD B;  1U35 B;  4X23 C;  5CPJ B;  3TU4 A;  4KGC D;  1P3L C;  2YFV B;  3LJA C;  3X1S C;  4EO5 B;  5B1M A;  5GSU A;  2YFW B;  5B33 C;  3LZ1 A;  1P3F A;  2HIO D;  1P3K B;  3MGR D;  3B6F B;  3MGP C;  3O62 A;  3W97 B;  3W99 C;  2BYK B;  3UTB A;  5C3I C;  3X1T D;  3REJ D;  5BT1 D;  3WA9 C;  3KXB C;  3WKJ B;  2F8N D;  3AZF D;  3B0C T;  5B33 D;  1P3I A;  4LD9 A;  3NQU A;  5AY8 D;  3C1C B;  5DNM D;  5CPK D;  3MGR C;  1P3G B;  5B24 A;  2JSS A;  3A6N C;  2NZD A;  4G92 B;  3REL B;  3W99 D;  1EQZ D;  2FJ7 B;  3AYW B;  5E5A C;  1KX3 B;  1P3O A;  3REJ C;  5BO0 B;  5BT1 C;  3MVD A;  3MGS A;  4Z5T D;  1BH9 B;  5KDM A;  1U35 D;  2NQB D;  5AV5 C;  3C1C C;  5FUG A;  5DNM C;  5CPK C;  5DNN A;  3B6G B;  4XUJ C;  3X1V D;  2F8N A;  3X1V A;  4JJN D;  5GT0 B;  3WAA A;  3MNN A;  3X1T A;  1N1J A;  4WV4 B;  3B0D B;  5B1L A;  3WA9 B;  3AZG B;  5B31 B;  5CP6 B;  5GT0 D;  3UT9 A;  5GXQ B;  3AN2 D;  2CV5 A;  5JRG A;  4X23 B;  5CPJ C;  3MVD D;  3AZH D;  1Q9C A;  4YM6 B;  4KGC A;  3V9R A;  2ARO A;  5AY8 B;  3C1C D;  5AVC A;  5GXQ C;  1KX5 C;  1P3B D;  1S32 C;  5JA4 B;  3AZM D;  4EO5 C;  4KHA A;  1P34 B;  3REL D;  1EQZ B;  5GT0 C;  1P3I D;  3WTP D;  1KX5 A;  4J8U A;  5AVB B;  1HQ3 D;  4M6B A;  5AV5 B;  1BH8 B;  1WWI A;  5AV8 C;  4H9S A;  4YS3 D;  3AZL A;  1P34 D;  2PYO A;  1P3B C;  3REJ B;  1S32 D;  5JRG C;  1KX3 D;  5B0Z C;  5GSU D;  2YFV A;  3REL C;  2HIO A;  5B1L C;  3LZ1 D;  3AZE C;  2NQB A;  4J8W B;  3LZ1 B;  2PYO C;  1P3K A;  3B6F A;  4J8X B;  3WKJ D;  3KXB B;  3W97 A;  3O62 B;  3X1U C;  4H9O B;  1JFI A;  1TZY C;  3UTB B;  4Z2M H;  5C3I B;  3AZI A;  1M1A B;  2IO5 C;  5AV9 B;  3AZL D;  4YS3 A;  1P3K C;  3AZE D;  3VH5 T;  5GT3 A;  4NE6 A;  1P3A B;  1AOI C;  1P3A C;  5B40 C;  3R45 A;  1P3I B;  3MGR A;  1KU5 A;  3KWQ C;  3REK A;  2RVQ D;  5B32 G;  5B2J D;  1M18 D;  1P3F D;  5B2J A;  1M18 A;  1ID3 C;  1TAF B;  3REL A;  1P3L B;  1P3O B;  1P3B A;  4Z66 D;  5CPI D;  5B32 D;  4ZUX A;  5AV6 A;  4KUD A;  3AZL C;  1U35 A;  5CPJ A;  3REH C;  4J8W C;  3MGP D;  1KX4 B;  5B2J C;  1M18 C;  3B6G A;  1P3F C;  4ZBJ B;  5GSU B;  5B0Z B;  2F8N B;  3REK C;  5GT0 A;  3UT9 D;  3WAA B;  5DNN C;  3MGQ B;  4WU9 B;  3X1T B;  4DRB A;  3AV1 C;  4H9Q B;  4NFT A;  5B2I A;  5GXQ A;  2CV5 B;  2BYK A;  4X23 A;  3A6N D;  4R8P C;  3B0B A;  5AVB C;  3AV2 D;  1B67 A;  2ARO C;  3AV1 B;  3UTB D;  4E45 A;  3AZK D;  1BFM A;  3W96 D;  5AVC B;  3W96 B;  3AYW D;  3REI A;  3NQU B;  1M19 B;  1HQ3 A;  4HGA C;  3UTA D;  5CHL B;  4J8U D;  1P3G D;  3AFA D;  5B24 B;  3AZJ B;  4KHA B;  2NZD B;  4H9R B;  3REH B;  4WNN A;  4XUJ D;  3X1V C;  4J8U B;  5DNM A;  5CPK A;  3MGS B;  5AV5 A;  3KUY B;  3UTB C;  1HTA A;  5B31 C;  5CP6 C;  3AZG C;  3WA9 D;  3LEL C;  2PYO B;  3REJ A;  3UTA C;  5E5A A;  5B40 B;  4CSR B;  3B6G C;  2NZD C;  2HIO B;  1AOI B;  3MNN B;  5AV9 C;  4QLC C;  4HGA B;  1M1A C;  3AZG A;  3NQJ B;  5B31 A;  5CP6 A;  3UT9 B;  3WAA D;  5JRG B;  1TZY B;  1P3P D;  5BNV A;  4CAY B;  1P3P B;  4J8X C;  3V9R B;  3WTP C;  4JJN B;  4DRA A;  3A6N B;  1ID3 A;  5B0Y B;  2CV5 C;  3AZI B;  3C1B C;  1M1A A;  1ZLA B;  5AV8 D;  5F99 B;  4WZS B;  4QLC A;  4H9N B;  4QLC D;  5JA4 A;  1P3O D;  1P3A A;  1P34 C;  5BNX A;  1EQZ A;  3WAA C;  5B0Z D;  5AVB A;  5B1M C;  3KUY D;  1TAF A;  5B2I C;  5AV8 B;  3MGP B; 
#chains in the Genus database with same CATH topology
 4J8V B;  4XZQ B;  1EQZ C;  3AZE A;  1KX4 A;  3H0R C;  3AZM C;  3AZK B;  3LJA B;  4XZQ D;  3AZN D;  4J8W A;  1U35 C;  5B2I D;  3MGQ A;  4J8V D;  4WU9 A;  4ZUX C;  3AV2 B;  1P3A D;  3VH5 A;  3VH6 T;  3LZ0 C;  4J8X A;  3KWQ D;  3KXB A;  2RVQ C;  4UUZ B;  5B2I B;  1Z2C B;  1JFI B;  2Y2M A;  3AV1 A;  1KX3 C;  2ZY4 A;  5AV9 A;  4YS3 B;  5GT3 B;  2FJ7 C;  3R45 B;  5CPJ D;  4XUJ B;  3MGR B;  5F99 D;  3REH D;  3W98 A;  3AZN A;  1HQ3 B;  5B0Y D;  3LEL A;  3AZJ A;  3AZH B;  3X1S A;  2CWE A;  3LJA D;  4WNN B;  3REH A;  1P3L A;  1F66 D;  3W98 D;  5GXQ D;  3WKJ C;  3EG5 B;  1P3B B;  1TZY D;  3KUY A;  1F1E A;  3AV1 D;  3LZ0 B;  2FFF B;  4G91 C;  3MNN C;  1AOI D;  1HQ3 C;  4YM6 D;  2UWX A;  1B6W A;  3KWQ A;  5B0Z A;  1WWS A;  5GT3 C;  1AOI A;  3AZK C;  4YS3 C;  1ID3 D;  4Z5T B;  3NQJ A;  4H9Q A;  1H3O B;  5JRG D;  2Y2N A;  3AN2 A;  4WU8 D;  2L5A A;  5CPI C;  4Z66 C;  3MGS C;  5B32 C;  3X1U A;  5B1L D;  2Y2I A;  1ZLA D;  5AY8 C;  3W97 C;  3B6F C;  1F66 A;  4AWL B;  1PZR A;  4J8W D;  3VH6 A;  4YM6 C;  3AZJ D;  5B24 C;  4Z66 B;  3A6N A;  5CPI B;  1S32 A;  3W96 A;  1P3M B;  1P3L D;  3REI B;  2JCH A;  1M19 D;  4LD9 C;  1M19 A;  3AZG D;  4H9N A;  5AVC C;  2ZY3 A;  4Z5T C;  4H9P A;  4H9R A;  2ZY2 A;  5AV6 C;  4KUD C;  3W97 D;  5DNM B;  3C1B B;  5CPK B;  1ZLA C;  4G91 B;  4WU8 A;  4H9S C;  1P3K D;  4JJN C;  3MGP A;  1M1A D;  3WTP B;  3VH5 W;  2LY8 A;  3X1T C;  4J8V A;  1P3P C;  5B33 A;  5AVC D;  3AN2 C;  2Y2H A;  5E5A B;  2DQN C;  4XZQ A;  3AYW C;  5B40 A;  4CSR A;  3AZH C;  1P3G C;  3AZK A;  5AV6 D;  3LJA A;  4KUD D;  1A7W A;  3AZI C;  2YFW A;  3TU4 C;  2F8N G;  3AFA B;  1ULY A;  3UTA B;  1TZY A;  3AZF B;  3AV2 A;  3VH6 W;  5BNV B;  4CAY A;  1P3P A;  5E5A D;  4KGC C;  2J8P A;  4UUZ A;  5CP6 D;  5B31 D;  4JJN A;  1ID3 B;  5B0Y A;  3LEL D;  3KUY C;  3UT9 C;  2BYM B;  5DNN D;  2NQB C;  1ZLA A;  5F99 A;  4QLC B;  4E44 A;  2HIO C;  5BNX B;  4XUJ A;  3AZN B;  2ARO D;  3C1C A;  4WU9 D;  3MGQ D;  5G49 B;  3LEL B;  3AZM B;  3W99 A;  3X1S B;  2FJ7 A;  5AV8 A;  3KXB D;  4XZQ C;  3AYW A;  4J8X D;  3MVD C;  4J8V C;  5BS7 A;  3AZF C;  5B32 A;  4ZUX D;  4R8P B;  4J8U C;  1BH9 A;  3AFA C;  2HUE C;  3TU4 B;  2Y2O A;  3AZE B;  1R4V A;  5B1M B;  3X1U D;  5DNN B;  3MGQ C;  4WU9 C;  1KX5 D;  4Z2M G;  1W2E A;  1P3F B;  1N1J B;  2XD5 A;  4Z5T A;  3F6T A;  3WA9 A;  5F99 C;  2W8S A;  5B40 D;  2HUE B;  5AV5 D;  5B0Y C;  2NZD D;  4YM6 A;  1F66 C;  3WKJ A;  4DQY B;  4Z66 A;  5CPI A;  1S32 B;  1P3M A;  4ZBJ C;  5GSU C;  4LD9 B;  3W98 B;  3AZN C;  1P3M C;  3A1I A;  1P3G A;  3MNN D;  4NE5 A;  1P34 A;  2VQR A;  3AZH A;  2JE5 A;  1KX3 A;  2CV5 D;  3WTP E;  3C1B D;  5BO0 A;  3C1B A;  3MVD B;  5GT3 D;  4WU8 B;  1P3O C;  5KDM B;  3B0D C;  3LZ0 A;  4WU8 C;  2F8N K;  3MGS D;  5B1M D;  5FUG B;  1P3M D;  3KWQ B;  1P3I C;  3B6F D;  3X1V B;  5B31 G;  5AVB D;  3AZJ C;  2IO5 B;  5B1L B;  3P5J B;  2NQB B;  1M19 C;  3W98 C;  4LD9 D;  4NE3 A;  1H3O A;  2Y2Q A;  3AFA A;  3W96 C;  3AN2 B;  3UTA A;  5BS7 C;  3AZF A;  3X1U B;  3O62 C;  3REI D;  4KGC B;  3KSY A;  1F66 B;  4H9O A;  4G92 C;  2ARO B;  5AY8 A;  1KX4 D;  3LZ1 C;  2F8N H;  2BYM A;  3LZ0 D;  4X23 D;  2XD1 A;  3EPJ A;  2PYO D;  3X1S D;  4H9P B;  3REK D;  3REK B;  1KX5 B;  3O62 D;  5B2J B;  5G49 A;  3REI C;  1M18 B;  3AZM A;  1BH8 A;  2FJ7 D;  1KX4 C;  3W99 B;  3B6G D;  3B0C W;  3AZI D;  3TU4 D;  3WTP A;  4AWL C;  5AV9 D;  3AZL B;  4ZUX B;  4R8P D;  3AV2 C;  5B32 B;  5AV6 B;  5B24 D;  4R8P A;  5B33 B;  4KUD B;  1U35 B;  4X23 C;  5CPJ B;  3TU4 A;  4KGC D;  1P3L C;  2YFV B;  3LJA C;  3X1S C;  2BG1 A;  4EO5 B;  5B1M A;  5GSU A;  2YFW B;  5B33 C;  3LZ1 A;  1P3F A;  2HIO D;  1P3K B;  3MGR D;  4WJ3 C;  3B6F B;  3MGP C;  3O62 A;  3W97 B;  3W99 C;  2BYK B;  3UTB A;  5C3I C;  3X1T D;  3REJ D;  2ZY5 A;  5BT1 D;  3WA9 C;  3KXB C;  3WKJ B;  2F8N D;  3AZF D;  3B0C T;  5B33 D;  1P3I A;  4LD9 A;  3NQU A;  5AY8 D;  3C1C B;  5DNM D;  5CPK D;  3MGR C;  1P3G B;  5B24 A;  2JSS A;  3A6N C;  3KFU G;  4G92 B;  3REL B;  3W99 D;  1EQZ D;  2FJ7 B;  2NZD A;  3AYW B;  5E5A C;  1KX3 B;  1P3O A;  3REJ C;  2G5I C;  5BO0 B;  5BT1 C;  3MVD A;  3MGS A;  4Z5T D;  1BH9 B;  5KDM A;  1U35 D;  2NQB D;  5AV5 C;  3C1C C;  5FUG A;  5DNM C;  5CPK C;  5DNN A;  3B6G B;  2Y2K A;  4XUJ C;  3X1V D;  2F8N A;  3X1V A;  4JJN D;  5GT0 B;  3WAA A;  3MNN A;  3X1T A;  1N1J A;  4WV4 B;  3B0D B;  5B1L A;  3WA9 B;  3AZG B;  5B31 B;  5CP6 B;  5GT0 D;  3UT9 A;  5GXQ B;  3AN2 D;  2CV5 A;  5JRG A;  4X23 B;  5CPJ C;  3MVD D;  3AZH D;  1Q9C A;  4YM6 B;  4KGC A;  3V9R A;  2ARO A;  5AY8 B;  3C1C D;  5AVC A;  5GXQ C;  1KX5 C;  1P3B D;  1S32 C;  5JA4 B;  3AZM D;  4EO5 C;  4KHA A;  1P34 B;  3REL D;  1EQZ B;  5GT0 C;  1P3I D;  3WTP D;  1KX5 A;  2RIQ A;  4J8U A;  5AVB B;  1HQ3 D;  4M6B A;  2G5H C;  5AV5 B;  1BH8 B;  4UPK A;  1WWI A;  5AV8 C;  4H9S A;  4YS3 D;  3AZL A;  1P34 D;  2PYO A;  1P3B C;  3REJ B;  1S32 D;  5JRG C;  1KX3 D;  5B0Z C;  5GSU D;  2YFV A;  3REL C;  2HIO A;  5B1L C;  3A1K A;  3LZ1 D;  3AZE C;  2Y2L A;  2NQB A;  4J8W B;  3LZ1 B;  2Y2J A;  2PYO C;  1P3K A;  3B6F A;  4J8X B;  3WKJ D;  3KXB B;  3W97 A;  3X1U C;  4H9O B;  3O62 B;  1JFI A;  1TZY C;  3UTB B;  4Z2M H;  5C3I B;  3AZI A;  1M1A B;  2IO5 C;  5AV9 B;  3AZL D;  4YS3 A;  2F2A C;  1P3K C;  3FDD A;  3VH5 T;  5GT3 A;  4NE6 A;  3AZE D;  1P3A B;  1P3A C;  1AOI C;  5B40 C;  3R45 A;  1P3I B;  3MGR A;  1KU5 A;  3KWQ C;  3REK A;  2RVQ D;  5B32 G;  5B2J D;  1M18 D;  1P3F D;  5B2J A;  1M18 A;  1ID3 C;  1TAF B;  3REL A;  1P3L B;  1P3O B;  2DF4 C;  1P3B A;  4Z66 D;  5CPI D;  5B32 D;  4ZUX A;  5AV6 A;  4KUD A;  3AZL C;  1U35 A;  5CPJ A;  3REH C;  4J8W C;  3AL0 C;  3MGP D;  1T3U A;  1KX4 B;  5B2J C;  1M18 C;  3B6G A;  1P3F C;  4ZBJ B;  5GSU B;  5B0Z B;  2F8N B;  3REK C;  5GT0 A;  3UT9 D;  3WAA B;  5DNN C;  3MGQ B;  4WU9 B;  3X1T B;  2Y2G A;  4DRB A;  3AV1 C;  4H9Q B;  4NFT A;  5B2I A;  5GXQ A;  2CV5 B;  2BYK A;  4X23 A;  3A6N D;  4R8P C;  3B0B A;  5AVB C;  3AV2 D;  1B67 A;  2ARO C;  3AV1 B;  3UTB D;  4E45 A;  3AZK D;  1BFM A;  3W96 D;  5AVC B;  3W96 B;  3AYW D;  3REI A;  3NQU B;  1M19 B;  1HQ3 A;  4HGA C;  3UTA D;  5CHL B;  4J8U D;  1P3G D;  3AFA D;  5B24 B;  3AZJ B;  4KHA B;  2NZD B;  4H9R B;  3REH B;  4WNN A;  3X1V C;  3H0L C;  4XUJ D;  4J8U B;  5DNM A;  5CPK A;  3MGS B;  5AV5 A;  3KUY B;  3UTB C;  1HTA A;  5B31 C;  5CP6 C;  3AZG C;  3WA9 D;  3IP4 C;  3LEL C;  2PYO B;  3REJ A;  3UTA C;  5E5A A;  5B40 B;  4CSR B;  3B6G C;  2NZD C;  2HIO B;  1AOI B;  3MNN B;  5AV9 C;  4QLC C;  4HGA B;  1M1A C;  3AZG A;  3NQJ B;  5B31 A;  5CP6 A;  3UT9 B;  3WAA D;  5JRG B;  1TZY B;  2ZM5 A;  1P3P D;  5BNV A;  4CAY B;  1P3P B;  4J8X C;  3V9R B;  3WTP C;  4JJN B;  4DRA A;  3A6N B;  1ID3 A;  5B0Y B;  3EPL A;  2CV5 C;  3AZI B;  3C1B C;  1M1A A;  1ZLA B;  5AV8 D;  3EPK A;  5F99 B;  4WZS B;  4QLC A;  4H9N B;  4QLC D;  5JA4 A;  1P3O D;  1P3A A;  1P34 C;  5BNX A;  1EQZ A;  3WAA C;  5B0Z D;  5AVB A;  5B1M C;  3EPH A;  3KUY D;  1TAF A;  5B2I C;  5AV8 B;  3MGP B;  3H0M C;  2Y2P A; 
#chains in the Genus database with same CATH homology
 4J8V B;  4XZQ B;  1EQZ C;  3AZE A;  1KX4 A;  3H0R C;  3AZM C;  3AZK B;  3LJA B;  4XZQ D;  3AZN D;  4J8W A;  1U35 C;  5B2I D;  3MGQ A;  4J8V D;  4WU9 A;  4ZUX C;  3AV2 B;  1P3A D;  3VH5 A;  3VH6 T;  3LZ0 C;  4J8X A;  3KWQ D;  3KXB A;  2RVQ C;  4UUZ B;  5B2I B;  1Z2C B;  1JFI B;  2Y2M A;  3AV1 A;  1KX3 C;  2ZY4 A;  5AV9 A;  4YS3 B;  5GT3 B;  2FJ7 C;  3R45 B;  5CPJ D;  4XUJ B;  3MGR B;  5F99 D;  3REH D;  3W98 A;  3AZN A;  1HQ3 B;  5B0Y D;  3LEL A;  3AZJ A;  3AZH B;  3X1S A;  2CWE A;  3LJA D;  4WNN B;  3REH A;  1P3L A;  1F66 D;  3W98 D;  5GXQ D;  3WKJ C;  3EG5 B;  1P3B B;  1TZY D;  3KUY A;  1F1E A;  3AV1 D;  3LZ0 B;  2FFF B;  4G91 C;  3MNN C;  1AOI D;  1HQ3 C;  4YM6 D;  2UWX A;  1B6W A;  3KWQ A;  5B0Z A;  1WWS A;  5GT3 C;  1AOI A;  3AZK C;  4YS3 C;  1ID3 D;  4Z5T B;  3NQJ A;  4H9Q A;  1H3O B;  5JRG D;  2Y2N A;  3AN2 A;  4WU8 D;  2L5A A;  5CPI C;  4Z66 C;  3MGS C;  5B32 C;  3X1U A;  5B1L D;  2Y2I A;  1ZLA D;  5AY8 C;  3W97 C;  3B6F C;  1F66 A;  4AWL B;  1PZR A;  4J8W D;  3VH6 A;  4YM6 C;  3AZJ D;  5B24 C;  4Z66 B;  3A6N A;  5CPI B;  1S32 A;  3W96 A;  1P3M B;  1P3L D;  3REI B;  2JCH A;  1M19 D;  4LD9 C;  1M19 A;  3AZG D;  4H9N A;  5AVC C;  2ZY3 A;  4Z5T C;  4H9P A;  4H9R A;  2ZY2 A;  5AV6 C;  4KUD C;  3W97 D;  5DNM B;  3C1B B;  5CPK B;  1ZLA C;  4G91 B;  4WU8 A;  4H9S C;  1P3K D;  4JJN C;  3MGP A;  1M1A D;  3WTP B;  3VH5 W;  2LY8 A;  3X1T C;  4J8V A;  1P3P C;  5B33 A;  5AVC D;  3AN2 C;  2Y2H A;  5E5A B;  2DQN C;  4XZQ A;  3AYW C;  5B40 A;  4CSR A;  3AZH C;  1P3G C;  3AZK A;  5AV6 D;  3LJA A;  4KUD D;  1A7W A;  3AZI C;  2YFW A;  3TU4 C;  2F8N G;  3AFA B;  1ULY A;  3UTA B;  1TZY A;  3AZF B;  3AV2 A;  3VH6 W;  5BNV B;  4CAY A;  1P3P A;  5E5A D;  4KGC C;  2J8P A;  4UUZ A;  5CP6 D;  5B31 D;  4JJN A;  1ID3 B;  5B0Y A;  3LEL D;  3KUY C;  3UT9 C;  2BYM B;  5DNN D;  2NQB C;  1ZLA A;  5F99 A;  4QLC B;  4E44 A;  2HIO C;  5BNX B;  4XUJ A;  3AZN B;  2ARO D;  3C1C A;  4WU9 D;  3MGQ D;  5G49 B;  3LEL B;  3AZM B;  3W99 A;  3X1S B;  2FJ7 A;  5AV8 A;  3KXB D;  4XZQ C;  3AYW A;  4J8X D;  3MVD C;  4J8V C;  5BS7 A;  3AZF C;  5B32 A;  4ZUX D;  4R8P B;  4J8U C;  1BH9 A;  3AFA C;  2HUE C;  3TU4 B;  2Y2O A;  3AZE B;  1R4V A;  5B1M B;  3X1U D;  5DNN B;  3MGQ C;  4WU9 C;  1KX5 D;  4Z2M G;  1W2E A;  1P3F B;  1N1J B;  2XD5 A;  4Z5T A;  3F6T A;  3WA9 A;  5F99 C;  2W8S A;  5B40 D;  2HUE B;  5AV5 D;  5B0Y C;  2NZD D;  4YM6 A;  1F66 C;  3WKJ A;  4DQY B;  4Z66 A;  5CPI A;  1S32 B;  1P3M A;  4ZBJ C;  5GSU C;  4LD9 B;  3W98 B;  3AZN C;  1P3M C;  3A1I A;  1P3G A;  3MNN D;  4NE5 A;  1P34 A;  2VQR A;  3AZH A;  2JE5 A;  1KX3 A;  2CV5 D;  3WTP E;  3C1B D;  5BO0 A;  3C1B A;  3MVD B;  5GT3 D;  4WU8 B;  1P3O C;  5KDM B;  3B0D C;  3LZ0 A;  4WU8 C;  2F8N K;  3MGS D;  5B1M D;  5FUG B;  1P3M D;  3KWQ B;  1P3I C;  3B6F D;  3X1V B;  5B31 G;  5AVB D;  3AZJ C;  2IO5 B;  5B1L B;  3P5J B;  2NQB B;  1M19 C;  3W98 C;  4LD9 D;  4NE3 A;  1H3O A;  2Y2Q A;  3AFA A;  3W96 C;  3AN2 B;  3UTA A;  5BS7 C;  3AZF A;  3X1U B;  3O62 C;  3REI D;  4KGC B;  3KSY A;  1F66 B;  4H9O A;  4G92 C;  2ARO B;  5AY8 A;  1KX4 D;  3LZ1 C;  2F8N H;  2BYM A;  3LZ0 D;  4X23 D;  2XD1 A;  3EPJ A;  2PYO D;  3X1S D;  4H9P B;  3REK D;  3REK B;  1KX5 B;  3O62 D;  5B2J B;  5G49 A;  3REI C;  1M18 B;  3AZM A;  1BH8 A;  2FJ7 D;  1KX4 C;  3W99 B;  3B6G D;  3B0C W;  3AZI D;  3TU4 D;  3WTP A;  4AWL C;  5AV9 D;  3AZL B;  4ZUX B;  4R8P D;  3AV2 C;  5B32 B;  5AV6 B;  5B24 D;  4R8P A;  5B33 B;  4KUD B;  1U35 B;  4X23 C;  5CPJ B;  3TU4 A;  4KGC D;  1P3L C;  2YFV B;  3LJA C;  3X1S C;  2BG1 A;  4EO5 B;  5B1M A;  5GSU A;  2YFW B;  5B33 C;  3LZ1 A;  1P3F A;  2HIO D;  1P3K B;  3MGR D;  4WJ3 C;  3B6F B;  3MGP C;  3O62 A;  3W97 B;  3W99 C;  2BYK B;  3UTB A;  5C3I C;  3X1T D;  3REJ D;  2ZY5 A;  5BT1 D;  3WA9 C;  3KXB C;  3WKJ B;  2F8N D;  3AZF D;  3B0C T;  5B33 D;  1P3I A;  4LD9 A;  3NQU A;  5AY8 D;  3C1C B;  5DNM D;  5CPK D;  3MGR C;  1P3G B;  5B24 A;  2JSS A;  3A6N C;  3KFU G;  4G92 B;  3REL B;  3W99 D;  1EQZ D;  2FJ7 B;  2NZD A;  3AYW B;  5E5A C;  1KX3 B;  1P3O A;  3REJ C;  2G5I C;  5BO0 B;  5BT1 C;  3MVD A;  3MGS A;  4Z5T D;  1BH9 B;  5KDM A;  1U35 D;  2NQB D;  5AV5 C;  3C1C C;  5FUG A;  5DNM C;  5CPK C;  5DNN A;  3B6G B;  2Y2K A;  4XUJ C;  3X1V D;  2F8N A;  3X1V A;  4JJN D;  5GT0 B;  3WAA A;  3MNN A;  3X1T A;  1N1J A;  4WV4 B;  3B0D B;  5B1L A;  3WA9 B;  3AZG B;  5B31 B;  5CP6 B;  5GT0 D;  3UT9 A;  5GXQ B;  3AN2 D;  2CV5 A;  5JRG A;  4X23 B;  5CPJ C;  3MVD D;  3AZH D;  1Q9C A;  4YM6 B;  4KGC A;  3V9R A;  2ARO A;  5AY8 B;  3C1C D;  5AVC A;  5GXQ C;  1KX5 C;  1P3B D;  1S32 C;  5JA4 B;  3AZM D;  4EO5 C;  4KHA A;  1P34 B;  3REL D;  1EQZ B;  5GT0 C;  1P3I D;  3WTP D;  1KX5 A;  2RIQ A;  4J8U A;  5AVB B;  1HQ3 D;  4M6B A;  2G5H C;  5AV5 B;  1BH8 B;  4UPK A;  1WWI A;  5AV8 C;  4H9S A;  4YS3 D;  3AZL A;  1P34 D;  2PYO A;  1P3B C;  3REJ B;  1S32 D;  5JRG C;  1KX3 D;  5B0Z C;  5GSU D;  2YFV A;  3REL C;  2HIO A;  5B1L C;  3A1K A;  3LZ1 D;  3AZE C;  2Y2L A;  2NQB A;  4J8W B;  3LZ1 B;  2Y2J A;  2PYO C;  1P3K A;  3B6F A;  4J8X B;  3WKJ D;  3KXB B;  3W97 A;  3X1U C;  4H9O B;  3O62 B;  1JFI A;  1TZY C;  3UTB B;  4Z2M H;  5C3I B;  3AZI A;  1M1A B;  2IO5 C;  5AV9 B;  3AZL D;  4YS3 A;  2F2A C;  1P3K C;  3FDD A;  3VH5 T;  5GT3 A;  4NE6 A;  3AZE D;  1P3A B;  1P3A C;  1AOI C;  5B40 C;  3R45 A;  1P3I B;  3MGR A;  1KU5 A;  3KWQ C;  3REK A;  2RVQ D;  5B32 G;  5B2J D;  1M18 D;  1P3F D;  5B2J A;  1M18 A;  1ID3 C;  1TAF B;  3REL A;  1P3L B;  1P3O B;  2DF4 C;  1P3B A;  4Z66 D;  5CPI D;  5B32 D;  4ZUX A;  5AV6 A;  4KUD A;  3AZL C;  1U35 A;  5CPJ A;  3REH C;  4J8W C;  3AL0 C;  3MGP D;  1T3U A;  1KX4 B;  5B2J C;  1M18 C;  3B6G A;  1P3F C;  4ZBJ B;  5GSU B;  5B0Z B;  2F8N B;  3REK C;  5GT0 A;  3UT9 D;  3WAA B;  5DNN C;  3MGQ B;  4WU9 B;  3X1T B;  2Y2G A;  4DRB A;  3AV1 C;  4H9Q B;  4NFT A;  5B2I A;  5GXQ A;  2CV5 B;  2BYK A;  4X23 A;  3A6N D;  4R8P C;  3B0B A;  5AVB C;  3AV2 D;  1B67 A;  2ARO C;  3AV1 B;  3UTB D;  4E45 A;  3AZK D;  1BFM A;  3W96 D;  5AVC B;  3W96 B;  3AYW D;  3REI A;  3NQU B;  1M19 B;  1HQ3 A;  4HGA C;  3UTA D;  5CHL B;  4J8U D;  1P3G D;  3AFA D;  5B24 B;  3AZJ B;  4KHA B;  2NZD B;  4H9R B;  3REH B;  4WNN A;  3X1V C;  3H0L C;  4XUJ D;  4J8U B;  5DNM A;  5CPK A;  3MGS B;  5AV5 A;  3KUY B;  3UTB C;  1HTA A;  5B31 C;  5CP6 C;  3AZG C;  3WA9 D;  3IP4 C;  3LEL C;  2PYO B;  3REJ A;  3UTA C;  5E5A A;  5B40 B;  4CSR B;  3B6G C;  2NZD C;  2HIO B;  1AOI B;  3MNN B;  5AV9 C;  4QLC C;  4HGA B;  1M1A C;  3AZG A;  3NQJ B;  5B31 A;  5CP6 A;  3UT9 B;  3WAA D;  5JRG B;  1TZY B;  2ZM5 A;  1P3P D;  5BNV A;  4CAY B;  1P3P B;  4J8X C;  3V9R B;  3WTP C;  4JJN B;  4DRA A;  3A6N B;  1ID3 A;  5B0Y B;  3EPL A;  2CV5 C;  3AZI B;  3C1B C;  1M1A A;  1ZLA B;  5AV8 D;  3EPK A;  5F99 B;  4WZS B;  4QLC A;  4H9N B;  4QLC D;  5JA4 A;  1P3O D;  1P3A A;  1P34 C;  5BNX A;  1EQZ A;  3WAA C;  5B0Z D;  5AVB A;  5B1M C;  3EPH A;  3KUY D;  1TAF A;  5B2I C;  5AV8 B;  3MGP B;  3H0M C;  2Y2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...