1M1AD

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aD00
3TU4C 1P3KB 5BNXA 4H9SC 3C1CA 1P3PB 4J8XC 3MGSD 5CP6A 3LZ1A 2BYMB 3VH5T 3A6NA 4H9PB 3V9RA 5B24B 2NZDB 5CHLB 4WZSB 5E5AC 5GT3B 3B0BA 3WAAD 1M19C 3C1BA 5F99B 5B2JD 3REJD 2AROB 4H9RA 2NQBB 1P3FD 3AZGC 1P3IB 4AWLB 3MGSC 2F8NH 5B32G 4CAYB 3W97D 2L5AA 4WNNB 4YS3A 3MVDA 1P3OB 1AOID 3AN2D 5DNMB 4Z5TA 1F1EA 3AZKA 5B0YB 5B2JC 3AZNB 1P3FC 2FJ7A 4Z66D 4J8UC 4J8VD 3MVDC 4XUJD 3RELD 5CPJB 4Z5TC 3W97C 1P3GB 3R45B 5B31B 3AFAA 1AOIC 5CPKD 1KX3A 4WU8B 4G91C 3WKJA 3W96D 4H9OA 3X1UD 2BYKA 5CPIB 4CSRB 3AZJC 2JSSA 5AV9B 5B40D 1P3LA 3MGPC 3VH6A 3KWQC 5KDMA 3REKB 3AZHB 1P3KD 1KX3C 5B32C 4XUJC 4J8WB 3WTPC 3VH5A 1KX5A 3W99C 1P3AA 4WU9C 1BH9B 5CPKC 4R8PB 4J8XB 5AVCC 3NQJA 5B24D 2NZDD 5GT3D 5JA4A 5AVBA 5F99D 3LELC 5BNXB 1P3KC 2AROD 5JRGA 2NQBD 1M19B 1P3ID 2LY8A 4X23A 3AZGB 3V9RB 5B33C 5B24C 2NZDC 5GT3C 3W98A 5DNMD 5GXQA 3AZND 5B0YD 3LZ0C 4JJNA 4AWLC 5B2JB 3AZLA 1U35A 1P3FB 4Z2MG 5CPJD 4J8UB 2CV5C 3MVDB 3B0CT 5B31D 3B6FD 5AV8A 4QLCC 1P3MA 4Z5TB 5DNMC 4NE5A 3O62A 3AZKB 5BO0A 5CPID 3AZLC 5AV6A 5B0YC 2HUEB 3AZNC 5AV9D 3NQUA 5B2IC 2FJ7B 4G91B 3REKD 3AZHD 3AZJB 3UTAD 2HIOA 4J8WD 3MGPB 1ID3C 3KWQB 4NE6A 5CPJC 2PYOA 3REIA 3AFAB 5AV6C 3B0DC 1KX3B 5B32B 5B31C 4XUJB 3B6FC 3WTPB 5BNVA 3WTPE 3W99B 4R8PD 4J8XD 4LD9A 4G92C 4KUDA 4WU9B 4ZUXC 5AV9C 4EO5C 1EQZA 3LJAA 5AVCB 4XZQC 3WA9A 3UTBA 3UTAC 3X1VA 1B6WA 1KX4C 5CP6D 3LELB 1KU5A 3LZ1D 1BFMA 3A6ND 4H9NB 3VH6T 3AZGD 1ZLAA 4R8PC 3UTBC 1S32A 3AZIC 2YFWA 5B33B 5JRGB 1F66A 3C1CC 1ZLAC 5CP6C 3X1TA 3LZ0B 3AV2A 3LZ1C 4H9QA 5DNNA 4KGCA 1N1JA 5B1LA 3A6NC 4J8UD 5B0ZA 3MVDD 5GT0A 5B1MA 3VH5W 1HQ3A 4Z5TD 2CV5B 3C1BC 3AZKD 1TAFA 2FJ7D 4QLCB 1M18A 3AZLB 3AZJD 3MNNA 5B2IB 3MGPD 3AZFA 3KWQD 1H3OB 5G49A 3B6GA 4YS3C 3AFAD 1KX3D 5B32D 4KHAA 3WTPD 3WKJD 1ID3B 3W99D 3O62B 3WAAA 3AZKC 5AV6B 4YM6A 3B0DB 1P3LD 4WU9D 3B6FB 3REHA 2HUEC 2FJ7C 2YFVA 3KXBA 3REJA 4Z2MH 5AVCD 4G92B 4ZUXB 4EO5B 3REIB 4YM6C 4XZQB 3LELD 2IO5B 3AFAC 5BNVB 3UTAB 1JFIA 3UT9A 1KX4B 3WKJC 3MGRA 3AN2A 2CWEA 1P3LC 3WA9B 3UTBB 4Z66A 5B33D 3KUYA 5JRGD 4J8VA 3X1VB 1KX5C 3AZIB 1P3AC 3LZ0D 1Q9CA 5BT1C 3C1CB 1ZLAB 1TZYA 5CP6B 3LZ1B 3X1UA 3A6NB 5AVBC 5GXQD 2CV5D 1F66B 5JRGC 4DRAA 4QLCD 4E45A 3C1BB 1P3PA 4H9QB 4X23C 4H9RB 3AZLD 4KGCB 1N1JB 5B1LB 5B2ID 2F8NG 4H9PA 1HQ3B 3W98C 5AV5A 3AZMA 1P3MD 1ID3D 3O62D 5GXQC 4YS3B 4HGAC 5AV6D 1TAFB 5F99A 3AYWA 1BH8A 4JJNC 3AV1A 1WWSA 1M18B 1P3IA 3MNNB 1U35C 3X1SA 4ZUXD 3B6GB 4CAYA 3REID 4XZQD 4KHAB 5AV8C 4WNNA 3AV1C 1P3MC 1P3OA 1KX4D 3O62C 3B0CW 4NE3A 4YM6B 2F8NA 3REHB 3KXBB 3WKJB 4H9OB 3MGQA 3WA9D 2BYKB 3UTBD 4ZBJB 3X1VD 2HIOC 1R4VA 1P3LB 5KDMB 1P3BA 3AZID 2PYOC 3REIC 1M1AA 2IO5C 1P3GA 3UT9B 3C1CD 1KX5B 3MGRB 1ZLAD 1P34A 4WU8A 1P3AB 4LD9C 1S32D 4KUDC 1B67A 3AZEA 1EQZC 3LJAC 3NQJB 3KUYB 5C3IC 3WA9C 1F66D 2F8NK 3REKA 3X1VC 5JA4B 5GSUA 5AVBB 4J8WA 3C1BD 3X1TD 3AV2D 5AY8A 4KGCD 3TU4A 5B1LD 5B0ZD 2RVQC 4H9SA 5BS7A 4X23B 5B1MD 4J8XA 1S32C 1HQ3D 3VH6W 5GSUC 5AY8C 4YS3D 1F66C 3W98B 5FUGA 1ULYA 5E5AA 5GXQB 4WV4B 4HGAB 5BS7C 3X1TC 3AV2C 1M19A 3MNND 1M18D 5DNNC 4UUZA 3AZFD 4JJNB 5B1LC 4KGCC 5B0ZC 3B6GD 5GT0C 3AZGA 5AV5B 3AZMB 5B1MC 3MGSA 1U35B 1HQ3C 4YM6D 3AYWB 1BH8B 5AV8B 3REHD 3KXBD 3AV1B 1P3MB 5BO0B 1M18C 3X1SB 3MNNC 3NQUB 5B2JA 3AZFC 4M6BA 3B6GC 1P3FA 4J8UA 2HIOB 3UT9D 1KX5D 3MGRD 2PYOB 3WAAC 2F8NB 1P3AD 3W97A 3REHC 4NFTA 5BT1D 3KXBC 3REJC 3MGQB 1AOIA 3KUYD 4LD9B 4KUDB 4ZBJC 1P3BB 3AZJA 3LJAB 1EQZB 1M1AB 5AVBD 5C3IB 3MGPA 3KWQA 3UT9C 1P34B 1TZYD 5B32A 4XUJA 3MGRC 3AN2C 3WTPA 1A7WA 3KSYA 3RELA 3W99A 4X23D 3AZEB 4WU9A 1HTAA 4Z66C 3KUYC 5CPKA 1S32B 5AVCA 3W96A 4J8VC 3W98D 1WWIA 5GSUB 2YFWB 5B40A 5AY8B 3RELC 1P3PD 3TU4B 3LELA 4JJND 1P3KA 1TZYC 4H9NA 3X1TB 3W96C 3AV2B 5AV5D 3X1UC 3AZMD 1U35D 5DNNB 5B0ZB 5B40C 2BYMA 5GT0B 5FUGB 3AYWD 5AV8D 5B1MB 5B33A 5E5AB 5B24A 3AV1D 2NZDA 5GT3A 1P3PC 4UUZB 3X1SD 3LZ0A 2AROA 2NQBA 3MGSB 5AV5C 3AZMC 2HIOD 1P3OD 3AZFB 5B31G 5G49B 2PYOD 2F8ND 2CV5A 5F99C 3AYWC 2AROC 2NQBC 3MGQD 3WAAB 4QLCA 4LD9D 1P3IC 5DNMA 4KUDD 3X1SC 2YFVB 3REJB 1P3BD 3AZNA 5B0YA 3LJAD 1EQZD 1M1AD 5B2IA 1P3GD 1H3OA 1P3OC 1P34D 4E44A 4WU8D 3W97B 1ID3A 5CPJA 3AZED 3R45A 1JFIB 1AOIB 5B31A 3AN2B 2RVQD 3MGQC 3B6FA 5CPIA 4CSRA 5GSUD 1P3BC 4ZUXA 5AY8D 4Z66B 5AV9A 1M1AC 4DRBA 4J8VB 3TU4D 1P3GC 3AZHA 4XZQA 1P34C 3UTAA 3RELB 4WU8C 1KX4A 5CPIC 5DNND 3AZEC 1TZYB 5CPKB 1BH9A 5GT0D 3W96B 3REKC 3AZHC 3X1UB 4R8PA 5E5AD 5B40B 4J8WC 1M19D 3AZIA
chains in the Genus database with same CATH superfamily
3TU4C 1P3KB 5BNXA 4H9SC 3C1CA 1P3PB 4J8XC 3H0RC 5CP6A 3MGSD 3LZ1A 2BYMB 3VH5T 3A6NA 4H9PB 3V9RA 5B24B 2NZDB 3H0LC 5CHLB 4WZSB 5E5AC 3H0MC 5GT3B 3B0BA 3WAAD 1M19C 3C1BA 5F99B 5B2JD 3REJD 2AROB 4H9RA 2NQBB 1P3FD 2RIQA 3AZGC 1P3IB 4AWLB 3MGSC 2F8NH 5B32G 4CAYB 3W97D 2L5AA 4WNNB 4YS3A 3MVDA 1P3OB 1AOID 3AN2D 5DNMB 4Z5TA 4UPKA 1F1EA 3AZKA 3P5JB 5B2JC 5B0YB 3AZNB 1P3FC 2FJ7A 4Z66D 4J8UC 4J8VD 3MVDC 4XUJD 3RELD 5CPJB 4Z5TC 3W97C 1P3GB 3R45B 5B31B 3AFAA 1AOIC 5CPKD 1KX3A 4WU8B 4G91C 3WKJA 3W96D 4H9OA 3X1UD 2BYKA 5CPIB 4CSRB 3AZJC 3AL0C 2JSSA 5AV9B 5B40D 1P3LA 3MGPC 3VH6A 3KWQC 5KDMA 3REKB 3AZHB 1P3KD 1KX3C 5B32C 4XUJC 4J8WB 3WTPC 3VH5A 1KX5A 3W99C 2ZY3A 1P3AA 4WU9C 1BH9B 5CPKC 4R8PB 4J8XB 5AVCC 3NQJA 5B24D 2NZDD 5GT3D 2Y2LA 5JA4A 5AVBA 5F99D 3LELC 5BNXB 1P3KC 2AROD 5JRGA 2NQBD 1M19B 1P3ID 2LY8A 4X23A 2Y2QA 3V9RB 3AZGB 5B33C 5B24C 2NZDC 5GT3C 3W98A 5DNMD 5GXQA 1Z2CB 3AZND 5B0YD 3LZ0C 4JJNA 4AWLC 5B2JB 3AZLA 1U35A 1P3FB 4Z2MG 5CPJD 4J8UB 2CV5C 3MVDB 3B0CT 5B31D 3B6FD 5AV8A 4QLCC 1P3MA 4Z5TB 5DNMC 4NE5A 3O62A 3AZKB 5BO0A 5CPID 3AZLC 5AV6A 5B0YC 2HUEB 3AZNC 5AV9D 3NQUA 5B2IC 2FJ7B 4G91B 3REKD 3AZHD 3AZJB 3UTAD 2HIOA 4J8WD 3MGPB 1ID3C 3KWQB 4NE6A 5CPJC 2PYOA 3REIA 3AFAB 5AV6C 2Y2HA 3B0DC 1KX3B 5B32B 5B31C 4XUJB 3B6FC 3WTPB 5BNVA 3WTPE 3W99B 4R8PD 4J8XD 2DQNC 4LD9A 4G92C 4KUDA 4WU9B 4ZUXC 5AV9C 4EO5C 1EQZA 3LJAA 5AVCB 4XZQC 3WA9A 3UTBA 2Y2JA 3UTAC 3X1VA 2W8SA 1B6WA 1KX4C 5CP6D 3LELB 1KU5A 3LZ1D 1BFMA 3A6ND 4H9NB 3VH6T 3AZGD 1ZLAA 4R8PC 3UTBC 1S32A 3AZIC 2YFWA 5B33B 5JRGB 1F66A 2JCHA 3C1CC 3EPKA 1ZLAC 5CP6C 2BG1A 3X1TA 3LZ0B 3AV2A 3LZ1C 4H9QA 5DNNA 4KGCA 1N1JA 5B1LA 3A6NC 4J8UD 5B0ZA 3MVDD 5GT0A 5B1MA 3VH5W 1HQ3A 4Z5TD 2CV5B 3C1BC 3AZKD 1TAFA 2FJ7D 4QLCB 1M18A 3AZLB 3AZJD 3MNNA 5B2IB 3MGPD 3AZFA 3KWQD 1H3OB 5G49A 3B6GA 4YS3C 3AFAD 1T3UA 1KX3D 5B32D 4KHAA 3WTPD 3WKJD 1ID3B 3W99D 3O62B 3WAAA 3AZKC 5AV6B 4YM6A 3B0DB 1P3LD 4WU9D 3B6FB 3REHA 2HUEC 2FJ7C 2YFVA 3KXBA 3REJA 4Z2MH 5AVCD 4G92B 4ZUXB 4EO5B 3REIB 4YM6C 4XZQB 3LELD 2IO5B 3AFAC 5BNVB 3UTAB 1JFIA 3UT9A 1KX4B 3WKJC 3MGRA 3AN2A 2CWEA 1P3LC 3WA9B 3UTBB 4Z66A 5B33D 3KUYA 5JRGD 4J8VA 3X1VB 3A1IA 1KX5C 3AZIB 1P3AC 3LZ0D 1Q9CA 2Y2GA 5BT1C 3C1CB 1ZLAB 1TZYA 5CP6B 3LZ1B 3X1UA 3A6NB 5AVBC 3EG5B 5GXQD 2CV5D 1F66B 5JRGC 4DRAA 4QLCD 4E45A 3C1BB 1P3PA 4H9QB 4X23C 4H9RB 3AZLD 4KGCB 1N1JB 5B1LB 5B2ID 1PZRA 2F8NG 4H9PA 1HQ3B 3EPLA 5AV5A 3AZMA 1P3MD 3W98C 1ID3D 3O62D 5GXQC 4YS3B 4HGAC 5AV6D 1TAFB 2G5IC 5F99A 3AYWA 1BH8A 4JJNC 3AV1A 2Y2KA 1WWSA 1M18B 1P3IA 3MNNB 3EPJA 1U35C 2Y2NA 3X1SA 4ZUXD 3B6GB 4CAYA 2G5HC 3REID 4XZQD 4KHAB 5AV8C 4WNNA 3AV1C 1P3MC 1P3OA 1KX4D 3O62C 3B0CW 4NE3A 4YM6B 2F8NA 2XD1A 3REHB 3A1KA 3KXBB 3WKJB 4H9OB 3MGQA 3WA9D 2BYKB 3UTBD 2ZY2A 4ZBJB 3X1VD 2HIOC 1R4VA 1P3LB 5KDMB 1P3BA 3AZID 2UWXA 2PYOC 3REIC 1M1AA 2IO5C 1P3GA 3UT9B 3C1CD 1KX5B 3MGRB 1ZLAD 1P34A 4WU8A 1P3AB 4LD9C 1S32D 4KUDC 1B67A 3AZEA 1EQZC 3LJAC 3NQJB 3KUYB 5C3IC 3WA9C 1F66D 2F8NK 3REKA 3X1VC 5JA4B 5GSUA 5AVBB 4J8WA 3C1BD 3X1TD 3AV2D 5AY8A 4KGCD 3TU4A 5B1LD 5B0ZD 2RVQC 2Y2PA 4H9SA 5BS7A 4X23B 5B1MD 4J8XA 1S32C 1HQ3D 3VH6W 5GSUC 5AY8C 4YS3D 1F66C 3W98B 5FUGA 1ULYA 5E5AA 5GXQB 4WV4B 4HGAB 5BS7C 3X1TC 3AV2C 1M19A 3MNND 1M18D 5DNNC 4UUZA 3AZFD 4JJNB 5B1LC 4KGCC 5B0ZC 3B6GD 5GT0C 3AZGA 5AV5B 3AZMB 5B1MC 3MGSA 1U35B 1HQ3C 4YM6D 3AYWB 1BH8B 5AV8B 3REHD 3KXBD 3AV1B 1P3MB 3KFUG 5BO0B 3IP4C 1M18C 3X1SB 3MNNC 3EPHA 3NQUB 5B2JA 3AZFC 4M6BA 3B6GC 1P3FA 4J8UA 2ZM5A 2HIOB 3UT9D 1KX5D 3MGRD 2PYOB 3WAAC 2F8NB 1P3AD 3W97A 2Y2MA 3REHC 4NFTA 5BT1D 3KXBC 3REJC 3MGQB 1AOIA 3KUYD 4LD9B 4KUDB 4ZBJC 1P3BB 3AZJA 3LJAB 1EQZB 3F6TA 5AVBD 1M1AB 5C3IB 3MGPA 3KWQA 3UT9C 1P34B 4WJ3C 1TZYD 5B32A 4XUJA 2FFFB 3MGRC 3WTPA 3AN2C 1A7WA 3KSYA 3RELA 3W99A 2XD5A 4X23D 3AZEB 4WU9A 1HTAA 4Z66C 2Y2IA 3KUYC 5CPKA 1S32B 5AVCA 3W96A 4J8VC 3W98D 1WWIA 5GSUB 2YFWB 5B40A 5AY8B 3RELC 1P3PD 3TU4B 3LELA 4JJND 1P3KA 1TZYC 4H9NA 3X1TB 3W96C 3AV2B 5AV5D 3X1UC 3AZMD 1U35D 5DNNB 5B0ZB 5B40C 2Y2OA 2BYMA 5GT0B 2J8PA 5FUGB 5AV8D 5B1MB 3AYWD 5B33A 5E5AB 5B24A 3AV1D 2NZDA 5GT3A 3FDDA 1P3PC 4UUZB 3X1SD 3LZ0A 2AROA 2NQBA 3MGSB 1W2EA 5AV5C 3AZMC 2HIOD 1P3OD 3AZFB 5B31G 5G49B 2PYOD 2F8ND 2CV5A 5F99C 3AYWC 2AROC 2NQBC 3MGQD 3WAAB 4QLCA 4LD9D 1P3IC 5DNMA 4KUDD 3X1SC 2YFVB 3REJB 4DQYB 3AZNA 5B0YA 3LJAD 1P3BD 1EQZD 1M1AD 5B2IA 2ZY5A 1P3GD 1H3OA 1P3OC 1P34D 4E44A 4WU8D 3W97B 1ID3A 5CPJA 2ZY4A 2DF4C 2JE5A 3R45A 3AZED 1JFIB 1AOIB 5B31A 3AN2B 2RVQD 3MGQC 3B6FA 5CPIA 4CSRA 5GSUD 1P3BC 4ZUXA 5AY8D 4Z66B 5AV9A 1M1AC 4DRBA 4J8VB 3TU4D 1P3GC 3AZHA 4XZQA 1P34C 3UTAA 3RELB 4WU8C 1KX4A 5CPIC 5DNND 3AZEC 2F2AC 1TZYB 5CPKB 1BH9A 5GT0D 3W96B 3REKC 3AZHC 3X1UB 4R8PA 5E5AD 2VQRA 5B40B 4J8WC 1M19D 3AZIA
chains in the Genus database with same CATH topology
3TU4C 1P3KB 5BNXA 4H9SC 3C1CA 1P3PB 4J8XC 3H0RC 5CP6A 3MGSD 3LZ1A 2BYMB 3VH5T 3A6NA 4H9PB 3V9RA 5B24B 2NZDB 3H0LC 5CHLB 4WZSB 5E5AC 3H0MC 5GT3B 3B0BA 3WAAD 1M19C 3C1BA 5F99B 5B2JD 3REJD 2AROB 4H9RA 2NQBB 1P3FD 2RIQA 3AZGC 1P3IB 4AWLB 3MGSC 2F8NH 5B32G 4CAYB 3W97D 2L5AA 4WNNB 4YS3A 3MVDA 1P3OB 1AOID 3AN2D 5DNMB 4Z5TA 4UPKA 1F1EA 3AZKA 3P5JB 5B2JC 5B0YB 3AZNB 1P3FC 2FJ7A 4Z66D 4J8UC 4J8VD 3MVDC 4XUJD 3RELD 5CPJB 4Z5TC 3W97C 1P3GB 3R45B 5B31B 3AFAA 1AOIC 5CPKD 1KX3A 4WU8B 4G91C 3WKJA 3W96D 4H9OA 3X1UD 2BYKA 5CPIB 4CSRB 3AZJC 3AL0C 2JSSA 5AV9B 5B40D 1P3LA 3MGPC 3VH6A 3KWQC 5KDMA 3REKB 3AZHB 1P3KD 1KX3C 5B32C 4XUJC 4J8WB 3WTPC 3VH5A 1KX5A 3W99C 2ZY3A 1P3AA 4WU9C 1BH9B 5CPKC 4R8PB 4J8XB 5AVCC 3NQJA 5B24D 2NZDD 5GT3D 2Y2LA 5JA4A 5AVBA 5F99D 3LELC 5BNXB 1P3KC 2AROD 5JRGA 2NQBD 1M19B 1P3ID 2LY8A 4X23A 2Y2QA 3V9RB 3AZGB 5B33C 5B24C 2NZDC 5GT3C 3W98A 5DNMD 5GXQA 1Z2CB 3AZND 5B0YD 3LZ0C 4JJNA 4AWLC 5B2JB 3AZLA 1U35A 1P3FB 4Z2MG 5CPJD 4J8UB 2CV5C 3MVDB 3B0CT 5B31D 3B6FD 5AV8A 4QLCC 1P3MA 4Z5TB 5DNMC 4NE5A 3O62A 3AZKB 5BO0A 5CPID 3AZLC 5AV6A 5B0YC 2HUEB 3AZNC 5AV9D 3NQUA 5B2IC 2FJ7B 4G91B 3REKD 3AZHD 3AZJB 3UTAD 2HIOA 4J8WD 3MGPB 1ID3C 3KWQB 4NE6A 5CPJC 2PYOA 3REIA 3AFAB 5AV6C 2Y2HA 3B0DC 1KX3B 5B32B 5B31C 4XUJB 3B6FC 3WTPB 5BNVA 3WTPE 3W99B 4R8PD 4J8XD 2DQNC 4LD9A 4G92C 4KUDA 4WU9B 4ZUXC 5AV9C 4EO5C 1EQZA 3LJAA 5AVCB 4XZQC 3WA9A 3UTBA 2Y2JA 3UTAC 3X1VA 2W8SA 1B6WA 1KX4C 5CP6D 3LELB 1KU5A 3LZ1D 1BFMA 3A6ND 4H9NB 3VH6T 3AZGD 1ZLAA 4R8PC 3UTBC 1S32A 3AZIC 2YFWA 5B33B 5JRGB 1F66A 2JCHA 3C1CC 3EPKA 1ZLAC 5CP6C 2BG1A 3X1TA 3LZ0B 3AV2A 3LZ1C 4H9QA 5DNNA 4KGCA 1N1JA 5B1LA 3A6NC 4J8UD 5B0ZA 3MVDD 5GT0A 5B1MA 3VH5W 1HQ3A 4Z5TD 2CV5B 3C1BC 3AZKD 1TAFA 2FJ7D 4QLCB 1M18A 3AZLB 3AZJD 3MNNA 5B2IB 3MGPD 3AZFA 3KWQD 1H3OB 5G49A 3B6GA 4YS3C 3AFAD 1T3UA 1KX3D 5B32D 4KHAA 3WTPD 3WKJD 1ID3B 3W99D 3O62B 3WAAA 3AZKC 5AV6B 4YM6A 3B0DB 1P3LD 4WU9D 3B6FB 3REHA 2HUEC 2FJ7C 2YFVA 3KXBA 3REJA 4Z2MH 5AVCD 4G92B 4ZUXB 4EO5B 3REIB 4YM6C 4XZQB 3LELD 2IO5B 3AFAC 5BNVB 3UTAB 1JFIA 3UT9A 1KX4B 3WKJC 3MGRA 3AN2A 2CWEA 1P3LC 3WA9B 3UTBB 4Z66A 5B33D 3KUYA 5JRGD 4J8VA 3X1VB 3A1IA 1KX5C 3AZIB 1P3AC 3LZ0D 1Q9CA 2Y2GA 5BT1C 3C1CB 1ZLAB 1TZYA 5CP6B 3LZ1B 3X1UA 3A6NB 5AVBC 3EG5B 5GXQD 2CV5D 1F66B 5JRGC 4DRAA 4QLCD 4E45A 3C1BB 1P3PA 4H9QB 4X23C 4H9RB 3AZLD 4KGCB 1N1JB 5B1LB 5B2ID 1PZRA 2F8NG 4H9PA 1HQ3B 3EPLA 5AV5A 3AZMA 1P3MD 3W98C 1ID3D 3O62D 5GXQC 4YS3B 4HGAC 5AV6D 1TAFB 2G5IC 5F99A 3AYWA 1BH8A 4JJNC 3AV1A 2Y2KA 1WWSA 1M18B 1P3IA 3MNNB 3EPJA 1U35C 2Y2NA 3X1SA 4ZUXD 3B6GB 4CAYA 2G5HC 3REID 4XZQD 4KHAB 5AV8C 4WNNA 3AV1C 1P3MC 1P3OA 1KX4D 3O62C 3B0CW 4NE3A 4YM6B 2F8NA 2XD1A 3REHB 3A1KA 3KXBB 3WKJB 4H9OB 3MGQA 3WA9D 2BYKB 3UTBD 2ZY2A 4ZBJB 3X1VD 2HIOC 1R4VA 1P3LB 5KDMB 1P3BA 3AZID 2UWXA 2PYOC 3REIC 1M1AA 2IO5C 1P3GA 3UT9B 3C1CD 1KX5B 3MGRB 1ZLAD 1P34A 4WU8A 1P3AB 4LD9C 1S32D 4KUDC 1B67A 3AZEA 1EQZC 3LJAC 3NQJB 3KUYB 5C3IC 3WA9C 1F66D 2F8NK 3REKA 3X1VC 5JA4B 5GSUA 5AVBB 4J8WA 3C1BD 3X1TD 3AV2D 5AY8A 4KGCD 3TU4A 5B1LD 5B0ZD 2RVQC 2Y2PA 4H9SA 5BS7A 4X23B 5B1MD 4J8XA 1S32C 1HQ3D 3VH6W 5GSUC 5AY8C 4YS3D 1F66C 3W98B 5FUGA 1ULYA 5E5AA 5GXQB 4WV4B 4HGAB 5BS7C 3X1TC 3AV2C 1M19A 3MNND 1M18D 5DNNC 4UUZA 3AZFD 4JJNB 5B1LC 4KGCC 5B0ZC 3B6GD 5GT0C 3AZGA 5AV5B 3AZMB 5B1MC 3MGSA 1U35B 1HQ3C 4YM6D 3AYWB 1BH8B 5AV8B 3REHD 3KXBD 3AV1B 1P3MB 3KFUG 5BO0B 3IP4C 1M18C 3X1SB 3MNNC 3EPHA 3NQUB 5B2JA 3AZFC 4M6BA 3B6GC 1P3FA 4J8UA 2ZM5A 2HIOB 3UT9D 1KX5D 3MGRD 2PYOB 3WAAC 2F8NB 1P3AD 3W97A 2Y2MA 3REHC 4NFTA 5BT1D 3KXBC 3REJC 3MGQB 1AOIA 3KUYD 4LD9B 4KUDB 4ZBJC 1P3BB 3AZJA 3LJAB 1EQZB 3F6TA 5AVBD 1M1AB 5C3IB 3MGPA 3KWQA 3UT9C 1P34B 4WJ3C 1TZYD 5B32A 4XUJA 2FFFB 3MGRC 3WTPA 3AN2C 1A7WA 3KSYA 3RELA 3W99A 2XD5A 4X23D 3AZEB 4WU9A 1HTAA 4Z66C 2Y2IA 3KUYC 5CPKA 1S32B 5AVCA 3W96A 4J8VC 3W98D 1WWIA 5GSUB 2YFWB 5B40A 5AY8B 3RELC 1P3PD 3TU4B 3LELA 4JJND 1P3KA 1TZYC 4H9NA 3X1TB 3W96C 3AV2B 5AV5D 3X1UC 3AZMD 1U35D 5DNNB 5B0ZB 5B40C 2Y2OA 2BYMA 5GT0B 2J8PA 5FUGB 5AV8D 5B1MB 3AYWD 5B33A 5E5AB 5B24A 3AV1D 2NZDA 5GT3A 3FDDA 1P3PC 4UUZB 3X1SD 3LZ0A 2AROA 2NQBA 3MGSB 1W2EA 5AV5C 3AZMC 2HIOD 1P3OD 3AZFB 5B31G 5G49B 2PYOD 2F8ND 2CV5A 5F99C 3AYWC 2AROC 2NQBC 3MGQD 3WAAB 4QLCA 4LD9D 1P3IC 5DNMA 4KUDD 3X1SC 2YFVB 3REJB 4DQYB 3AZNA 5B0YA 3LJAD 1P3BD 1EQZD 1M1AD 5B2IA 2ZY5A 1P3GD 1H3OA 1P3OC 1P34D 4E44A 4WU8D 3W97B 1ID3A 5CPJA 2ZY4A 2DF4C 2JE5A 3R45A 3AZED 1JFIB 1AOIB 5B31A 3AN2B 2RVQD 3MGQC 3B6FA 5CPIA 4CSRA 5GSUD 1P3BC 4ZUXA 5AY8D 4Z66B 5AV9A 1M1AC 4DRBA 4J8VB 3TU4D 1P3GC 3AZHA 4XZQA 1P34C 3UTAA 3RELB 4WU8C 1KX4A 5CPIC 5DNND 3AZEC 2F2AC 1TZYB 5CPKB 1BH9A 5GT0D 3W96B 3REKC 3AZHC 3X1UB 4R8PA 5E5AD 2VQRA 5B40B 4J8WC 1M19D 3AZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 C;  1P3K B;  5BNX A;  4H9S C;  3C1C A;  1P3P B;  4J8X C;  3MGS D;  5CP6 A;  3LZ1 A;  2BYM B;  3VH5 T;  3A6N A;  4H9P B;  3V9R A;  5B24 B;  2NZD B;  5CHL B;  4WZS B;  5E5A C;  5GT3 B;  3B0B A;  3WAA D;  1M19 C;  3C1B A;  5F99 B;  5B2J D;  3REJ D;  2ARO B;  4H9R A;  2NQB B;  1P3F D;  3AZG C;  1P3I B;  4AWL B;  3MGS C;  2F8N H;  5B32 G;  4CAY B;  3W97 D;  2L5A A;  4WNN B;  4YS3 A;  3MVD A;  1P3O B;  1AOI D;  3AN2 D;  5DNM B;  4Z5T A;  1F1E A;  3AZK A;  5B0Y B;  5B2J C;  3AZN B;  1P3F C;  2FJ7 A;  4Z66 D;  4J8U C;  4J8V D;  3MVD C;  4XUJ D;  3REL D;  5CPJ B;  4Z5T C;  3W97 C;  1P3G B;  3R45 B;  5B31 B;  3AFA A;  1AOI C;  5CPK D;  1KX3 A;  4WU8 B;  4G91 C;  3WKJ A;  3W96 D;  4H9O A;  3X1U D;  2BYK A;  5CPI B;  4CSR B;  3AZJ C;  2JSS A;  5AV9 B;  5B40 D;  1P3L A;  3MGP C;  3VH6 A;  3KWQ C;  5KDM A;  3REK B;  3AZH B;  1P3K D;  1KX3 C;  5B32 C;  4XUJ C;  4J8W B;  3WTP C;  3VH5 A;  1KX5 A;  3W99 C;  1P3A A;  4WU9 C;  1BH9 B;  5CPK C;  4R8P B;  4J8X B;  5AVC C;  3NQJ A;  5B24 D;  2NZD D;  5GT3 D;  5JA4 A;  5AVB A;  5F99 D;  3LEL C;  5BNX B;  1P3K C;  2ARO D;  5JRG A;  2NQB D;  1M19 B;  1P3I D;  2LY8 A;  4X23 A;  3AZG B;  3V9R B;  5B33 C;  5B24 C;  2NZD C;  5GT3 C;  3W98 A;  5DNM D;  5GXQ A;  3AZN D;  5B0Y D;  3LZ0 C;  4JJN A;  4AWL C;  5B2J B;  3AZL A;  1U35 A;  1P3F B;  4Z2M G;  5CPJ D;  4J8U B;  2CV5 C;  3MVD B;  3B0C T;  5B31 D;  3B6F D;  5AV8 A;  4QLC C;  1P3M A;  4Z5T B;  5DNM C;  4NE5 A;  3O62 A;  3AZK B;  5BO0 A;  5CPI D;  3AZL C;  5AV6 A;  5B0Y C;  2HUE B;  3AZN C;  5AV9 D;  3NQU A;  5B2I C;  2FJ7 B;  4G91 B;  3REK D;  3AZH D;  3AZJ B;  3UTA D;  2HIO A;  4J8W D;  3MGP B;  1ID3 C;  3KWQ B;  4NE6 A;  5CPJ C;  2PYO A;  3REI A;  3AFA B;  5AV6 C;  3B0D C;  1KX3 B;  5B32 B;  5B31 C;  4XUJ B;  3B6F C;  3WTP B;  5BNV A;  3WTP E;  3W99 B;  4R8P D;  4J8X D;  4LD9 A;  4G92 C;  4KUD A;  4WU9 B;  4ZUX C;  5AV9 C;  4EO5 C;  1EQZ A;  3LJA A;  5AVC B;  4XZQ C;  3WA9 A;  3UTB A;  3UTA C;  3X1V A;  1B6W A;  1KX4 C;  5CP6 D;  3LEL B;  1KU5 A;  3LZ1 D;  1BFM A;  3A6N D;  4H9N B;  3VH6 T;  3AZG D;  1ZLA A;  4R8P C;  3UTB C;  1S32 A;  3AZI C;  2YFW A;  5B33 B;  5JRG B;  1F66 A;  3C1C C;  1ZLA C;  5CP6 C;  3X1T A;  3LZ0 B;  3AV2 A;  3LZ1 C;  4H9Q A;  5DNN A;  4KGC A;  1N1J A;  5B1L A;  3A6N C;  4J8U D;  5B0Z A;  3MVD D;  5GT0 A;  5B1M A;  3VH5 W;  1HQ3 A;  4Z5T D;  2CV5 B;  3C1B C;  3AZK D;  1TAF A;  2FJ7 D;  4QLC B;  1M18 A;  3AZL B;  3AZJ D;  3MNN A;  5B2I B;  3MGP D;  3AZF A;  3KWQ D;  1H3O B;  5G49 A;  3B6G A;  4YS3 C;  3AFA D;  1KX3 D;  5B32 D;  4KHA A;  3WTP D;  3WKJ D;  1ID3 B;  3W99 D;  3O62 B;  3WAA A;  3AZK C;  5AV6 B;  4YM6 A;  3B0D B;  1P3L D;  4WU9 D;  3B6F B;  3REH A;  2HUE C;  2FJ7 C;  2YFV A;  3KXB A;  3REJ A;  4Z2M H;  5AVC D;  4G92 B;  4ZUX B;  4EO5 B;  3REI B;  4YM6 C;  4XZQ B;  3LEL D;  2IO5 B;  3AFA C;  5BNV B;  3UTA B;  1JFI A;  3UT9 A;  1KX4 B;  3WKJ C;  3MGR A;  3AN2 A;  2CWE A;  1P3L C;  3WA9 B;  3UTB B;  4Z66 A;  5B33 D;  3KUY A;  5JRG D;  4J8V A;  3X1V B;  1KX5 C;  3AZI B;  1P3A C;  3LZ0 D;  1Q9C A;  5BT1 C;  3C1C B;  1ZLA B;  1TZY A;  5CP6 B;  3LZ1 B;  3X1U A;  3A6N B;  5AVB C;  5GXQ D;  2CV5 D;  1F66 B;  5JRG C;  4DRA A;  4QLC D;  4E45 A;  3C1B B;  1P3P A;  4H9Q B;  4X23 C;  4H9R B;  3AZL D;  4KGC B;  1N1J B;  5B1L B;  5B2I D;  2F8N G;  4H9P A;  1HQ3 B;  3W98 C;  5AV5 A;  3AZM A;  1P3M D;  1ID3 D;  3O62 D;  5GXQ C;  4YS3 B;  4HGA C;  5AV6 D;  1TAF B;  5F99 A;  3AYW A;  1BH8 A;  4JJN C;  3AV1 A;  1WWS A;  1M18 B;  1P3I A;  3MNN B;  1U35 C;  3X1S A;  4ZUX D;  3B6G B;  4CAY A;  3REI D;  4XZQ D;  4KHA B;  5AV8 C;  4WNN A;  3AV1 C;  1P3M C;  1P3O A;  1KX4 D;  3O62 C;  3B0C W;  4NE3 A;  4YM6 B;  2F8N A;  3REH B;  3KXB B;  3WKJ B;  4H9O B;  3MGQ A;  3WA9 D;  2BYK B;  3UTB D;  4ZBJ B;  3X1V D;  2HIO C;  1R4V A;  1P3L B;  5KDM B;  1P3B A;  3AZI D;  2PYO C;  3REI C;  1M1A A;  2IO5 C;  1P3G A;  3UT9 B;  3C1C D;  1KX5 B;  3MGR B;  1ZLA D;  1P34 A;  4WU8 A;  1P3A B;  4LD9 C;  1S32 D;  4KUD C;  1B67 A;  3AZE A;  1EQZ C;  3LJA C;  3NQJ B;  3KUY B;  5C3I C;  3WA9 C;  1F66 D;  2F8N K;  3REK A;  3X1V C;  5JA4 B;  5GSU A;  5AVB B;  4J8W A;  3C1B D;  3X1T D;  3AV2 D;  5AY8 A;  4KGC D;  3TU4 A;  5B1L D;  5B0Z D;  2RVQ C;  4H9S A;  5BS7 A;  4X23 B;  5B1M D;  4J8X A;  1S32 C;  1HQ3 D;  3VH6 W;  5GSU C;  5AY8 C;  4YS3 D;  1F66 C;  3W98 B;  5FUG A;  1ULY A;  5E5A A;  5GXQ B;  4WV4 B;  4HGA B;  5BS7 C;  3X1T C;  3AV2 C;  1M19 A;  3MNN D;  1M18 D;  5DNN C;  4UUZ A;  3AZF D;  4JJN B;  5B1L C;  4KGC C;  5B0Z C;  3B6G D;  5GT0 C;  3AZG A;  5AV5 B;  3AZM B;  5B1M C;  3MGS A;  1U35 B;  1HQ3 C;  4YM6 D;  3AYW B;  1BH8 B;  5AV8 B;  3REH D;  3KXB D;  3AV1 B;  1P3M B;  5BO0 B;  1M18 C;  3X1S B;  3MNN C;  3NQU B;  5B2J A;  3AZF C;  4M6B A;  3B6G C;  1P3F A;  4J8U A;  2HIO B;  3UT9 D;  1KX5 D;  3MGR D;  2PYO B;  3WAA C;  2F8N B;  1P3A D;  3W97 A;  3REH C;  4NFT A;  5BT1 D;  3KXB C;  3REJ C;  3MGQ B;  1AOI A;  3KUY D;  4LD9 B;  4KUD B;  4ZBJ C;  1P3B B;  3AZJ A;  3LJA B;  1EQZ B;  1M1A B;  5AVB D;  5C3I B;  3MGP A;  3KWQ A;  3UT9 C;  1P34 B;  1TZY D;  5B32 A;  4XUJ A;  3MGR C;  3AN2 C;  3WTP A;  1A7W A;  3KSY A;  3REL A;  3W99 A;  4X23 D;  3AZE B;  4WU9 A;  1HTA A;  4Z66 C;  3KUY C;  5CPK A;  1S32 B;  5AVC A;  3W96 A;  4J8V C;  3W98 D;  1WWI A;  5GSU B;  2YFW B;  5B40 A;  5AY8 B;  3REL C;  1P3P D;  3TU4 B;  3LEL A;  4JJN D;  1P3K A;  1TZY C;  4H9N A;  3X1T B;  3W96 C;  3AV2 B;  5AV5 D;  3X1U C;  3AZM D;  1U35 D;  5DNN B;  5B0Z B;  5B40 C;  2BYM A;  5GT0 B;  5FUG B;  3AYW D;  5AV8 D;  5B1M B;  5B33 A;  5E5A B;  5B24 A;  3AV1 D;  2NZD A;  5GT3 A;  1P3P C;  4UUZ B;  3X1S D;  3LZ0 A;  2ARO A;  2NQB A;  3MGS B;  5AV5 C;  3AZM C;  2HIO D;  1P3O D;  3AZF B;  5B31 G;  5G49 B;  2PYO D;  2F8N D;  2CV5 A;  5F99 C;  3AYW C;  2ARO C;  2NQB C;  3MGQ D;  3WAA B;  4QLC A;  4LD9 D;  1P3I C;  5DNM A;  4KUD D;  3X1S C;  2YFV B;  3REJ B;  1P3B D;  3AZN A;  5B0Y A;  3LJA D;  1EQZ D;  1M1A D;  5B2I A;  1P3G D;  1H3O A;  1P3O C;  1P34 D;  4E44 A;  4WU8 D;  3W97 B;  1ID3 A;  5CPJ A;  3AZE D;  3R45 A;  1JFI B;  1AOI B;  5B31 A;  3AN2 B;  2RVQ D;  3MGQ C;  3B6F A;  5CPI A;  4CSR A;  5GSU D;  1P3B C;  4ZUX A;  5AY8 D;  4Z66 B;  5AV9 A;  1M1A C;  4DRB A;  4J8V B;  3TU4 D;  1P3G C;  3AZH A;  4XZQ A;  1P34 C;  3UTA A;  3REL B;  4WU8 C;  1KX4 A;  5CPI C;  5DNN D;  3AZE C;  1TZY B;  5CPK B;  1BH9 A;  5GT0 D;  3W96 B;  3REK C;  3AZH C;  3X1U B;  4R8P A;  5E5A D;  5B40 B;  4J8W C;  1M19 D;  3AZI A; 
#chains in the Genus database with same CATH topology
 3TU4 C;  1P3K B;  5BNX A;  4H9S C;  3C1C A;  1P3P B;  4J8X C;  3H0R C;  5CP6 A;  3MGS D;  3LZ1 A;  2BYM B;  3VH5 T;  3A6N A;  4H9P B;  3V9R A;  5B24 B;  2NZD B;  3H0L C;  5CHL B;  4WZS B;  5E5A C;  3H0M C;  5GT3 B;  3B0B A;  3WAA D;  1M19 C;  3C1B A;  5F99 B;  5B2J D;  3REJ D;  2ARO B;  4H9R A;  2NQB B;  1P3F D;  2RIQ A;  3AZG C;  1P3I B;  4AWL B;  3MGS C;  2F8N H;  5B32 G;  4CAY B;  3W97 D;  2L5A A;  4WNN B;  4YS3 A;  3MVD A;  1P3O B;  1AOI D;  3AN2 D;  5DNM B;  4Z5T A;  4UPK A;  1F1E A;  3AZK A;  3P5J B;  5B2J C;  5B0Y B;  3AZN B;  1P3F C;  2FJ7 A;  4Z66 D;  4J8U C;  4J8V D;  3MVD C;  4XUJ D;  3REL D;  5CPJ B;  4Z5T C;  3W97 C;  1P3G B;  3R45 B;  5B31 B;  3AFA A;  1AOI C;  5CPK D;  1KX3 A;  4WU8 B;  4G91 C;  3WKJ A;  3W96 D;  4H9O A;  3X1U D;  2BYK A;  5CPI B;  4CSR B;  3AZJ C;  3AL0 C;  2JSS A;  5AV9 B;  5B40 D;  1P3L A;  3MGP C;  3VH6 A;  3KWQ C;  5KDM A;  3REK B;  3AZH B;  1P3K D;  1KX3 C;  5B32 C;  4XUJ C;  4J8W B;  3WTP C;  3VH5 A;  1KX5 A;  3W99 C;  2ZY3 A;  1P3A A;  4WU9 C;  1BH9 B;  5CPK C;  4R8P B;  4J8X B;  5AVC C;  3NQJ A;  5B24 D;  2NZD D;  5GT3 D;  2Y2L A;  5JA4 A;  5AVB A;  5F99 D;  3LEL C;  5BNX B;  1P3K C;  2ARO D;  5JRG A;  2NQB D;  1M19 B;  1P3I D;  2LY8 A;  4X23 A;  2Y2Q A;  3V9R B;  3AZG B;  5B33 C;  5B24 C;  2NZD C;  5GT3 C;  3W98 A;  5DNM D;  5GXQ A;  1Z2C B;  3AZN D;  5B0Y D;  3LZ0 C;  4JJN A;  4AWL C;  5B2J B;  3AZL A;  1U35 A;  1P3F B;  4Z2M G;  5CPJ D;  4J8U B;  2CV5 C;  3MVD B;  3B0C T;  5B31 D;  3B6F D;  5AV8 A;  4QLC C;  1P3M A;  4Z5T B;  5DNM C;  4NE5 A;  3O62 A;  3AZK B;  5BO0 A;  5CPI D;  3AZL C;  5AV6 A;  5B0Y C;  2HUE B;  3AZN C;  5AV9 D;  3NQU A;  5B2I C;  2FJ7 B;  4G91 B;  3REK D;  3AZH D;  3AZJ B;  3UTA D;  2HIO A;  4J8W D;  3MGP B;  1ID3 C;  3KWQ B;  4NE6 A;  5CPJ C;  2PYO A;  3REI A;  3AFA B;  5AV6 C;  2Y2H A;  3B0D C;  1KX3 B;  5B32 B;  5B31 C;  4XUJ B;  3B6F C;  3WTP B;  5BNV A;  3WTP E;  3W99 B;  4R8P D;  4J8X D;  2DQN C;  4LD9 A;  4G92 C;  4KUD A;  4WU9 B;  4ZUX C;  5AV9 C;  4EO5 C;  1EQZ A;  3LJA A;  5AVC B;  4XZQ C;  3WA9 A;  3UTB A;  2Y2J A;  3UTA C;  3X1V A;  2W8S A;  1B6W A;  1KX4 C;  5CP6 D;  3LEL B;  1KU5 A;  3LZ1 D;  1BFM A;  3A6N D;  4H9N B;  3VH6 T;  3AZG D;  1ZLA A;  4R8P C;  3UTB C;  1S32 A;  3AZI C;  2YFW A;  5B33 B;  5JRG B;  1F66 A;  2JCH A;  3C1C C;  3EPK A;  1ZLA C;  5CP6 C;  2BG1 A;  3X1T A;  3LZ0 B;  3AV2 A;  3LZ1 C;  4H9Q A;  5DNN A;  4KGC A;  1N1J A;  5B1L A;  3A6N C;  4J8U D;  5B0Z A;  3MVD D;  5GT0 A;  5B1M A;  3VH5 W;  1HQ3 A;  4Z5T D;  2CV5 B;  3C1B C;  3AZK D;  1TAF A;  2FJ7 D;  4QLC B;  1M18 A;  3AZL B;  3AZJ D;  3MNN A;  5B2I B;  3MGP D;  3AZF A;  3KWQ D;  1H3O B;  5G49 A;  3B6G A;  4YS3 C;  3AFA D;  1T3U A;  1KX3 D;  5B32 D;  4KHA A;  3WTP D;  3WKJ D;  1ID3 B;  3W99 D;  3O62 B;  3WAA A;  3AZK C;  5AV6 B;  4YM6 A;  3B0D B;  1P3L D;  4WU9 D;  3B6F B;  3REH A;  2HUE C;  2FJ7 C;  2YFV A;  3KXB A;  3REJ A;  4Z2M H;  5AVC D;  4G92 B;  4ZUX B;  4EO5 B;  3REI B;  4YM6 C;  4XZQ B;  3LEL D;  2IO5 B;  3AFA C;  5BNV B;  3UTA B;  1JFI A;  3UT9 A;  1KX4 B;  3WKJ C;  3MGR A;  3AN2 A;  2CWE A;  1P3L C;  3WA9 B;  3UTB B;  4Z66 A;  5B33 D;  3KUY A;  5JRG D;  4J8V A;  3X1V B;  3A1I A;  1KX5 C;  3AZI B;  1P3A C;  3LZ0 D;  1Q9C A;  2Y2G A;  5BT1 C;  3C1C B;  1ZLA B;  1TZY A;  5CP6 B;  3LZ1 B;  3X1U A;  3A6N B;  5AVB C;  3EG5 B;  5GXQ D;  2CV5 D;  1F66 B;  5JRG C;  4DRA A;  4QLC D;  4E45 A;  3C1B B;  1P3P A;  4H9Q B;  4X23 C;  4H9R B;  3AZL D;  4KGC B;  1N1J B;  5B1L B;  5B2I D;  1PZR A;  2F8N G;  4H9P A;  1HQ3 B;  3EPL A;  5AV5 A;  3AZM A;  1P3M D;  3W98 C;  1ID3 D;  3O62 D;  5GXQ C;  4YS3 B;  4HGA C;  5AV6 D;  1TAF B;  2G5I C;  5F99 A;  3AYW A;  1BH8 A;  4JJN C;  3AV1 A;  2Y2K A;  1WWS A;  1M18 B;  1P3I A;  3MNN B;  3EPJ A;  1U35 C;  2Y2N A;  3X1S A;  4ZUX D;  3B6G B;  4CAY A;  2G5H C;  3REI D;  4XZQ D;  4KHA B;  5AV8 C;  4WNN A;  3AV1 C;  1P3M C;  1P3O A;  1KX4 D;  3O62 C;  3B0C W;  4NE3 A;  4YM6 B;  2F8N A;  2XD1 A;  3REH B;  3A1K A;  3KXB B;  3WKJ B;  4H9O B;  3MGQ A;  3WA9 D;  2BYK B;  3UTB D;  2ZY2 A;  4ZBJ B;  3X1V D;  2HIO C;  1R4V A;  1P3L B;  5KDM B;  1P3B A;  3AZI D;  2UWX A;  2PYO C;  3REI C;  1M1A A;  2IO5 C;  1P3G A;  3UT9 B;  3C1C D;  1KX5 B;  3MGR B;  1ZLA D;  1P34 A;  4WU8 A;  1P3A B;  4LD9 C;  1S32 D;  4KUD C;  1B67 A;  3AZE A;  1EQZ C;  3LJA C;  3NQJ B;  3KUY B;  5C3I C;  3WA9 C;  1F66 D;  2F8N K;  3REK A;  3X1V C;  5JA4 B;  5GSU A;  5AVB B;  4J8W A;  3C1B D;  3X1T D;  3AV2 D;  5AY8 A;  4KGC D;  3TU4 A;  5B1L D;  5B0Z D;  2RVQ C;  2Y2P A;  4H9S A;  5BS7 A;  4X23 B;  5B1M D;  4J8X A;  1S32 C;  1HQ3 D;  3VH6 W;  5GSU C;  5AY8 C;  4YS3 D;  1F66 C;  3W98 B;  5FUG A;  1ULY A;  5E5A A;  5GXQ B;  4WV4 B;  4HGA B;  5BS7 C;  3X1T C;  3AV2 C;  1M19 A;  3MNN D;  1M18 D;  5DNN C;  4UUZ A;  3AZF D;  4JJN B;  5B1L C;  4KGC C;  5B0Z C;  3B6G D;  5GT0 C;  3AZG A;  5AV5 B;  3AZM B;  5B1M C;  3MGS A;  1U35 B;  1HQ3 C;  4YM6 D;  3AYW B;  1BH8 B;  5AV8 B;  3REH D;  3KXB D;  3AV1 B;  1P3M B;  3KFU G;  5BO0 B;  3IP4 C;  1M18 C;  3X1S B;  3MNN C;  3EPH A;  3NQU B;  5B2J A;  3AZF C;  4M6B A;  3B6G C;  1P3F A;  4J8U A;  2ZM5 A;  2HIO B;  3UT9 D;  1KX5 D;  3MGR D;  2PYO B;  3WAA C;  2F8N B;  1P3A D;  3W97 A;  2Y2M A;  3REH C;  4NFT A;  5BT1 D;  3KXB C;  3REJ C;  3MGQ B;  1AOI A;  3KUY D;  4LD9 B;  4KUD B;  4ZBJ C;  1P3B B;  3AZJ A;  3LJA B;  1EQZ B;  3F6T A;  5AVB D;  1M1A B;  5C3I B;  3MGP A;  3KWQ A;  3UT9 C;  1P34 B;  4WJ3 C;  1TZY D;  5B32 A;  4XUJ A;  2FFF B;  3MGR C;  3WTP A;  3AN2 C;  1A7W A;  3KSY A;  3REL A;  3W99 A;  2XD5 A;  4X23 D;  3AZE B;  4WU9 A;  1HTA A;  4Z66 C;  2Y2I A;  3KUY C;  5CPK A;  1S32 B;  5AVC A;  3W96 A;  4J8V C;  3W98 D;  1WWI A;  5GSU B;  2YFW B;  5B40 A;  5AY8 B;  3REL C;  1P3P D;  3TU4 B;  3LEL A;  4JJN D;  1P3K A;  1TZY C;  4H9N A;  3X1T B;  3W96 C;  3AV2 B;  5AV5 D;  3X1U C;  3AZM D;  1U35 D;  5DNN B;  5B0Z B;  5B40 C;  2Y2O A;  2BYM A;  5GT0 B;  2J8P A;  5FUG B;  5AV8 D;  5B1M B;  3AYW D;  5B33 A;  5E5A B;  5B24 A;  3AV1 D;  2NZD A;  5GT3 A;  3FDD A;  1P3P C;  4UUZ B;  3X1S D;  3LZ0 A;  2ARO A;  2NQB A;  3MGS B;  1W2E A;  5AV5 C;  3AZM C;  2HIO D;  1P3O D;  3AZF B;  5B31 G;  5G49 B;  2PYO D;  2F8N D;  2CV5 A;  5F99 C;  3AYW C;  2ARO C;  2NQB C;  3MGQ D;  3WAA B;  4QLC A;  4LD9 D;  1P3I C;  5DNM A;  4KUD D;  3X1S C;  2YFV B;  3REJ B;  4DQY B;  3AZN A;  5B0Y A;  3LJA D;  1P3B D;  1EQZ D;  1M1A D;  5B2I A;  2ZY5 A;  1P3G D;  1H3O A;  1P3O C;  1P34 D;  4E44 A;  4WU8 D;  3W97 B;  1ID3 A;  5CPJ A;  2ZY4 A;  2DF4 C;  2JE5 A;  3R45 A;  3AZE D;  1JFI B;  1AOI B;  5B31 A;  3AN2 B;  2RVQ D;  3MGQ C;  3B6F A;  5CPI A;  4CSR A;  5GSU D;  1P3B C;  4ZUX A;  5AY8 D;  4Z66 B;  5AV9 A;  1M1A C;  4DRB A;  4J8V B;  3TU4 D;  1P3G C;  3AZH A;  4XZQ A;  1P34 C;  3UTA A;  3REL B;  4WU8 C;  1KX4 A;  5CPI C;  5DNN D;  3AZE C;  2F2A C;  1TZY B;  5CPK B;  1BH9 A;  5GT0 D;  3W96 B;  3REK C;  3AZH C;  3X1U B;  4R8P A;  5E5A D;  2VQR A;  5B40 B;  4J8W C;  1M19 D;  3AZI A; 
#chains in the Genus database with same CATH homology
 3TU4 C;  1P3K B;  5BNX A;  4H9S C;  3C1C A;  1P3P B;  4J8X C;  3H0R C;  5CP6 A;  3MGS D;  3LZ1 A;  2BYM B;  3VH5 T;  3A6N A;  4H9P B;  3V9R A;  5B24 B;  2NZD B;  3H0L C;  5CHL B;  4WZS B;  5E5A C;  3H0M C;  5GT3 B;  3B0B A;  3WAA D;  1M19 C;  3C1B A;  5F99 B;  5B2J D;  3REJ D;  2ARO B;  4H9R A;  2NQB B;  1P3F D;  2RIQ A;  3AZG C;  1P3I B;  4AWL B;  3MGS C;  2F8N H;  5B32 G;  4CAY B;  3W97 D;  2L5A A;  4WNN B;  4YS3 A;  3MVD A;  1P3O B;  1AOI D;  3AN2 D;  5DNM B;  4Z5T A;  4UPK A;  1F1E A;  3AZK A;  3P5J B;  5B2J C;  5B0Y B;  3AZN B;  1P3F C;  2FJ7 A;  4Z66 D;  4J8U C;  4J8V D;  3MVD C;  4XUJ D;  3REL D;  5CPJ B;  4Z5T C;  3W97 C;  1P3G B;  3R45 B;  5B31 B;  3AFA A;  1AOI C;  5CPK D;  1KX3 A;  4WU8 B;  4G91 C;  3WKJ A;  3W96 D;  4H9O A;  3X1U D;  2BYK A;  5CPI B;  4CSR B;  3AZJ C;  3AL0 C;  2JSS A;  5AV9 B;  5B40 D;  1P3L A;  3MGP C;  3VH6 A;  3KWQ C;  5KDM A;  3REK B;  3AZH B;  1P3K D;  1KX3 C;  5B32 C;  4XUJ C;  4J8W B;  3WTP C;  3VH5 A;  1KX5 A;  3W99 C;  2ZY3 A;  1P3A A;  4WU9 C;  1BH9 B;  5CPK C;  4R8P B;  4J8X B;  5AVC C;  3NQJ A;  5B24 D;  2NZD D;  5GT3 D;  2Y2L A;  5JA4 A;  5AVB A;  5F99 D;  3LEL C;  5BNX B;  1P3K C;  2ARO D;  5JRG A;  2NQB D;  1M19 B;  1P3I D;  2LY8 A;  4X23 A;  2Y2Q A;  3V9R B;  3AZG B;  5B33 C;  5B24 C;  2NZD C;  5GT3 C;  3W98 A;  5DNM D;  5GXQ A;  1Z2C B;  3AZN D;  5B0Y D;  3LZ0 C;  4JJN A;  4AWL C;  5B2J B;  3AZL A;  1U35 A;  1P3F B;  4Z2M G;  5CPJ D;  4J8U B;  2CV5 C;  3MVD B;  3B0C T;  5B31 D;  3B6F D;  5AV8 A;  4QLC C;  1P3M A;  4Z5T B;  5DNM C;  4NE5 A;  3O62 A;  3AZK B;  5BO0 A;  5CPI D;  3AZL C;  5AV6 A;  5B0Y C;  2HUE B;  3AZN C;  5AV9 D;  3NQU A;  5B2I C;  2FJ7 B;  4G91 B;  3REK D;  3AZH D;  3AZJ B;  3UTA D;  2HIO A;  4J8W D;  3MGP B;  1ID3 C;  3KWQ B;  4NE6 A;  5CPJ C;  2PYO A;  3REI A;  3AFA B;  5AV6 C;  2Y2H A;  3B0D C;  1KX3 B;  5B32 B;  5B31 C;  4XUJ B;  3B6F C;  3WTP B;  5BNV A;  3WTP E;  3W99 B;  4R8P D;  4J8X D;  2DQN C;  4LD9 A;  4G92 C;  4KUD A;  4WU9 B;  4ZUX C;  5AV9 C;  4EO5 C;  1EQZ A;  3LJA A;  5AVC B;  4XZQ C;  3WA9 A;  3UTB A;  2Y2J A;  3UTA C;  3X1V A;  2W8S A;  1B6W A;  1KX4 C;  5CP6 D;  3LEL B;  1KU5 A;  3LZ1 D;  1BFM A;  3A6N D;  4H9N B;  3VH6 T;  3AZG D;  1ZLA A;  4R8P C;  3UTB C;  1S32 A;  3AZI C;  2YFW A;  5B33 B;  5JRG B;  1F66 A;  2JCH A;  3C1C C;  3EPK A;  1ZLA C;  5CP6 C;  2BG1 A;  3X1T A;  3LZ0 B;  3AV2 A;  3LZ1 C;  4H9Q A;  5DNN A;  4KGC A;  1N1J A;  5B1L A;  3A6N C;  4J8U D;  5B0Z A;  3MVD D;  5GT0 A;  5B1M A;  3VH5 W;  1HQ3 A;  4Z5T D;  2CV5 B;  3C1B C;  3AZK D;  1TAF A;  2FJ7 D;  4QLC B;  1M18 A;  3AZL B;  3AZJ D;  3MNN A;  5B2I B;  3MGP D;  3AZF A;  3KWQ D;  1H3O B;  5G49 A;  3B6G A;  4YS3 C;  3AFA D;  1T3U A;  1KX3 D;  5B32 D;  4KHA A;  3WTP D;  3WKJ D;  1ID3 B;  3W99 D;  3O62 B;  3WAA A;  3AZK C;  5AV6 B;  4YM6 A;  3B0D B;  1P3L D;  4WU9 D;  3B6F B;  3REH A;  2HUE C;  2FJ7 C;  2YFV A;  3KXB A;  3REJ A;  4Z2M H;  5AVC D;  4G92 B;  4ZUX B;  4EO5 B;  3REI B;  4YM6 C;  4XZQ B;  3LEL D;  2IO5 B;  3AFA C;  5BNV B;  3UTA B;  1JFI A;  3UT9 A;  1KX4 B;  3WKJ C;  3MGR A;  3AN2 A;  2CWE A;  1P3L C;  3WA9 B;  3UTB B;  4Z66 A;  5B33 D;  3KUY A;  5JRG D;  4J8V A;  3X1V B;  3A1I A;  1KX5 C;  3AZI B;  1P3A C;  3LZ0 D;  1Q9C A;  2Y2G A;  5BT1 C;  3C1C B;  1ZLA B;  1TZY A;  5CP6 B;  3LZ1 B;  3X1U A;  3A6N B;  5AVB C;  3EG5 B;  5GXQ D;  2CV5 D;  1F66 B;  5JRG C;  4DRA A;  4QLC D;  4E45 A;  3C1B B;  1P3P A;  4H9Q B;  4X23 C;  4H9R B;  3AZL D;  4KGC B;  1N1J B;  5B1L B;  5B2I D;  1PZR A;  2F8N G;  4H9P A;  1HQ3 B;  3EPL A;  5AV5 A;  3AZM A;  1P3M D;  3W98 C;  1ID3 D;  3O62 D;  5GXQ C;  4YS3 B;  4HGA C;  5AV6 D;  1TAF B;  2G5I C;  5F99 A;  3AYW A;  1BH8 A;  4JJN C;  3AV1 A;  2Y2K A;  1WWS A;  1M18 B;  1P3I A;  3MNN B;  3EPJ A;  1U35 C;  2Y2N A;  3X1S A;  4ZUX D;  3B6G B;  4CAY A;  2G5H C;  3REI D;  4XZQ D;  4KHA B;  5AV8 C;  4WNN A;  3AV1 C;  1P3M C;  1P3O A;  1KX4 D;  3O62 C;  3B0C W;  4NE3 A;  4YM6 B;  2F8N A;  2XD1 A;  3REH B;  3A1K A;  3KXB B;  3WKJ B;  4H9O B;  3MGQ A;  3WA9 D;  2BYK B;  3UTB D;  2ZY2 A;  4ZBJ B;  3X1V D;  2HIO C;  1R4V A;  1P3L B;  5KDM B;  1P3B A;  3AZI D;  2UWX A;  2PYO C;  3REI C;  1M1A A;  2IO5 C;  1P3G A;  3UT9 B;  3C1C D;  1KX5 B;  3MGR B;  1ZLA D;  1P34 A;  4WU8 A;  1P3A B;  4LD9 C;  1S32 D;  4KUD C;  1B67 A;  3AZE A;  1EQZ C;  3LJA C;  3NQJ B;  3KUY B;  5C3I C;  3WA9 C;  1F66 D;  2F8N K;  3REK A;  3X1V C;  5JA4 B;  5GSU A;  5AVB B;  4J8W A;  3C1B D;  3X1T D;  3AV2 D;  5AY8 A;  4KGC D;  3TU4 A;  5B1L D;  5B0Z D;  2RVQ C;  2Y2P A;  4H9S A;  5BS7 A;  4X23 B;  5B1M D;  4J8X A;  1S32 C;  1HQ3 D;  3VH6 W;  5GSU C;  5AY8 C;  4YS3 D;  1F66 C;  3W98 B;  5FUG A;  1ULY A;  5E5A A;  5GXQ B;  4WV4 B;  4HGA B;  5BS7 C;  3X1T C;  3AV2 C;  1M19 A;  3MNN D;  1M18 D;  5DNN C;  4UUZ A;  3AZF D;  4JJN B;  5B1L C;  4KGC C;  5B0Z C;  3B6G D;  5GT0 C;  3AZG A;  5AV5 B;  3AZM B;  5B1M C;  3MGS A;  1U35 B;  1HQ3 C;  4YM6 D;  3AYW B;  1BH8 B;  5AV8 B;  3REH D;  3KXB D;  3AV1 B;  1P3M B;  3KFU G;  5BO0 B;  3IP4 C;  1M18 C;  3X1S B;  3MNN C;  3EPH A;  3NQU B;  5B2J A;  3AZF C;  4M6B A;  3B6G C;  1P3F A;  4J8U A;  2ZM5 A;  2HIO B;  3UT9 D;  1KX5 D;  3MGR D;  2PYO B;  3WAA C;  2F8N B;  1P3A D;  3W97 A;  2Y2M A;  3REH C;  4NFT A;  5BT1 D;  3KXB C;  3REJ C;  3MGQ B;  1AOI A;  3KUY D;  4LD9 B;  4KUD B;  4ZBJ C;  1P3B B;  3AZJ A;  3LJA B;  1EQZ B;  3F6T A;  5AVB D;  1M1A B;  5C3I B;  3MGP A;  3KWQ A;  3UT9 C;  1P34 B;  4WJ3 C;  1TZY D;  5B32 A;  4XUJ A;  2FFF B;  3MGR C;  3WTP A;  3AN2 C;  1A7W A;  3KSY A;  3REL A;  3W99 A;  2XD5 A;  4X23 D;  3AZE B;  4WU9 A;  1HTA A;  4Z66 C;  2Y2I A;  3KUY C;  5CPK A;  1S32 B;  5AVC A;  3W96 A;  4J8V C;  3W98 D;  1WWI A;  5GSU B;  2YFW B;  5B40 A;  5AY8 B;  3REL C;  1P3P D;  3TU4 B;  3LEL A;  4JJN D;  1P3K A;  1TZY C;  4H9N A;  3X1T B;  3W96 C;  3AV2 B;  5AV5 D;  3X1U C;  3AZM D;  1U35 D;  5DNN B;  5B0Z B;  5B40 C;  2Y2O A;  2BYM A;  5GT0 B;  2J8P A;  5FUG B;  5AV8 D;  5B1M B;  3AYW D;  5B33 A;  5E5A B;  5B24 A;  3AV1 D;  2NZD A;  5GT3 A;  3FDD A;  1P3P C;  4UUZ B;  3X1S D;  3LZ0 A;  2ARO A;  2NQB A;  3MGS B;  1W2E A;  5AV5 C;  3AZM C;  2HIO D;  1P3O D;  3AZF B;  5B31 G;  5G49 B;  2PYO D;  2F8N D;  2CV5 A;  5F99 C;  3AYW C;  2ARO C;  2NQB C;  3MGQ D;  3WAA B;  4QLC A;  4LD9 D;  1P3I C;  5DNM A;  4KUD D;  3X1S C;  2YFV B;  3REJ B;  4DQY B;  3AZN A;  5B0Y A;  3LJA D;  1P3B D;  1EQZ D;  1M1A D;  5B2I A;  2ZY5 A;  1P3G D;  1H3O A;  1P3O C;  1P34 D;  4E44 A;  4WU8 D;  3W97 B;  1ID3 A;  5CPJ A;  2ZY4 A;  2DF4 C;  2JE5 A;  3R45 A;  3AZE D;  1JFI B;  1AOI B;  5B31 A;  3AN2 B;  2RVQ D;  3MGQ C;  3B6F A;  5CPI A;  4CSR A;  5GSU D;  1P3B C;  4ZUX A;  5AY8 D;  4Z66 B;  5AV9 A;  1M1A C;  4DRB A;  4J8V B;  3TU4 D;  1P3G C;  3AZH A;  4XZQ A;  1P34 C;  3UTA A;  3REL B;  4WU8 C;  1KX4 A;  5CPI C;  5DNN D;  3AZE C;  2F2A C;  1TZY B;  5CPK B;  1BH9 A;  5GT0 D;  3W96 B;  3REK C;  3AZH C;  3X1U B;  4R8P A;  5E5A D;  2VQR A;  5B40 B;  4J8W C;  1M19 D;  3AZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...