3AZIC

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziC00
1P34B 3W97A 4H9PA 5BO0A 4DRAA 5DNNC 3AZNC 4M6BA 1P3PB 1B6WA 5DNMC 1M19B 2F8NK 4EO5C 4X23C 1F66D 3X1UB 4KHAA 4XZQC 4J8XB 1AOIA 3REJB 3LZ0D 4NFTA 1P3OB 2PYOC 3KXBD 5BT1C 5C3IC 3MGQB 3REID 5CP6D 1P3FA 3V9RB 3UTAA 3C1CA 4J8UC 3RELD 3B6GD 4LD9C 2NQBB 3X1TA 1KX3D 3B6FC 5CPJC 3TU4D 5JA4B 4QLCB 4JJNC 4H9NA 3AV1B 3WTPD 5B1LA 3W96A 3MGSA 3AYWB 4H9RA 5F99C 3MVDB 1ZLAB 2YFVA 4KGCC 5GXQC 3LZ0A 3AZFD 2BYMA 1S32D 5FUGB 3KXBA 3C1BD 1P3KA 2RVQC 3X1VC 3REIA 5CP6A 5B1MC 4R8PB 2CV5C 3AV2D 3LJAD 2F8NA 3B6GA 3REHA 3TU4A 4XUJC 5B40C 3W99C 3NQJA 5B31B 3AZHB 3W97C 1M1AC 1P3GB 3AZED 4Z66B 3AZFA 5GT3B 1ID3A 3AZKD 5AVCA 1KX5B 1AOIC 3AV2A 5GT0B 4HGAB 4Z2MH 4WU8B 1P3LB 2HUEC 2NZDA 5B0ZB 3C1CC 3O62D 1P3MC 5AV9D 3NQUA 4H9SC 4ZUXD 3WKJB 1WWSA 2IO5C 5GSUB 4J8VB 5AVBB 5B24D 1KX4B 3AZEA 3AZGB 2AROD 3KUYB 1F66C 4WU9A 5B0YD 3LZ0C 3LZ1A 3KXBC 1P3AB 3UTBD 5CPKD 3REIC 5CP6C 4KUDD 5CPIB 5B2JD 3AZLD 1HTAA 5AY8B 3O62A 4Z5TB 3RELC 3B6GC 3X1SB 1KX3C 3TU4C 1M19D 3AZJD 5B33D 4G91C 5AV8B 2AROA 3W98A 3WTPC 3AZID 4AWLC 1P3BB 5B2IB 5B0YA 4J8WD 5B32B 3B0DB 3AZFC 1S32C 2YFWA 3C1BC 4H9OB 4NE5A 3UTBA 5CPKA 4KUDA 4YM6B 3AV2C 3AZLA 3LJAC 1P3IB 4NE6A 1M18B 1M19A 3R45A 4YS3D 3X1UA 3AZIA 4J8XA 1P3OA 4J8WA 2F8NG 5AV6B 3AZEC 3MGRB 3MGQA 2BYKB 3KWQB 2F8NH 3AZKC 3WA9B 4G92B 1TAFB 2NQBA 1U35B 5BS7A 1P3FD 1HQ3B 5E5AB 5JA4A 4QLCA 3UTAD 1TZYD 3X1TD 3AYWA 4YS3A 3O62C 3MVDA 5AV9C 2HIOD 4ZUXC 3LELB 3AZNB 5DNNB 2FJ7D 5FUGA 5GT3D 5JRGD 1BH9B 5B24C 5DNMB 3AZMD 3WAAB 5B1LD 4EO5B 3MGSD 3W96D 2AROC 4R8PA 4X23B 1WWIA 4XZQB 1P3KD 5B0YC 1BH8B 5C3IB 3UTBC 5B32G 4KUDC 1TZYA 5B2JC 2F8ND 4J8UB 4WNNB 3MGPB 3AZLC 3REHD 4LD9B 5GSUD 5CPJB 2HIOA 1P3GA 4WZSB 2FJ7A 5GT3A 5JRGA 4JJNB 3AZJC 3AZMA 3VH6W 5B33C 3KUYD 1ULYA 4UUZB 3AZIC 5F99B 3AN2D 5GXQB 5GT0A 5CPKB 4J8WC 2JSSA 1P3LA 1ID3D 5AVCD 5BNVB 3X1VB 5B0ZA 5B1MB 2CV5B 1KU5A 5CHLB 5BS7C 5GSUA 1N1JB 4J8VA 2NZDD 4E45A 5B40B 3W99B 3REKD 3KUYA 4YS3C 1JFIA 5BO0B 3AN2A 1M1AB 3VH5W 5AV5D 4WU9D 3AFAD 1AOIB 3LZ1D 3X1SA 3UT9D 1P3FC 3UTAC 1TZYC 3REKA 3C1CB 1P3MB 3X1TC 1P3BA 2IO5B 4CAYB 2HIOC 5B32A 3A6NB 4KUDB 3MNND 2FJ7C 5GT3C 5JRGC 3W98D 4H9OA 3AZMC 4H9NB 5B1LC 3W96C 3MGSC 5AV5A 4YM6A 1F66B 4H9RB 3AFAA 1P3KC 3LZ0B 2BYMB 1HQ3D 5E5AD 4DRBA 3KXBB 3UT9A 1M18A 1P34D 5CP6B 4CSRB 3RELB 3LELD 2L5AA 3KSYA 3REHC 1P3PD 1KX3B 5GSUC 3B6GB 5AV6A 3TU4B 3B0BA 3WAAD 3MNNA 2BYKA 4G91B 3X1UD 3KWQA 5G49A 4J8XD 3REJD 3WTPB 3KUYC 1P3OD 1EQZB 4AWLB 3WA9A 1TAFA 5B31G 3AN2C 3MGQD 1S32B 1HQ3A 5E5AA 3C1BB 1ID3C 5AVCC 1P34A 2NQBD 4J8UD 3MGPD 4H9QB 3LJAB 1R4VA 3LELA 1P3PA 4QLCD 2NZDC 3AV1D 1BH9A 3WAAA 3AYWD 3MVDD 3REKC 1ZLAD 4X23A 3REJA 1BH8A 4NE3A 3AZEB 3V9RA 4R8PD 1Q9CA 5AV5C 4WU9C 3AZKB 4J8UA 3AFAC 3MGPA 3LZ1C 3UT9C 3AV1A 4ZBJC 5B31D 3AZHD 1ZLAA 4UUZA 3O62B 1P3GD 5AV9B 1M1AD 4Z66D 4ZUXB 3VH6A 1A7WA 5B24B 3MNNC 5BNVA 1KX5D 3X1VA 3W98C 2CV5A 5GT0D 4G92C 4WU8D 2PYOB 5B0YB 1P3LD 1N1JA 5B0ZD 1HQ3C 2YFWB 5E5AC 5B40A 5CPKC 3W99A 5B31A 3AZHA 1P34C 5B2JB 1H3OB 3WKJD 3B6FB 3AZLB 4J8VD 5BNXB 5AVBD 1KX4D 1M1AA 3A6ND 4Z66A 3LELC 3AZGD 1P3PC 1M19C 3WAAC 3AZJB 5B33B 1KX5A 3R45B 3X1UC 4J8XC 4KGCB 3REJC 3AZIB 1P3OC 4WU8A 5KDMB 1P3AD 4J8WB 3VH5A 3MGQC 5CPID 5AY8D 4Z5TD 1P3MA 3X1SD 2NQBC 3WKJA 3MGPC 4H9SA 1KX4A 5AVBA 4CAYA 3A6NA 3AZGA 4XUJB 4QLCC 5AV8D 3AV1C 1P3BD 3AYWC 1EQZD 3W97B 5B2ID 3MVDC 1ZLAC 4YS3B 1F66A 4H9PB 5B32D 1P3AA 3B0CW 4YM6D 4R8PC 5CPIA 4KHAB 5AY8A 4Z5TA 1P3ID 4CSRA 3RELA 1KX3A 1M18D 2HUEB 1P3FB 5AV8A 3UTAB 5B31C 3AZHC 1TZYB 1EQZA 3WTPA 5B2IA 3X1TB 5AV6D 2CWEA 1P3GC 4Z66C 2HIOB 3MGRD 1S32A 3KWQD 5JRGB 2FJ7B 3C1BA 4WV4B 3AZMB 3WA9D 5B1LB 3MGSB 4Z2MG 1KX5C 3W96B 1U35D 2YFVB 5GT0C 4HGAC 4WU8C 1P3IA 4H9QA 3LJAA 1P3KB 1P3LC 5B0ZC 3REIB 3WTPE 2F8NB 3WKJC 3AZND 5DNND 1KX4C 4J8VC 3VH6T 5AVBC 3REHB 3A6NC 5DNMD 3AZGC 3MGRA 4X23D 3NQJB 4XZQD 3AZKA 2PYOD 1U35A 1JFIB 5BT1D 3AN2B 3AZFB 1P3AC 1ID3B 5CPIC 5AVCB 5AY8C 3AV2B 4LD9D 2LY8A 4Z5TC 5CPJD 3B6FD 3X1SC 5AV9A 3AZNA 5DNNA 4ZUXA 4JJND 2NZDB 5DNMA 5B24A 1F1EA 5AV8C 5F99D 3REKB 4XZQA 1P3BC 3NQUB 5GXQD 1EQZC 5B2IC 4KGCD 2PYOA 3B0CT 5B32C 3VH5T 3B0DC 2RVQD 3X1VD 5B1MD 2CV5D 4YM6C 5AV5B 4WU9B 4WNNA 5B2JA 1H3OA 4LD9A 3AFAB 3B6FA 1P3IC 5CPJA 5BNXA 3LZ1B 4XUJD 5B40D 3UT9B 1M18C 3W99D 4JJNA 4ZBJB 3AZJA 3W97D 5B33A 1BFMA 5F99A 4KGCA 5GXQA 5KDMA 5AV6C 3MGRC 3MNNB 2AROB 3KWQC 5B1MA 3W98B 1AOID 5G49B 3WA9C 1U35C 4E44A 1B67A 4XUJA 3UTBB 3C1CD 1P3MD
chains in the Genus database with same CATH superfamily
1P34B 3W97A 4H9PA 2Y2PA 5BO0A 4DRAA 5DNNC 3AZNC 4WJ3C 4M6BA 1P3PB 1B6WA 5DNMC 1M19B 2F8NK 4EO5C 4X23C 1F66D 3X1UB 4KHAA 4XZQC 4J8XB 1AOIA 3REJB 3LZ0D 4NFTA 1P3OB 2PYOC 3KXBD 5BT1C 5C3IC 3MGQB 3REID 5CP6D 1P3FA 3V9RB 3UTAA 3C1CA 4J8UC 3RELD 3B6GD 4LD9C 2NQBB 3X1TA 1KX3D 3B6FC 5CPJC 3TU4D 5JA4B 4QLCB 4JJNC 4H9NA 3AV1B 3WTPD 5B1LA 3W96A 3MGSA 3AYWB 4H9RA 5F99C 3MVDB 1ZLAB 2YFVA 4KGCC 5GXQC 3LZ0A 3AZFD 2BYMA 1S32D 5FUGB 3KXBA 3C1BD 1P3KA 2RVQC 3X1VC 3REIA 5CP6A 5B1MC 4R8PB 2CV5C 3AV2D 3LJAD 2F8NA 3B6GA 3A1IA 3REHA 3TU4A 4XUJC 5B40C 3W99C 3NQJA 2XD1A 5B31B 3AZHB 3W97C 1M1AC 1P3GB 3AZED 4Z66B 3AZFA 5GT3B 1ID3A 3AZKD 5AVCA 2Y2HA 1KX5B 1AOIC 3AV2A 5GT0B 4HGAB 4Z2MH 4WU8B 1P3LB 2HUEC 2NZDA 5B0ZB 3C1CC 3O62D 1P3MC 5AV9D 3NQUA 4H9SC 4ZUXD 3WKJB 1WWSA 2IO5C 5GSUB 4J8VB 5AVBB 5B24D 1KX4B 3AZEA 3AZGB 2AROD 3EPHA 3KUYB 1F66C 4WU9A 5B0YD 3LZ0C 3LZ1A 3KXBC 1P3AB 3UTBD 5CPKD 3REIC 5CP6C 4KUDD 5CPIB 5B2JD 2ZY3A 2Y2QA 3AZLD 1HTAA 5AY8B 3O62A 4Z5TB 3RELC 3B6GC 3X1SB 1KX3C 3TU4C 1M19D 3AZJD 5B33D 3EPKA 4G91C 5AV8B 2AROA 3W98A 3WTPC 3AZID 4AWLC 1P3BB 5B2IB 5B0YA 4J8WD 5B32B 3B0DB 3AZFC 1S32C 2YFWA 3C1BC 4H9OB 4NE5A 3UTBA 5CPKA 4KUDA 4YM6B 3AV2C 3AZLA 2ZY2A 3LJAC 1P3IB 3P5JB 4NE6A 1M18B 1M19A 3R45A 4YS3D 3X1UA 3AZIA 4J8XA 2Y2OA 3A1KA 1P3OA 4J8WA 2F8NG 5AV6B 3F6TA 3AZEC 3MGRB 3MGQA 2BYKB 3KWQB 2F8NH 3AZKC 3WA9B 4G92B 2W8SA 1TAFB 2NQBA 1U35B 5BS7A 1P3FD 1HQ3B 5E5AB 5JA4A 3KFUG 4QLCA 3UTAD 1TZYD 3X1TD 3AYWA 4YS3A 3O62C 3MVDA 5AV9C 2HIOD 4ZUXC 3LELB 3AZNB 5DNNB 2FJ7D 2DF4C 5FUGA 5GT3D 1BH9B 5JRGD 5B24C 5DNMB 3AZMD 3WAAB 5B1LD 4EO5B 3MGSD 2ZM5A 3W96D 2AROC 4R8PA 4X23B 1WWIA 4XZQB 3EPLA 1P3KD 5B0YC 1BH8B 5C3IB 3UTBC 5B32G 4KUDC 1TZYA 5B2JC 2F8ND 4J8UB 4WNNB 3MGPB 3AZLC 3REHD 4LD9B 5GSUD 5CPJB 2HIOA 1P3GA 4WZSB 2FJ7A 5GT3A 5JRGA 4JJNB 3AZJC 3AZMA 3VH6W 5B33C 3KUYD 1ULYA 4UUZB 3AZIC 5F99B 3AN2D 5GXQB 5GT0A 5CPKB 4J8WC 2JSSA 1P3LA 1ID3D 5AVCD 5BNVB 2G5IC 3X1VB 5B0ZA 5B1MB 2CV5B 1KU5A 2Y2GA 5CHLB 2FFFB 2RIQA 5BS7C 5GSUA 1N1JB 4J8VA 2NZDD 4E45A 5B40B 3W99B 3REKD 2JE5A 3KUYA 4YS3C 1JFIA 5BO0B 3AN2A 1M1AB 3H0MC 3VH5W 5AV5D 4WU9D 3AFAD 1AOIB 3LZ1D 3X1SA 3UT9D 1P3FC 3UTAC 1TZYC 3REKA 3C1CB 1P3MB 3X1TC 1P3BA 2IO5B 4CAYB 2HIOC 5B32A 3A6NB 4KUDB 3MNND 2FJ7C 5GT3C 5JRGC 3W98D 4H9OA 3AZMC 4H9NB 5B1LC 3W96C 3MGSC 5AV5A 4YM6A 1F66B 4H9RB 3AFAA 1P3KC 3LZ0B 2BYMB 1HQ3D 5E5AD 4DRBA 3KXBB 3UT9A 1M18A 1P34D 5CP6B 3FDDA 3EG5B 4CSRB 3RELB 2DQNC 3LELD 2L5AA 3KSYA 3REHC 1P3PD 1KX3B 5GSUC 3B6GB 5AV6A 3TU4B 3B0BA 3WAAD 3MNNA 2BYKA 4G91B 3X1UD 3KWQA 5G49A 4J8XD 3REJD 3WTPB 3IP4C 3KUYC 1P3OD 4AWLB 1EQZB 3WA9A 1TAFA 5B31G 3AN2C 3MGQD 3H0LC 1S32B 1HQ3A 5E5AA 3C1BB 1ID3C 2VQRA 5AVCC 1P34A 2NQBD 4J8UD 3MGPD 4H9QB 3LJAB 1R4VA 3LELA 1P3PA 4QLCD 2NZDC 3AV1D 1BH9A 3WAAA 3AYWD 3MVDD 3REKC 1ZLAD 4X23A 3REJA 2Y2KA 1BH8A 4NE3A 3AZEB 3V9RA 4R8PD 1Q9CA 2J8PA 2BG1A 5AV5C 4WU9C 3AZKB 4J8UA 3AFAC 3MGPA 3LZ1C 3UT9C 3AV1A 4ZBJC 5B31D 3AZHD 1ZLAA 4UUZA 3O62B 1P3GD 5AV9B 1M1AD 4Z66D 4ZUXB 4DQYB 2Y2MA 3H0RC 3VH6A 1A7WA 5B24B 3MNNC 5BNVA 1KX5D 3X1VA 3W98C 2CV5A 5GT0D 4G92C 4WU8D 2PYOB 2Y2IA 5B0YB 1P3LD 1N1JA 5B0ZD 1HQ3C 2YFWB 5E5AC 5B40A 5CPKC 3W99A 5B31A 3AZHA 1P34C 5B2JB 1H3OB 3WKJD 3B6FB 3AZLB 4J8VD 5BNXB 5AVBD 1KX4D 1M1AA 3A6ND 4Z66A 3LELC 3AZGD 1P3PC 1M19C 3WAAC 3AZJB 5B33B 1KX5A 3R45B 3X1UC 4J8XC 4KGCB 2UWXA 3REJC 3AZIB 1P3OC 4WU8A 5KDMB 1P3AD 4J8WB 3VH5A 3MGQC 5CPID 1PZRA 5AY8D 4Z5TD 1P3MA 3X1SD 2NQBC 3AL0C 3WKJA 3MGPC 3EPJA 4H9SA 1KX4A 5AVBA 4CAYA 3A6NA 3AZGA 4XUJB 4QLCC 5AV8D 3AV1C 1P3BD 3AYWC 1EQZD 3W97B 5B2ID 3MVDC 1ZLAC 4YS3B 1F66A 4H9PB 5B32D 2G5HC 1P3AA 3B0CW 2JCHA 4YM6D 4R8PC 5CPIA 4KHAB 5AY8A 2Y2LA 4Z5TA 1P3ID 4CSRA 3RELA 2Y2JA 1KX3A 1M18D 2HUEB 1P3FB 1W2EA 5AV8A 3UTAB 5B31C 3AZHC 1TZYB 1EQZA 3WTPA 5B2IA 3X1TB 5AV6D 2CWEA 4UPKA 1P3GC 4Z66C 2HIOB 3MGRD 1S32A 3KWQD 5JRGB 2FJ7B 3C1BA 4WV4B 3AZMB 3WA9D 5B1LB 3MGSB 4Z2MG 1KX5C 3W96B 1U35D 2YFVB 5GT0C 4HGAC 4WU8C 1P3IA 4H9QA 3LJAA 1P3KB 1P3LC 5B0ZC 3REIB 3WTPE 2F8NB 3WKJC 3AZND 5DNND 1KX4C 4J8VC 3VH6T 5AVBC 3REHB 3A6NC 5DNMD 3AZGC 3MGRA 4X23D 3NQJB 4XZQD 3AZKA 2PYOD 1T3UA 1U35A 2ZY4A 1JFIB 5BT1D 3AN2B 3AZFB 1P3AC 2F2AC 1ID3B 5CPIC 5AVCB 1Z2CB 5AY8C 3AV2B 4LD9D 2LY8A 4Z5TC 5CPJD 3B6FD 3X1SC 5AV9A 3AZNA 5DNNA 4ZUXA 4JJND 2NZDB 5DNMA 5B24A 1F1EA 5AV8C 5F99D 3REKB 4XZQA 1P3BC 3NQUB 5GXQD 1EQZC 5B2IC 4KGCD 2PYOA 3B0CT 5B32C 3VH5T 3B0DC 2RVQD 3X1VD 5B1MD 2CV5D 4YM6C 5AV5B 4WU9B 4WNNA 5B2JA 1H3OA 4LD9A 3AFAB 3B6FA 1P3IC 5CPJA 5BNXA 3LZ1B 4XUJD 5B40D 3UT9B 1M18C 3W99D 2Y2NA 4JJNA 4ZBJB 3AZJA 3W97D 5B33A 2XD5A 1BFMA 5F99A 4KGCA 5GXQA 5KDMA 5AV6C 3MGRC 3MNNB 2AROB 2ZY5A 3KWQC 5B1MA 3W98B 1AOID 5G49B 3WA9C 1U35C 4E44A 1B67A 4XUJA 3UTBB 3C1CD 1P3MD
chains in the Genus database with same CATH topology
1P34B 3W97A 4H9PA 2Y2PA 5BO0A 4DRAA 5DNNC 3AZNC 4WJ3C 4M6BA 1P3PB 1B6WA 5DNMC 1M19B 2F8NK 4EO5C 4X23C 1F66D 3X1UB 4KHAA 4XZQC 4J8XB 1AOIA 3REJB 3LZ0D 4NFTA 1P3OB 2PYOC 3KXBD 5BT1C 5C3IC 3MGQB 3REID 5CP6D 1P3FA 3V9RB 3UTAA 3C1CA 4J8UC 3RELD 3B6GD 4LD9C 2NQBB 3X1TA 1KX3D 3B6FC 5CPJC 3TU4D 5JA4B 4QLCB 4JJNC 4H9NA 3AV1B 3WTPD 5B1LA 3W96A 3MGSA 3AYWB 4H9RA 5F99C 3MVDB 1ZLAB 2YFVA 4KGCC 5GXQC 3LZ0A 3AZFD 2BYMA 1S32D 5FUGB 3KXBA 3C1BD 1P3KA 2RVQC 3X1VC 3REIA 5CP6A 5B1MC 4R8PB 2CV5C 3AV2D 3LJAD 2F8NA 3B6GA 3A1IA 3REHA 3TU4A 4XUJC 5B40C 3W99C 3NQJA 2XD1A 5B31B 3AZHB 3W97C 1M1AC 1P3GB 3AZED 4Z66B 3AZFA 5GT3B 1ID3A 3AZKD 5AVCA 2Y2HA 1KX5B 1AOIC 3AV2A 5GT0B 4HGAB 4Z2MH 4WU8B 1P3LB 2HUEC 2NZDA 5B0ZB 3C1CC 3O62D 1P3MC 5AV9D 3NQUA 4H9SC 4ZUXD 3WKJB 1WWSA 2IO5C 5GSUB 4J8VB 5AVBB 5B24D 1KX4B 3AZEA 3AZGB 2AROD 3EPHA 3KUYB 1F66C 4WU9A 5B0YD 3LZ0C 3LZ1A 3KXBC 1P3AB 3UTBD 5CPKD 3REIC 5CP6C 4KUDD 5CPIB 5B2JD 2ZY3A 2Y2QA 3AZLD 1HTAA 5AY8B 3O62A 4Z5TB 3RELC 3B6GC 3X1SB 1KX3C 3TU4C 1M19D 3AZJD 5B33D 3EPKA 4G91C 5AV8B 2AROA 3W98A 3WTPC 3AZID 4AWLC 1P3BB 5B2IB 5B0YA 4J8WD 5B32B 3B0DB 3AZFC 1S32C 2YFWA 3C1BC 4H9OB 4NE5A 3UTBA 5CPKA 4KUDA 4YM6B 3AV2C 3AZLA 2ZY2A 3LJAC 1P3IB 3P5JB 4NE6A 1M18B 1M19A 3R45A 4YS3D 3X1UA 3AZIA 4J8XA 2Y2OA 3A1KA 1P3OA 4J8WA 2F8NG 5AV6B 3F6TA 3AZEC 3MGRB 3MGQA 2BYKB 3KWQB 2F8NH 3AZKC 3WA9B 4G92B 2W8SA 1TAFB 2NQBA 1U35B 5BS7A 1P3FD 1HQ3B 5E5AB 5JA4A 3KFUG 4QLCA 3UTAD 1TZYD 3X1TD 3AYWA 4YS3A 3O62C 3MVDA 5AV9C 2HIOD 4ZUXC 3LELB 3AZNB 5DNNB 2FJ7D 2DF4C 5FUGA 5GT3D 1BH9B 5JRGD 5B24C 5DNMB 3AZMD 3WAAB 5B1LD 4EO5B 3MGSD 2ZM5A 3W96D 2AROC 4R8PA 4X23B 1WWIA 4XZQB 3EPLA 1P3KD 5B0YC 1BH8B 5C3IB 3UTBC 5B32G 4KUDC 1TZYA 5B2JC 2F8ND 4J8UB 4WNNB 3MGPB 3AZLC 3REHD 4LD9B 5GSUD 5CPJB 2HIOA 1P3GA 4WZSB 2FJ7A 5GT3A 5JRGA 4JJNB 3AZJC 3AZMA 3VH6W 5B33C 3KUYD 1ULYA 4UUZB 3AZIC 5F99B 3AN2D 5GXQB 5GT0A 5CPKB 4J8WC 2JSSA 1P3LA 1ID3D 5AVCD 5BNVB 2G5IC 3X1VB 5B0ZA 5B1MB 2CV5B 1KU5A 2Y2GA 5CHLB 2FFFB 2RIQA 5BS7C 5GSUA 1N1JB 4J8VA 2NZDD 4E45A 5B40B 3W99B 3REKD 2JE5A 3KUYA 4YS3C 1JFIA 5BO0B 3AN2A 1M1AB 3H0MC 3VH5W 5AV5D 4WU9D 3AFAD 1AOIB 3LZ1D 3X1SA 3UT9D 1P3FC 3UTAC 1TZYC 3REKA 3C1CB 1P3MB 3X1TC 1P3BA 2IO5B 4CAYB 2HIOC 5B32A 3A6NB 4KUDB 3MNND 2FJ7C 5GT3C 5JRGC 3W98D 4H9OA 3AZMC 4H9NB 5B1LC 3W96C 3MGSC 5AV5A 4YM6A 1F66B 4H9RB 3AFAA 1P3KC 3LZ0B 2BYMB 1HQ3D 5E5AD 4DRBA 3KXBB 3UT9A 1M18A 1P34D 5CP6B 3FDDA 3EG5B 4CSRB 3RELB 2DQNC 3LELD 2L5AA 3KSYA 3REHC 1P3PD 1KX3B 5GSUC 3B6GB 5AV6A 3TU4B 3B0BA 3WAAD 3MNNA 2BYKA 4G91B 3X1UD 3KWQA 5G49A 4J8XD 3REJD 3WTPB 3IP4C 3KUYC 1P3OD 4AWLB 1EQZB 3WA9A 1TAFA 5B31G 3AN2C 3MGQD 3H0LC 1S32B 1HQ3A 5E5AA 3C1BB 1ID3C 2VQRA 5AVCC 1P34A 2NQBD 4J8UD 3MGPD 4H9QB 3LJAB 1R4VA 3LELA 1P3PA 4QLCD 2NZDC 3AV1D 1BH9A 3WAAA 3AYWD 3MVDD 3REKC 1ZLAD 4X23A 3REJA 2Y2KA 1BH8A 4NE3A 3AZEB 3V9RA 4R8PD 1Q9CA 2J8PA 2BG1A 5AV5C 4WU9C 3AZKB 4J8UA 3AFAC 3MGPA 3LZ1C 3UT9C 3AV1A 4ZBJC 5B31D 3AZHD 1ZLAA 4UUZA 3O62B 1P3GD 5AV9B 1M1AD 4Z66D 4ZUXB 4DQYB 2Y2MA 3H0RC 3VH6A 1A7WA 5B24B 3MNNC 5BNVA 1KX5D 3X1VA 3W98C 2CV5A 5GT0D 4G92C 4WU8D 2PYOB 2Y2IA 5B0YB 1P3LD 1N1JA 5B0ZD 1HQ3C 2YFWB 5E5AC 5B40A 5CPKC 3W99A 5B31A 3AZHA 1P34C 5B2JB 1H3OB 3WKJD 3B6FB 3AZLB 4J8VD 5BNXB 5AVBD 1KX4D 1M1AA 3A6ND 4Z66A 3LELC 3AZGD 1P3PC 1M19C 3WAAC 3AZJB 5B33B 1KX5A 3R45B 3X1UC 4J8XC 4KGCB 2UWXA 3REJC 3AZIB 1P3OC 4WU8A 5KDMB 1P3AD 4J8WB 3VH5A 3MGQC 5CPID 1PZRA 5AY8D 4Z5TD 1P3MA 3X1SD 2NQBC 3AL0C 3WKJA 3MGPC 3EPJA 4H9SA 1KX4A 5AVBA 4CAYA 3A6NA 3AZGA 4XUJB 4QLCC 5AV8D 3AV1C 1P3BD 3AYWC 1EQZD 3W97B 5B2ID 3MVDC 1ZLAC 4YS3B 1F66A 4H9PB 5B32D 2G5HC 1P3AA 3B0CW 2JCHA 4YM6D 4R8PC 5CPIA 4KHAB 5AY8A 2Y2LA 4Z5TA 1P3ID 4CSRA 3RELA 2Y2JA 1KX3A 1M18D 2HUEB 1P3FB 1W2EA 5AV8A 3UTAB 5B31C 3AZHC 1TZYB 1EQZA 3WTPA 5B2IA 3X1TB 5AV6D 2CWEA 4UPKA 1P3GC 4Z66C 2HIOB 3MGRD 1S32A 3KWQD 5JRGB 2FJ7B 3C1BA 4WV4B 3AZMB 3WA9D 5B1LB 3MGSB 4Z2MG 1KX5C 3W96B 1U35D 2YFVB 5GT0C 4HGAC 4WU8C 1P3IA 4H9QA 3LJAA 1P3KB 1P3LC 5B0ZC 3REIB 3WTPE 2F8NB 3WKJC 3AZND 5DNND 1KX4C 4J8VC 3VH6T 5AVBC 3REHB 3A6NC 5DNMD 3AZGC 3MGRA 4X23D 3NQJB 4XZQD 3AZKA 2PYOD 1T3UA 1U35A 2ZY4A 1JFIB 5BT1D 3AN2B 3AZFB 1P3AC 2F2AC 1ID3B 5CPIC 5AVCB 1Z2CB 5AY8C 3AV2B 4LD9D 2LY8A 4Z5TC 5CPJD 3B6FD 3X1SC 5AV9A 3AZNA 5DNNA 4ZUXA 4JJND 2NZDB 5DNMA 5B24A 1F1EA 5AV8C 5F99D 3REKB 4XZQA 1P3BC 3NQUB 5GXQD 1EQZC 5B2IC 4KGCD 2PYOA 3B0CT 5B32C 3VH5T 3B0DC 2RVQD 3X1VD 5B1MD 2CV5D 4YM6C 5AV5B 4WU9B 4WNNA 5B2JA 1H3OA 4LD9A 3AFAB 3B6FA 1P3IC 5CPJA 5BNXA 3LZ1B 4XUJD 5B40D 3UT9B 1M18C 3W99D 2Y2NA 4JJNA 4ZBJB 3AZJA 3W97D 5B33A 2XD5A 1BFMA 5F99A 4KGCA 5GXQA 5KDMA 5AV6C 3MGRC 3MNNB 2AROB 2ZY5A 3KWQC 5B1MA 3W98B 1AOID 5G49B 3WA9C 1U35C 4E44A 1B67A 4XUJA 3UTBB 3C1CD 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 B;  3W97 A;  4H9P A;  5BO0 A;  4DRA A;  5DNN C;  3AZN C;  4M6B A;  1P3P B;  1B6W A;  5DNM C;  1M19 B;  2F8N K;  4EO5 C;  4X23 C;  1F66 D;  3X1U B;  4KHA A;  4XZQ C;  4J8X B;  1AOI A;  3REJ B;  3LZ0 D;  4NFT A;  1P3O B;  2PYO C;  3KXB D;  5BT1 C;  5C3I C;  3MGQ B;  3REI D;  5CP6 D;  1P3F A;  3V9R B;  3UTA A;  3C1C A;  4J8U C;  3REL D;  3B6G D;  4LD9 C;  2NQB B;  3X1T A;  1KX3 D;  3B6F C;  5CPJ C;  3TU4 D;  5JA4 B;  4QLC B;  4JJN C;  4H9N A;  3AV1 B;  3WTP D;  5B1L A;  3W96 A;  3MGS A;  3AYW B;  4H9R A;  5F99 C;  3MVD B;  1ZLA B;  2YFV A;  4KGC C;  5GXQ C;  3LZ0 A;  3AZF D;  2BYM A;  1S32 D;  5FUG B;  3KXB A;  3C1B D;  1P3K A;  2RVQ C;  3X1V C;  3REI A;  5CP6 A;  5B1M C;  4R8P B;  2CV5 C;  3AV2 D;  3LJA D;  2F8N A;  3B6G A;  3REH A;  3TU4 A;  4XUJ C;  5B40 C;  3W99 C;  3NQJ A;  5B31 B;  3AZH B;  3W97 C;  1M1A C;  1P3G B;  3AZE D;  4Z66 B;  3AZF A;  5GT3 B;  1ID3 A;  3AZK D;  5AVC A;  1KX5 B;  1AOI C;  3AV2 A;  5GT0 B;  4HGA B;  4Z2M H;  4WU8 B;  1P3L B;  2HUE C;  2NZD A;  5B0Z B;  3C1C C;  3O62 D;  1P3M C;  5AV9 D;  3NQU A;  4H9S C;  4ZUX D;  3WKJ B;  1WWS A;  2IO5 C;  5GSU B;  4J8V B;  5AVB B;  5B24 D;  1KX4 B;  3AZE A;  3AZG B;  2ARO D;  3KUY B;  1F66 C;  4WU9 A;  5B0Y D;  3LZ0 C;  3LZ1 A;  3KXB C;  1P3A B;  3UTB D;  5CPK D;  3REI C;  5CP6 C;  4KUD D;  5CPI B;  5B2J D;  3AZL D;  1HTA A;  5AY8 B;  3O62 A;  4Z5T B;  3REL C;  3B6G C;  3X1S B;  1KX3 C;  3TU4 C;  1M19 D;  3AZJ D;  5B33 D;  4G91 C;  5AV8 B;  2ARO A;  3W98 A;  3WTP C;  3AZI D;  4AWL C;  1P3B B;  5B2I B;  5B0Y A;  4J8W D;  5B32 B;  3B0D B;  3AZF C;  1S32 C;  2YFW A;  3C1B C;  4H9O B;  4NE5 A;  3UTB A;  5CPK A;  4KUD A;  4YM6 B;  3AV2 C;  3AZL A;  3LJA C;  1P3I B;  4NE6 A;  1M18 B;  1M19 A;  3R45 A;  4YS3 D;  3X1U A;  3AZI A;  4J8X A;  1P3O A;  4J8W A;  2F8N G;  5AV6 B;  3AZE C;  3MGR B;  3MGQ A;  2BYK B;  3KWQ B;  2F8N H;  3AZK C;  3WA9 B;  4G92 B;  1TAF B;  2NQB A;  1U35 B;  5BS7 A;  1P3F D;  1HQ3 B;  5E5A B;  5JA4 A;  4QLC A;  3UTA D;  1TZY D;  3X1T D;  3AYW A;  4YS3 A;  3O62 C;  3MVD A;  5AV9 C;  2HIO D;  4ZUX C;  3LEL B;  3AZN B;  5DNN B;  2FJ7 D;  5FUG A;  5GT3 D;  5JRG D;  1BH9 B;  5B24 C;  5DNM B;  3AZM D;  3WAA B;  5B1L D;  4EO5 B;  3MGS D;  3W96 D;  2ARO C;  4R8P A;  4X23 B;  1WWI A;  4XZQ B;  1P3K D;  5B0Y C;  1BH8 B;  5C3I B;  3UTB C;  5B32 G;  4KUD C;  1TZY A;  5B2J C;  2F8N D;  4J8U B;  4WNN B;  3MGP B;  3AZL C;  3REH D;  4LD9 B;  5GSU D;  5CPJ B;  2HIO A;  1P3G A;  4WZS B;  2FJ7 A;  5GT3 A;  5JRG A;  4JJN B;  3AZJ C;  3AZM A;  3VH6 W;  5B33 C;  3KUY D;  1ULY A;  4UUZ B;  3AZI C;  5F99 B;  3AN2 D;  5GXQ B;  5GT0 A;  5CPK B;  4J8W C;  2JSS A;  1P3L A;  1ID3 D;  5AVC D;  5BNV B;  3X1V B;  5B0Z A;  5B1M B;  2CV5 B;  1KU5 A;  5CHL B;  5BS7 C;  5GSU A;  1N1J B;  4J8V A;  2NZD D;  4E45 A;  5B40 B;  3W99 B;  3REK D;  3KUY A;  4YS3 C;  1JFI A;  5BO0 B;  3AN2 A;  1M1A B;  3VH5 W;  5AV5 D;  4WU9 D;  3AFA D;  1AOI B;  3LZ1 D;  3X1S A;  3UT9 D;  1P3F C;  3UTA C;  1TZY C;  3REK A;  3C1C B;  1P3M B;  3X1T C;  1P3B A;  2IO5 B;  4CAY B;  2HIO C;  5B32 A;  3A6N B;  4KUD B;  3MNN D;  2FJ7 C;  5GT3 C;  5JRG C;  3W98 D;  4H9O A;  3AZM C;  4H9N B;  5B1L C;  3W96 C;  3MGS C;  5AV5 A;  4YM6 A;  1F66 B;  4H9R B;  3AFA A;  1P3K C;  3LZ0 B;  2BYM B;  1HQ3 D;  5E5A D;  4DRB A;  3KXB B;  3UT9 A;  1M18 A;  1P34 D;  5CP6 B;  4CSR B;  3REL B;  3LEL D;  2L5A A;  3KSY A;  3REH C;  1P3P D;  1KX3 B;  5GSU C;  3B6G B;  5AV6 A;  3TU4 B;  3B0B A;  3WAA D;  3MNN A;  2BYK A;  4G91 B;  3X1U D;  3KWQ A;  5G49 A;  4J8X D;  3REJ D;  3WTP B;  3KUY C;  1P3O D;  1EQZ B;  4AWL B;  3WA9 A;  1TAF A;  5B31 G;  3AN2 C;  3MGQ D;  1S32 B;  1HQ3 A;  5E5A A;  3C1B B;  1ID3 C;  5AVC C;  1P34 A;  2NQB D;  4J8U D;  3MGP D;  4H9Q B;  3LJA B;  1R4V A;  3LEL A;  1P3P A;  4QLC D;  2NZD C;  3AV1 D;  1BH9 A;  3WAA A;  3AYW D;  3MVD D;  3REK C;  1ZLA D;  4X23 A;  3REJ A;  1BH8 A;  4NE3 A;  3AZE B;  3V9R A;  4R8P D;  1Q9C A;  5AV5 C;  4WU9 C;  3AZK B;  4J8U A;  3AFA C;  3MGP A;  3LZ1 C;  3UT9 C;  3AV1 A;  4ZBJ C;  5B31 D;  3AZH D;  1ZLA A;  4UUZ A;  3O62 B;  1P3G D;  5AV9 B;  1M1A D;  4Z66 D;  4ZUX B;  3VH6 A;  1A7W A;  5B24 B;  3MNN C;  5BNV A;  1KX5 D;  3X1V A;  3W98 C;  2CV5 A;  5GT0 D;  4G92 C;  4WU8 D;  2PYO B;  5B0Y B;  1P3L D;  1N1J A;  5B0Z D;  1HQ3 C;  2YFW B;  5E5A C;  5B40 A;  5CPK C;  3W99 A;  5B31 A;  3AZH A;  1P34 C;  5B2J B;  1H3O B;  3WKJ D;  3B6F B;  3AZL B;  4J8V D;  5BNX B;  5AVB D;  1KX4 D;  1M1A A;  3A6N D;  4Z66 A;  3LEL C;  3AZG D;  1P3P C;  1M19 C;  3WAA C;  3AZJ B;  5B33 B;  1KX5 A;  3R45 B;  3X1U C;  4J8X C;  4KGC B;  3REJ C;  3AZI B;  1P3O C;  4WU8 A;  5KDM B;  1P3A D;  4J8W B;  3VH5 A;  3MGQ C;  5CPI D;  5AY8 D;  4Z5T D;  1P3M A;  3X1S D;  2NQB C;  3WKJ A;  3MGP C;  4H9S A;  1KX4 A;  5AVB A;  4CAY A;  3A6N A;  3AZG A;  4XUJ B;  4QLC C;  5AV8 D;  3AV1 C;  1P3B D;  3AYW C;  1EQZ D;  3W97 B;  5B2I D;  3MVD C;  1ZLA C;  4YS3 B;  1F66 A;  4H9P B;  5B32 D;  1P3A A;  3B0C W;  4YM6 D;  4R8P C;  5CPI A;  4KHA B;  5AY8 A;  4Z5T A;  1P3I D;  4CSR A;  3REL A;  1KX3 A;  1M18 D;  2HUE B;  1P3F B;  5AV8 A;  3UTA B;  5B31 C;  3AZH C;  1TZY B;  1EQZ A;  3WTP A;  5B2I A;  3X1T B;  5AV6 D;  2CWE A;  1P3G C;  4Z66 C;  2HIO B;  3MGR D;  1S32 A;  3KWQ D;  5JRG B;  2FJ7 B;  3C1B A;  4WV4 B;  3AZM B;  3WA9 D;  5B1L B;  3MGS B;  4Z2M G;  1KX5 C;  3W96 B;  1U35 D;  2YFV B;  5GT0 C;  4HGA C;  4WU8 C;  1P3I A;  4H9Q A;  3LJA A;  1P3K B;  1P3L C;  5B0Z C;  3REI B;  3WTP E;  2F8N B;  3WKJ C;  3AZN D;  5DNN D;  1KX4 C;  4J8V C;  3VH6 T;  5AVB C;  3REH B;  3A6N C;  5DNM D;  3AZG C;  3MGR A;  4X23 D;  3NQJ B;  4XZQ D;  3AZK A;  2PYO D;  1U35 A;  1JFI B;  5BT1 D;  3AN2 B;  3AZF B;  1P3A C;  1ID3 B;  5CPI C;  5AVC B;  5AY8 C;  3AV2 B;  4LD9 D;  2LY8 A;  4Z5T C;  5CPJ D;  3B6F D;  3X1S C;  5AV9 A;  3AZN A;  5DNN A;  4ZUX A;  4JJN D;  2NZD B;  5DNM A;  5B24 A;  1F1E A;  5AV8 C;  5F99 D;  3REK B;  4XZQ A;  1P3B C;  3NQU B;  5GXQ D;  1EQZ C;  5B2I C;  4KGC D;  2PYO A;  3B0C T;  5B32 C;  3VH5 T;  3B0D C;  2RVQ D;  3X1V D;  5B1M D;  2CV5 D;  4YM6 C;  5AV5 B;  4WU9 B;  4WNN A;  5B2J A;  1H3O A;  4LD9 A;  3AFA B;  3B6F A;  1P3I C;  5CPJ A;  5BNX A;  3LZ1 B;  4XUJ D;  5B40 D;  3UT9 B;  1M18 C;  3W99 D;  4JJN A;  4ZBJ B;  3AZJ A;  3W97 D;  5B33 A;  1BFM A;  5F99 A;  4KGC A;  5GXQ A;  5KDM A;  5AV6 C;  3MGR C;  3MNN B;  2ARO B;  3KWQ C;  5B1M A;  3W98 B;  1AOI D;  5G49 B;  3WA9 C;  1U35 C;  4E44 A;  1B67 A;  4XUJ A;  3UTB B;  3C1C D;  1P3M D; 
#chains in the Genus database with same CATH topology
 1P34 B;  3W97 A;  4H9P A;  2Y2P A;  5BO0 A;  4DRA A;  5DNN C;  3AZN C;  4WJ3 C;  4M6B A;  1P3P B;  1B6W A;  5DNM C;  1M19 B;  2F8N K;  4EO5 C;  4X23 C;  1F66 D;  3X1U B;  4KHA A;  4XZQ C;  4J8X B;  1AOI A;  3REJ B;  3LZ0 D;  4NFT A;  1P3O B;  2PYO C;  3KXB D;  5BT1 C;  5C3I C;  3MGQ B;  3REI D;  5CP6 D;  1P3F A;  3V9R B;  3UTA A;  3C1C A;  4J8U C;  3REL D;  3B6G D;  4LD9 C;  2NQB B;  3X1T A;  1KX3 D;  3B6F C;  5CPJ C;  3TU4 D;  5JA4 B;  4QLC B;  4JJN C;  4H9N A;  3AV1 B;  3WTP D;  5B1L A;  3W96 A;  3MGS A;  3AYW B;  4H9R A;  5F99 C;  3MVD B;  1ZLA B;  2YFV A;  4KGC C;  5GXQ C;  3LZ0 A;  3AZF D;  2BYM A;  1S32 D;  5FUG B;  3KXB A;  3C1B D;  1P3K A;  2RVQ C;  3X1V C;  3REI A;  5CP6 A;  5B1M C;  4R8P B;  2CV5 C;  3AV2 D;  3LJA D;  2F8N A;  3B6G A;  3A1I A;  3REH A;  3TU4 A;  4XUJ C;  5B40 C;  3W99 C;  3NQJ A;  2XD1 A;  5B31 B;  3AZH B;  3W97 C;  1M1A C;  1P3G B;  3AZE D;  4Z66 B;  3AZF A;  5GT3 B;  1ID3 A;  3AZK D;  5AVC A;  2Y2H A;  1KX5 B;  1AOI C;  3AV2 A;  5GT0 B;  4HGA B;  4Z2M H;  4WU8 B;  1P3L B;  2HUE C;  2NZD A;  5B0Z B;  3C1C C;  3O62 D;  1P3M C;  5AV9 D;  3NQU A;  4H9S C;  4ZUX D;  3WKJ B;  1WWS A;  2IO5 C;  5GSU B;  4J8V B;  5AVB B;  5B24 D;  1KX4 B;  3AZE A;  3AZG B;  2ARO D;  3EPH A;  3KUY B;  1F66 C;  4WU9 A;  5B0Y D;  3LZ0 C;  3LZ1 A;  3KXB C;  1P3A B;  3UTB D;  5CPK D;  3REI C;  5CP6 C;  4KUD D;  5CPI B;  5B2J D;  2ZY3 A;  2Y2Q A;  3AZL D;  1HTA A;  5AY8 B;  3O62 A;  4Z5T B;  3REL C;  3B6G C;  3X1S B;  1KX3 C;  3TU4 C;  1M19 D;  3AZJ D;  5B33 D;  3EPK A;  4G91 C;  5AV8 B;  2ARO A;  3W98 A;  3WTP C;  3AZI D;  4AWL C;  1P3B B;  5B2I B;  5B0Y A;  4J8W D;  5B32 B;  3B0D B;  3AZF C;  1S32 C;  2YFW A;  3C1B C;  4H9O B;  4NE5 A;  3UTB A;  5CPK A;  4KUD A;  4YM6 B;  3AV2 C;  3AZL A;  2ZY2 A;  3LJA C;  1P3I B;  3P5J B;  4NE6 A;  1M18 B;  1M19 A;  3R45 A;  4YS3 D;  3X1U A;  3AZI A;  4J8X A;  2Y2O A;  3A1K A;  1P3O A;  4J8W A;  2F8N G;  5AV6 B;  3F6T A;  3AZE C;  3MGR B;  3MGQ A;  2BYK B;  3KWQ B;  2F8N H;  3AZK C;  3WA9 B;  4G92 B;  2W8S A;  1TAF B;  2NQB A;  1U35 B;  5BS7 A;  1P3F D;  1HQ3 B;  5E5A B;  5JA4 A;  3KFU G;  4QLC A;  3UTA D;  1TZY D;  3X1T D;  3AYW A;  4YS3 A;  3O62 C;  3MVD A;  5AV9 C;  2HIO D;  4ZUX C;  3LEL B;  3AZN B;  5DNN B;  2FJ7 D;  2DF4 C;  5FUG A;  5GT3 D;  1BH9 B;  5JRG D;  5B24 C;  5DNM B;  3AZM D;  3WAA B;  5B1L D;  4EO5 B;  3MGS D;  2ZM5 A;  3W96 D;  2ARO C;  4R8P A;  4X23 B;  1WWI A;  4XZQ B;  3EPL A;  1P3K D;  5B0Y C;  1BH8 B;  5C3I B;  3UTB C;  5B32 G;  4KUD C;  1TZY A;  5B2J C;  2F8N D;  4J8U B;  4WNN B;  3MGP B;  3AZL C;  3REH D;  4LD9 B;  5GSU D;  5CPJ B;  2HIO A;  1P3G A;  4WZS B;  2FJ7 A;  5GT3 A;  5JRG A;  4JJN B;  3AZJ C;  3AZM A;  3VH6 W;  5B33 C;  3KUY D;  1ULY A;  4UUZ B;  3AZI C;  5F99 B;  3AN2 D;  5GXQ B;  5GT0 A;  5CPK B;  4J8W C;  2JSS A;  1P3L A;  1ID3 D;  5AVC D;  5BNV B;  2G5I C;  3X1V B;  5B0Z A;  5B1M B;  2CV5 B;  1KU5 A;  2Y2G A;  5CHL B;  2FFF B;  2RIQ A;  5BS7 C;  5GSU A;  1N1J B;  4J8V A;  2NZD D;  4E45 A;  5B40 B;  3W99 B;  3REK D;  2JE5 A;  3KUY A;  4YS3 C;  1JFI A;  5BO0 B;  3AN2 A;  1M1A B;  3H0M C;  3VH5 W;  5AV5 D;  4WU9 D;  3AFA D;  1AOI B;  3LZ1 D;  3X1S A;  3UT9 D;  1P3F C;  3UTA C;  1TZY C;  3REK A;  3C1C B;  1P3M B;  3X1T C;  1P3B A;  2IO5 B;  4CAY B;  2HIO C;  5B32 A;  3A6N B;  4KUD B;  3MNN D;  2FJ7 C;  5GT3 C;  5JRG C;  3W98 D;  4H9O A;  3AZM C;  4H9N B;  5B1L C;  3W96 C;  3MGS C;  5AV5 A;  4YM6 A;  1F66 B;  4H9R B;  3AFA A;  1P3K C;  3LZ0 B;  2BYM B;  1HQ3 D;  5E5A D;  4DRB A;  3KXB B;  3UT9 A;  1M18 A;  1P34 D;  5CP6 B;  3FDD A;  3EG5 B;  4CSR B;  3REL B;  2DQN C;  3LEL D;  2L5A A;  3KSY A;  3REH C;  1P3P D;  1KX3 B;  5GSU C;  3B6G B;  5AV6 A;  3TU4 B;  3B0B A;  3WAA D;  3MNN A;  2BYK A;  4G91 B;  3X1U D;  3KWQ A;  5G49 A;  4J8X D;  3REJ D;  3WTP B;  3IP4 C;  3KUY C;  1P3O D;  4AWL B;  1EQZ B;  3WA9 A;  1TAF A;  5B31 G;  3AN2 C;  3MGQ D;  3H0L C;  1S32 B;  1HQ3 A;  5E5A A;  3C1B B;  1ID3 C;  2VQR A;  5AVC C;  1P34 A;  2NQB D;  4J8U D;  3MGP D;  4H9Q B;  3LJA B;  1R4V A;  3LEL A;  1P3P A;  4QLC D;  2NZD C;  3AV1 D;  1BH9 A;  3WAA A;  3AYW D;  3MVD D;  3REK C;  1ZLA D;  4X23 A;  3REJ A;  2Y2K A;  1BH8 A;  4NE3 A;  3AZE B;  3V9R A;  4R8P D;  1Q9C A;  2J8P A;  2BG1 A;  5AV5 C;  4WU9 C;  3AZK B;  4J8U A;  3AFA C;  3MGP A;  3LZ1 C;  3UT9 C;  3AV1 A;  4ZBJ C;  5B31 D;  3AZH D;  1ZLA A;  4UUZ A;  3O62 B;  1P3G D;  5AV9 B;  1M1A D;  4Z66 D;  4ZUX B;  4DQY B;  2Y2M A;  3H0R C;  3VH6 A;  1A7W A;  5B24 B;  3MNN C;  5BNV A;  1KX5 D;  3X1V A;  3W98 C;  2CV5 A;  5GT0 D;  4G92 C;  4WU8 D;  2PYO B;  2Y2I A;  5B0Y B;  1P3L D;  1N1J A;  5B0Z D;  1HQ3 C;  2YFW B;  5E5A C;  5B40 A;  5CPK C;  3W99 A;  5B31 A;  3AZH A;  1P34 C;  5B2J B;  1H3O B;  3WKJ D;  3B6F B;  3AZL B;  4J8V D;  5BNX B;  5AVB D;  1KX4 D;  1M1A A;  3A6N D;  4Z66 A;  3LEL C;  3AZG D;  1P3P C;  1M19 C;  3WAA C;  3AZJ B;  5B33 B;  1KX5 A;  3R45 B;  3X1U C;  4J8X C;  4KGC B;  2UWX A;  3REJ C;  3AZI B;  1P3O C;  4WU8 A;  5KDM B;  1P3A D;  4J8W B;  3VH5 A;  3MGQ C;  5CPI D;  1PZR A;  5AY8 D;  4Z5T D;  1P3M A;  3X1S D;  2NQB C;  3AL0 C;  3WKJ A;  3MGP C;  3EPJ A;  4H9S A;  1KX4 A;  5AVB A;  4CAY A;  3A6N A;  3AZG A;  4XUJ B;  4QLC C;  5AV8 D;  3AV1 C;  1P3B D;  3AYW C;  1EQZ D;  3W97 B;  5B2I D;  3MVD C;  1ZLA C;  4YS3 B;  1F66 A;  4H9P B;  5B32 D;  2G5H C;  1P3A A;  3B0C W;  2JCH A;  4YM6 D;  4R8P C;  5CPI A;  4KHA B;  5AY8 A;  2Y2L A;  4Z5T A;  1P3I D;  4CSR A;  3REL A;  2Y2J A;  1KX3 A;  1M18 D;  2HUE B;  1P3F B;  1W2E A;  5AV8 A;  3UTA B;  5B31 C;  3AZH C;  1TZY B;  1EQZ A;  3WTP A;  5B2I A;  3X1T B;  5AV6 D;  2CWE A;  4UPK A;  1P3G C;  4Z66 C;  2HIO B;  3MGR D;  1S32 A;  3KWQ D;  5JRG B;  2FJ7 B;  3C1B A;  4WV4 B;  3AZM B;  3WA9 D;  5B1L B;  3MGS B;  4Z2M G;  1KX5 C;  3W96 B;  1U35 D;  2YFV B;  5GT0 C;  4HGA C;  4WU8 C;  1P3I A;  4H9Q A;  3LJA A;  1P3K B;  1P3L C;  5B0Z C;  3REI B;  3WTP E;  2F8N B;  3WKJ C;  3AZN D;  5DNN D;  1KX4 C;  4J8V C;  3VH6 T;  5AVB C;  3REH B;  3A6N C;  5DNM D;  3AZG C;  3MGR A;  4X23 D;  3NQJ B;  4XZQ D;  3AZK A;  2PYO D;  1T3U A;  1U35 A;  2ZY4 A;  1JFI B;  5BT1 D;  3AN2 B;  3AZF B;  1P3A C;  2F2A C;  1ID3 B;  5CPI C;  5AVC B;  1Z2C B;  5AY8 C;  3AV2 B;  4LD9 D;  2LY8 A;  4Z5T C;  5CPJ D;  3B6F D;  3X1S C;  5AV9 A;  3AZN A;  5DNN A;  4ZUX A;  4JJN D;  2NZD B;  5DNM A;  5B24 A;  1F1E A;  5AV8 C;  5F99 D;  3REK B;  4XZQ A;  1P3B C;  3NQU B;  5GXQ D;  1EQZ C;  5B2I C;  4KGC D;  2PYO A;  3B0C T;  5B32 C;  3VH5 T;  3B0D C;  2RVQ D;  3X1V D;  5B1M D;  2CV5 D;  4YM6 C;  5AV5 B;  4WU9 B;  4WNN A;  5B2J A;  1H3O A;  4LD9 A;  3AFA B;  3B6F A;  1P3I C;  5CPJ A;  5BNX A;  3LZ1 B;  4XUJ D;  5B40 D;  3UT9 B;  1M18 C;  3W99 D;  2Y2N A;  4JJN A;  4ZBJ B;  3AZJ A;  3W97 D;  5B33 A;  2XD5 A;  1BFM A;  5F99 A;  4KGC A;  5GXQ A;  5KDM A;  5AV6 C;  3MGR C;  3MNN B;  2ARO B;  2ZY5 A;  3KWQ C;  5B1M A;  3W98 B;  1AOI D;  5G49 B;  3WA9 C;  1U35 C;  4E44 A;  1B67 A;  4XUJ A;  3UTB B;  3C1C D;  1P3M D; 
#chains in the Genus database with same CATH homology
 1P34 B;  3W97 A;  4H9P A;  2Y2P A;  5BO0 A;  4DRA A;  5DNN C;  3AZN C;  4WJ3 C;  4M6B A;  1P3P B;  1B6W A;  5DNM C;  1M19 B;  2F8N K;  4EO5 C;  4X23 C;  1F66 D;  3X1U B;  4KHA A;  4XZQ C;  4J8X B;  1AOI A;  3REJ B;  3LZ0 D;  4NFT A;  1P3O B;  2PYO C;  3KXB D;  5BT1 C;  5C3I C;  3MGQ B;  3REI D;  5CP6 D;  1P3F A;  3V9R B;  3UTA A;  3C1C A;  4J8U C;  3REL D;  3B6G D;  4LD9 C;  2NQB B;  3X1T A;  1KX3 D;  3B6F C;  5CPJ C;  3TU4 D;  5JA4 B;  4QLC B;  4JJN C;  4H9N A;  3AV1 B;  3WTP D;  5B1L A;  3W96 A;  3MGS A;  3AYW B;  4H9R A;  5F99 C;  3MVD B;  1ZLA B;  2YFV A;  4KGC C;  5GXQ C;  3LZ0 A;  3AZF D;  2BYM A;  1S32 D;  5FUG B;  3KXB A;  3C1B D;  1P3K A;  2RVQ C;  3X1V C;  3REI A;  5CP6 A;  5B1M C;  4R8P B;  2CV5 C;  3AV2 D;  3LJA D;  2F8N A;  3B6G A;  3A1I A;  3REH A;  3TU4 A;  4XUJ C;  5B40 C;  3W99 C;  3NQJ A;  2XD1 A;  5B31 B;  3AZH B;  3W97 C;  1M1A C;  1P3G B;  3AZE D;  4Z66 B;  3AZF A;  5GT3 B;  1ID3 A;  3AZK D;  5AVC A;  2Y2H A;  1KX5 B;  1AOI C;  3AV2 A;  5GT0 B;  4HGA B;  4Z2M H;  4WU8 B;  1P3L B;  2HUE C;  2NZD A;  5B0Z B;  3C1C C;  3O62 D;  1P3M C;  5AV9 D;  3NQU A;  4H9S C;  4ZUX D;  3WKJ B;  1WWS A;  2IO5 C;  5GSU B;  4J8V B;  5AVB B;  5B24 D;  1KX4 B;  3AZE A;  3AZG B;  2ARO D;  3EPH A;  3KUY B;  1F66 C;  4WU9 A;  5B0Y D;  3LZ0 C;  3LZ1 A;  3KXB C;  1P3A B;  3UTB D;  5CPK D;  3REI C;  5CP6 C;  4KUD D;  5CPI B;  5B2J D;  2ZY3 A;  2Y2Q A;  3AZL D;  1HTA A;  5AY8 B;  3O62 A;  4Z5T B;  3REL C;  3B6G C;  3X1S B;  1KX3 C;  3TU4 C;  1M19 D;  3AZJ D;  5B33 D;  3EPK A;  4G91 C;  5AV8 B;  2ARO A;  3W98 A;  3WTP C;  3AZI D;  4AWL C;  1P3B B;  5B2I B;  5B0Y A;  4J8W D;  5B32 B;  3B0D B;  3AZF C;  1S32 C;  2YFW A;  3C1B C;  4H9O B;  4NE5 A;  3UTB A;  5CPK A;  4KUD A;  4YM6 B;  3AV2 C;  3AZL A;  2ZY2 A;  3LJA C;  1P3I B;  3P5J B;  4NE6 A;  1M18 B;  1M19 A;  3R45 A;  4YS3 D;  3X1U A;  3AZI A;  4J8X A;  2Y2O A;  3A1K A;  1P3O A;  4J8W A;  2F8N G;  5AV6 B;  3F6T A;  3AZE C;  3MGR B;  3MGQ A;  2BYK B;  3KWQ B;  2F8N H;  3AZK C;  3WA9 B;  4G92 B;  2W8S A;  1TAF B;  2NQB A;  1U35 B;  5BS7 A;  1P3F D;  1HQ3 B;  5E5A B;  5JA4 A;  3KFU G;  4QLC A;  3UTA D;  1TZY D;  3X1T D;  3AYW A;  4YS3 A;  3O62 C;  3MVD A;  5AV9 C;  2HIO D;  4ZUX C;  3LEL B;  3AZN B;  5DNN B;  2FJ7 D;  2DF4 C;  5FUG A;  5GT3 D;  1BH9 B;  5JRG D;  5B24 C;  5DNM B;  3AZM D;  3WAA B;  5B1L D;  4EO5 B;  3MGS D;  2ZM5 A;  3W96 D;  2ARO C;  4R8P A;  4X23 B;  1WWI A;  4XZQ B;  3EPL A;  1P3K D;  5B0Y C;  1BH8 B;  5C3I B;  3UTB C;  5B32 G;  4KUD C;  1TZY A;  5B2J C;  2F8N D;  4J8U B;  4WNN B;  3MGP B;  3AZL C;  3REH D;  4LD9 B;  5GSU D;  5CPJ B;  2HIO A;  1P3G A;  4WZS B;  2FJ7 A;  5GT3 A;  5JRG A;  4JJN B;  3AZJ C;  3AZM A;  3VH6 W;  5B33 C;  3KUY D;  1ULY A;  4UUZ B;  3AZI C;  5F99 B;  3AN2 D;  5GXQ B;  5GT0 A;  5CPK B;  4J8W C;  2JSS A;  1P3L A;  1ID3 D;  5AVC D;  5BNV B;  2G5I C;  3X1V B;  5B0Z A;  5B1M B;  2CV5 B;  1KU5 A;  2Y2G A;  5CHL B;  2FFF B;  2RIQ A;  5BS7 C;  5GSU A;  1N1J B;  4J8V A;  2NZD D;  4E45 A;  5B40 B;  3W99 B;  3REK D;  2JE5 A;  3KUY A;  4YS3 C;  1JFI A;  5BO0 B;  3AN2 A;  1M1A B;  3H0M C;  3VH5 W;  5AV5 D;  4WU9 D;  3AFA D;  1AOI B;  3LZ1 D;  3X1S A;  3UT9 D;  1P3F C;  3UTA C;  1TZY C;  3REK A;  3C1C B;  1P3M B;  3X1T C;  1P3B A;  2IO5 B;  4CAY B;  2HIO C;  5B32 A;  3A6N B;  4KUD B;  3MNN D;  2FJ7 C;  5GT3 C;  5JRG C;  3W98 D;  4H9O A;  3AZM C;  4H9N B;  5B1L C;  3W96 C;  3MGS C;  5AV5 A;  4YM6 A;  1F66 B;  4H9R B;  3AFA A;  1P3K C;  3LZ0 B;  2BYM B;  1HQ3 D;  5E5A D;  4DRB A;  3KXB B;  3UT9 A;  1M18 A;  1P34 D;  5CP6 B;  3FDD A;  3EG5 B;  4CSR B;  3REL B;  2DQN C;  3LEL D;  2L5A A;  3KSY A;  3REH C;  1P3P D;  1KX3 B;  5GSU C;  3B6G B;  5AV6 A;  3TU4 B;  3B0B A;  3WAA D;  3MNN A;  2BYK A;  4G91 B;  3X1U D;  3KWQ A;  5G49 A;  4J8X D;  3REJ D;  3WTP B;  3IP4 C;  3KUY C;  1P3O D;  4AWL B;  1EQZ B;  3WA9 A;  1TAF A;  5B31 G;  3AN2 C;  3MGQ D;  3H0L C;  1S32 B;  1HQ3 A;  5E5A A;  3C1B B;  1ID3 C;  2VQR A;  5AVC C;  1P34 A;  2NQB D;  4J8U D;  3MGP D;  4H9Q B;  3LJA B;  1R4V A;  3LEL A;  1P3P A;  4QLC D;  2NZD C;  3AV1 D;  1BH9 A;  3WAA A;  3AYW D;  3MVD D;  3REK C;  1ZLA D;  4X23 A;  3REJ A;  2Y2K A;  1BH8 A;  4NE3 A;  3AZE B;  3V9R A;  4R8P D;  1Q9C A;  2J8P A;  2BG1 A;  5AV5 C;  4WU9 C;  3AZK B;  4J8U A;  3AFA C;  3MGP A;  3LZ1 C;  3UT9 C;  3AV1 A;  4ZBJ C;  5B31 D;  3AZH D;  1ZLA A;  4UUZ A;  3O62 B;  1P3G D;  5AV9 B;  1M1A D;  4Z66 D;  4ZUX B;  4DQY B;  2Y2M A;  3H0R C;  3VH6 A;  1A7W A;  5B24 B;  3MNN C;  5BNV A;  1KX5 D;  3X1V A;  3W98 C;  2CV5 A;  5GT0 D;  4G92 C;  4WU8 D;  2PYO B;  2Y2I A;  5B0Y B;  1P3L D;  1N1J A;  5B0Z D;  1HQ3 C;  2YFW B;  5E5A C;  5B40 A;  5CPK C;  3W99 A;  5B31 A;  3AZH A;  1P34 C;  5B2J B;  1H3O B;  3WKJ D;  3B6F B;  3AZL B;  4J8V D;  5BNX B;  5AVB D;  1KX4 D;  1M1A A;  3A6N D;  4Z66 A;  3LEL C;  3AZG D;  1P3P C;  1M19 C;  3WAA C;  3AZJ B;  5B33 B;  1KX5 A;  3R45 B;  3X1U C;  4J8X C;  4KGC B;  2UWX A;  3REJ C;  3AZI B;  1P3O C;  4WU8 A;  5KDM B;  1P3A D;  4J8W B;  3VH5 A;  3MGQ C;  5CPI D;  1PZR A;  5AY8 D;  4Z5T D;  1P3M A;  3X1S D;  2NQB C;  3AL0 C;  3WKJ A;  3MGP C;  3EPJ A;  4H9S A;  1KX4 A;  5AVB A;  4CAY A;  3A6N A;  3AZG A;  4XUJ B;  4QLC C;  5AV8 D;  3AV1 C;  1P3B D;  3AYW C;  1EQZ D;  3W97 B;  5B2I D;  3MVD C;  1ZLA C;  4YS3 B;  1F66 A;  4H9P B;  5B32 D;  2G5H C;  1P3A A;  3B0C W;  2JCH A;  4YM6 D;  4R8P C;  5CPI A;  4KHA B;  5AY8 A;  2Y2L A;  4Z5T A;  1P3I D;  4CSR A;  3REL A;  2Y2J A;  1KX3 A;  1M18 D;  2HUE B;  1P3F B;  1W2E A;  5AV8 A;  3UTA B;  5B31 C;  3AZH C;  1TZY B;  1EQZ A;  3WTP A;  5B2I A;  3X1T B;  5AV6 D;  2CWE A;  4UPK A;  1P3G C;  4Z66 C;  2HIO B;  3MGR D;  1S32 A;  3KWQ D;  5JRG B;  2FJ7 B;  3C1B A;  4WV4 B;  3AZM B;  3WA9 D;  5B1L B;  3MGS B;  4Z2M G;  1KX5 C;  3W96 B;  1U35 D;  2YFV B;  5GT0 C;  4HGA C;  4WU8 C;  1P3I A;  4H9Q A;  3LJA A;  1P3K B;  1P3L C;  5B0Z C;  3REI B;  3WTP E;  2F8N B;  3WKJ C;  3AZN D;  5DNN D;  1KX4 C;  4J8V C;  3VH6 T;  5AVB C;  3REH B;  3A6N C;  5DNM D;  3AZG C;  3MGR A;  4X23 D;  3NQJ B;  4XZQ D;  3AZK A;  2PYO D;  1T3U A;  1U35 A;  2ZY4 A;  1JFI B;  5BT1 D;  3AN2 B;  3AZF B;  1P3A C;  2F2A C;  1ID3 B;  5CPI C;  5AVC B;  1Z2C B;  5AY8 C;  3AV2 B;  4LD9 D;  2LY8 A;  4Z5T C;  5CPJ D;  3B6F D;  3X1S C;  5AV9 A;  3AZN A;  5DNN A;  4ZUX A;  4JJN D;  2NZD B;  5DNM A;  5B24 A;  1F1E A;  5AV8 C;  5F99 D;  3REK B;  4XZQ A;  1P3B C;  3NQU B;  5GXQ D;  1EQZ C;  5B2I C;  4KGC D;  2PYO A;  3B0C T;  5B32 C;  3VH5 T;  3B0D C;  2RVQ D;  3X1V D;  5B1M D;  2CV5 D;  4YM6 C;  5AV5 B;  4WU9 B;  4WNN A;  5B2J A;  1H3O A;  4LD9 A;  3AFA B;  3B6F A;  1P3I C;  5CPJ A;  5BNX A;  3LZ1 B;  4XUJ D;  5B40 D;  3UT9 B;  1M18 C;  3W99 D;  2Y2N A;  4JJN A;  4ZBJ B;  3AZJ A;  3W97 D;  5B33 A;  2XD5 A;  1BFM A;  5F99 A;  4KGC A;  5GXQ A;  5KDM A;  5AV6 C;  3MGR C;  3MNN B;  2ARO B;  2ZY5 A;  3KWQ C;  5B1M A;  3W98 B;  1AOI D;  5G49 B;  3WA9 C;  1U35 C;  4E44 A;  1B67 A;  4XUJ A;  3UTB B;  3C1C D;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...