3AZIC

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziC00
1ID3B 3REIA 1KX4C 3C1BD 1P34B 4H9PB 5B40C 5JRGB 4X23D 5B33D 5B32D 3KXBB 4ZUXC 3AZLC 3MGPD 5B0ZB 3AV2B 1P3BA 1P3OD 3LZ0C 5B2JA 5AV6A 4WU8D 5B31C 4WZSB 3MVDD 1P3LC 4ZBJC 5B32G 3X1TB 3AZGC 5C3IC 3MGRD 2IO5C 3V9RA 1U35C 3AZFB 4Z5TD 1P3MC 5CPIC 3REKD 3REJA 3X1UC 3AZEB 2FJ7B 4Z66B 3B6GD 4WNNA 3X1SB 1EQZA 3X1VB 1S32C 5B24A 3LZ0A 5F99A 5AY8B 4JJNC 3VH5W 1M18C 5B31A 1P3KD 3W98B 2CV5C 1P3LA 5B2IC 2BYMB 3WA9C 4KUDB 3MNNC 5AV5C 3UT9D 1P3GD 5AV9A 1HQ3B 5GT3A 3REIB 1ZLAD 3X1UA 4LD9C 1TZYD 5DNMC 4J8VD 3UTBD 5GT0A 2NQBB 5AVBD 3C1BC 3VH5A 4X23C 2BYKB 5B1LC 5B33C 5B32C 1P3BB 4R8PD 4G91B 3MGPC 5E5AD 4J8UB 4JJNA 5BNVB 1M18A 2YFVA 3AZKA 3VH6W 3MGSD 3AZMD 3LJAA 3TU4A 3RELB 4WU8C 2HIOA 2AROA 3MVDC 1KX4B 3V9RB 4EO5C 5B40B 3B6FA 3KWQC 3MGRC 4Z5TC 5B1LA 3REKC 5B32A 1P34A 4H9NA 5B24B 4KGCD 3VH6A 3LZ0B 1M1AD 5F99B 3KXBA 3B6GC 3UTAD 5B0ZA 3AV2A 5B31B 5AVCA 5GXQD 1P3LB 3AN2D 4ZBJB 3AZGB 5C3IB 1P3KC 4DRBA 2IO5B 3UT9C 1AOID 5CPIB 1P3GC 2F8ND 3X1UB 3KWQA 3X1TA 1F66D 1S32B 1ZLAC 1A7WA 1TZYC 3AZJD 4J8VC 3UTBC 3AZEA 2FJ7A 5AVBC 4JJNB 3R45A 4WV4B 1M18B 4H9SA 3X1SA 1WWIA 3A6ND 3X1VA 3AZKB 2CV5B 4R8PC 5E5AC 3WA9B 1F1EA 5AV5B 3LJAB 5AY8A 1P3KA 4QLCD 3WTPD 5B0YD 2HIOB 3AV1D 3MGSC 3AZMC 1P3AD 3WAAA 2BYMA 5DNMB 3AYWD 3C1CD 4X23B 5B1LB 5B32B 1H3OA 3UTBA 4H9NB 5AVBA 3B0DC 2NQBA 3LELD 4M6BA 3O62D 4KGCC 2BYKA 3MGQD 1N1JA 1M19A 2NZDD 5DNND 5AVCB 4XZQD 1M1AC 3AFAD 4J8UA 1WWSA 1JFIA 3UTAC 4WU8B 4YM6D 1KX3D 5BNVA 3MGSA 4UUZA 3AZMA 5GXQC 3MVDB 3AN2C 2L5AA 3RELA 3KWQB 3WKJD 3MGRB 4HGAC 4Z5TB 1AOIC 4H9QA 3REKB 1KX4A 1ID3D 5B40A 5JRGD 4ZUXA 3AZLA 3B6GB 3R45B 4DRAA 2HUEC 4AWLC 3AZJC 1M1AA 3AZND 3W99D 1P3PD 4WU9D 5CPKD 1P3ID 3A6NC 1P3KB 5B1MD 3WAAB 4QLCC 3WTPC 5B0YC 4J8WC 3AV1C 3AZGA 1P3AC 4H9OB 1U35A 1TZYB 1P3MA 5CP6D 3AZHD 5CPIA 3AZFD 4J8VB 1H3OB 5BO0A 3UTBB 5AVBB 2F8NK 3AYWC 3C1CC 1S32A 5E5AB 1N1JB 1M19B 5BS7C 4E45A 1JFIB 3O62C 3MGQC 4Z2MG 3MGSB 2NZDC 5DNNC 4UUZB 4XZQC 3AZMB 5BNXA 3AFAC 2CV5A 1P3OC 5B2IA 3WA9A 3LZ1D 3WTPA 5AV5A 3MNNA 4J8WA 1KX3C 4KUDD 4G92C 4NE6A 1P3FD 1ULYA 4YS3D 3NQJA 1HQ3D 4H9QB 4LD9A 3WKJC 3AYWA 5DNMA 4J8XD 4ZUXB 3AZLB 3C1BA 4KGCB 4X23A 5B33A 1M1AB 5JRGC 5GSUD 3MGPA 3UTAB 1P3BD 5AV8D 3MGQA 5DNNA 1TAFA 4XZQA 5GXQB 3AZNC 3AFAA 5B2JD 3W99C 5AV6D 3AN2B 1P3OA 1P3PC 4WU9C 1KX3A 5CPKC 1P3IC 4WU8A 4HGAB 5B1MC 1AOIB 3MVDA 3W97D 1U35B 1P3MB 5BO0B 2PYOD 3MGRA 2YFWA 3REJD 4Z5TA 2HUEB 5CP6C 4AWLB 3KUYD 3REKA 3AZHC 4H9RA 1EQZD 5B24D 3B0BA 3B6GA 5F99D 1B6WA 3W99A 1BFMA 1P3PA 4WU9A 5BNXB 5B31D 5B2IB 2F8NG 3WTPB 5B0YB 3MNNB 4J8WB 3AV1B 1KX5D 5CHLB 1P3AB 3LZ1C 3NQJB 3UT9A 5AV9D 1P3GA 3W96D 4KUDC 5GT3D 4LD9B 5CPJD 3AYWB 1P3FC 4YS3C 5FUGB 3C1BB 3REHD 4E44A 3AZID 1TZYA 5GT0D 1ZLAA 1Q9CA 5B33B 4J8XC 4J8VA 2JSSA 3MGPB 3O62B 2RVQD 3MGQB 2NZDB 5DNNB 1TAFB 4XZQB 5GSUC 1M18D 3AFAB 4R8PA 1P3OB 5E5AA 3AZKD 4NE5A 1P3BC 5AV8C 1KX3B 3KSYA 4Z2MH 4G92B 3LJAD 5B2JC 5AV6C 3TU4D 2LY8A 3LZ1A 1BH8B 2HIOD 2AROD 4EO5B 5BT1D 3WKJB 4YS3A 3B6FD 3W97C 2YFWB 5G49B 4XUJD 4J8XA 5B1LD 4H9RB 2PYOC 1P34D 3REJC 1F66C 3KUYC 3AZNB 5GSUA 3KXBD 4KGCA 3W99B 1EQZC 1P3PB 5B0ZD 5B24C 4WU9B 5AV8A 3AV2D 5CPKB 1P3IB 5AVCD 5F99C 3UTAA 5B1MB 5GXQA 1B67A 5KDMB 3AN2A 3UT9B 1P3GB 1KX5C 3W97A 3KWQD 3W96C 1AOIA 5AV9C 3X1TD 5CP6B 3AZHB 5GT3C 2F8NA 1ZLAB 5CPJC 2PYOA 1F66A 4NE3A 3KUYA 3REHC 3AZED 3AZIC 2FJ7D 5GT0C 4Z66D 3AZJA 3NQUB 3X1SD 1KU5A 4R8PB 3X1VD 2RVQC 3A6NA 3LELC 4KHAA 5AY8D 3LZ1B 3AZKC 2F8NH 1KX5A 3WAAD 4QLCA 3LJAC 3TU4C 3W98D 5B0YA 4YM6C 3AV1A 4YS3B 1P3FB 3W96A 2HIOC 2AROC 1P3AA 5CPJA 5BT1C 4CAYA 4J8XB 3B6FC 3REID 3B0DB 3C1CA 3REHA 3AZIA 1R4VA 4XUJC 5FUGA 1ID3C 5GSUB 2NQBD 1P34C 5AV8B 5BS7A 1HTAA 1M19D 3LELA 3O62A 3KXBC 4CSRA 5B2JB 5AV6B 4J8UD 5B0ZC 2NZDA 3AV2C 1BH9A 5AVCC 5JA4A 4YM6A 3W97B 3RELD 1BH8A 2F8NB 2PYOB 1KX4D 3WKJA 3B0CW 5B40D 3REJB 4XUJA 4H9OA 3X1TC 1F66B 3KUYB 1ID3A 5G49A 4ZUXD 4WNNB 3AZLD 1EQZB 4H9PA 3AZJB 3AZFC 3VH5T 5JRGA 3AZEC 2FJ7C 3LZ0D 4Z66C 3A6NB 3AZNA 4KHAB 4H9SC 3X1SC 3X1VC 3WTPE 5CPKA 1P3IA 1KX5B 4QLCB 5AY8C 1P3LD 4NFTA 5B1MA 3W96B 5AV9B 5KDMA 5GT3B 3AZGD 3WAAC 5CPJB 3W98C 4CAYB 1U35D 1P3MD 5CPID 3C1CB 3REHB 3X1UD 3AZIB 5GT0B 5CP6A 1HQ3C 3AZHA 3AZFA 3REIC 1S32D 5B31G 3VH6T 4Z66A 3LELB 4CSRB 2NQBC 2YFVB 4JJND 1HQ3A 3NQUA 1M19C 1BH9B 5JA4B 3TU4B 2CV5D 4J8UC 4G91C 5B2ID 4YM6B 3WA9D 3MNND 5AV5D 4J8WD 2AROB 3W98A 3B0CT 4KUDA 3B6FB 3RELC 1P3FA 2CWEA 4LD9D 4XUJB 5DNMD
chains in the Genus database with same CATH superfamily
1ID3B 3REIA 1KX4C 3C1BD 1P34B 4H9PB 5B40C 5JRGB 4X23D 5B33D 5B32D 3KXBB 4ZUXC 3AZLC 3MGPD 5B0ZB 2ZM5A 3AV2B 1P3BA 1P3OD 3LZ0C 5B2JA 5AV6A 4WU8D 5B31C 4WZSB 3MVDD 1P3LC 4ZBJC 5B32G 3X1TB 3AZGC 5C3IC 3MGRD 2IO5C 3V9RA 1U35C 3AZFB 4Z5TD 1P3MC 5CPIC 3REKD 3REJA 3X1UC 3AZEB 2FJ7B 4Z66B 3B6GD 4WNNA 3X1SB 1EQZA 3X1VB 1S32C 5B24A 3LZ0A 5F99A 5AY8B 4JJNC 3VH5W 2JE5A 2J8PA 1M18C 5B31A 1P3KD 3W98B 2CV5C 1P3LA 5B2IC 2BYMB 3WA9C 4KUDB 2Y2HA 5AV5C 3MNNC 3UT9D 1P3GD 5AV9A 1HQ3B 5GT3A 3H0RC 3REIB 1ZLAD 3X1UA 4LD9C 1TZYD 2Y2LA 5DNMC 4J8VD 3UTBD 5GT0A 2NQBB 5AVBD 3H0MC 3C1BC 3VH5A 4X23C 2BYKB 5B1LC 5B33C 2W8SA 5B32C 1P3BB 4R8PD 4G91B 3MGPC 5E5AD 4J8UB 4JJNA 2VQRA 5BNVB 1M18A 2YFVA 3AZKA 3VH6W 3MGSD 3AZMD 3LJAA 3TU4A 3RELB 4WU8C 2HIOA 2AROA 3MVDC 1KX4B 3V9RB 4EO5C 5B40B 3B6FA 3KWQC 3MGRC 2DQNC 4Z5TC 5B1LA 3REKC 5B32A 1P34A 4H9NA 5B24B 4KGCD 3VH6A 3LZ0B 1M1AD 5F99B 2XD5A 3KXBA 3B6GC 3UTAD 5B0ZA 3AV2A 5B31B 5AVCA 5GXQD 1P3LB 3AN2D 4ZBJB 3AZGB 5C3IB 1P3KC 4DRBA 2IO5B 3UT9C 1AOID 5CPIB 1P3GC 2F8ND 3X1UB 2JCHA 3KWQA 3X1TA 1F66D 1S32B 1ZLAC 1A7WA 1TZYC 3AZJD 4J8VC 3UTBC 3AZEA 2FJ7A 5AVBC 4JJNB 3R45A 4WV4B 2Y2GA 1M18B 4H9SA 3X1SA 1WWIA 3A6ND 2ZY2A 3X1VA 3AZKB 2CV5B 4R8PC 5E5AC 3WA9B 1F1EA 5AV5B 3LJAB 5AY8A 1P3KA 4QLCD 1W2EA 3WTPD 5B0YD 2HIOB 3AV1D 3MGSC 3AZMC 1P3AD 3WAAA 1Z2CB 2BYMA 5DNMB 3AYWD 3C1CD 2ZY5A 4X23B 5B1LB 5B32B 1H3OA 3UTBA 4H9NB 3IP4C 5AVBA 2Y2KA 3B0DC 3EPJA 2NQBA 3LELD 4M6BA 3O62D 4KGCC 2BYKA 3MGQD 1N1JA 1M19A 2NZDD 5DNND 5AVCB 4XZQD 1M1AC 3AFAD 4J8UA 1WWSA 1JFIA 3UTAC 4WU8B 4YM6D 1KX3D 5BNVA 2UWXA 2Y2NA 3MGSA 2XD1A 4UUZA 5GXQC 3AZMA 3MVDB 3AN2C 2Y2PA 2L5AA 3RELA 3KWQB 3WKJD 3MGRB 4HGAC 4Z5TB 1AOIC 4H9QA 3REKB 1KX4A 1ID3D 2DF4C 5B40A 5JRGD 4ZUXA 3AZLA 3B6GB 1T3UA 3R45B 4DRAA 2HUEC 4AWLC 3AZJC 1M1AA 3AZND 3W99D 1P3PD 4WU9D 5CPKD 1P3ID 3A6NC 1P3KB 5B1MD 3WAAB 3EPHA 4QLCC 3WTPC 5B0YC 4J8WC 3AV1C 3AZGA 3H0LC 1P3AC 4H9OB 1U35A 1TZYB 1P3MA 5CP6D 3AZHD 5CPIA 3AZFD 2Y2QA 4J8VB 1H3OB 5BO0A 3UTBB 5AVBB 2F8NK 3AYWC 3C1CC 1S32A 5E5AB 1N1JB 1M19B 5BS7C 4E45A 1JFIB 3O62C 3MGQC 4Z2MG 3MGSB 2F2AC 2NZDC 5DNNC 4UUZB 4XZQC 3AZMB 5BNXA 3AFAC 2CV5A 1P3OC 5B2IA 3WA9A 3LZ1D 3WTPA 5AV5A 3MNNA 4J8WA 1KX3C 4KUDD 4G92C 4NE6A 1P3FD 2Y2MA 1ULYA 4YS3D 3NQJA 1HQ3D 4H9QB 4LD9A 3WKJC 3AYWA 5DNMA 4J8XD 4ZUXB 3AZLB 3C1BA 4KGCB 4X23A 5B33A 1M1AB 5JRGC 5GSUD 3MGPA 3UTAB 1P3BD 5AV8D 3MGQA 5DNNA 1TAFA 4XZQA 5GXQB 3AZNC 3AFAA 5B2JD 3W99C 5AV6D 3AN2B 1P3OA 1P3PC 4WU9C 1KX3A 5CPKC 1P3IC 4WU8A 4HGAB 5B1MC 1AOIB 3MVDA 3W97D 1U35B 1P3MB 5BO0B 2PYOD 3MGRA 2YFWA 3REJD 4Z5TA 2HUEB 5CP6C 4AWLB 3KUYD 3REKA 3AZHC 4H9RA 1EQZD 5B24D 3B0BA 3B6GA 5F99D 1B6WA 3W99A 1BFMA 1P3PA 4WU9A 5BNXB 5B31D 5B2IB 2F8NG 3WTPB 5B0YB 3MNNB 4J8WB 3AV1B 1KX5D 5CHLB 1P3AB 3LZ1C 2RIQA 3NQJB 3UT9A 5AV9D 3A1KA 1P3GA 3W96D 4KUDC 5GT3D 4LD9B 5CPJD 3AYWB 1P3FC 4YS3C 3FDDA 4UPKA 5FUGB 3C1BB 3REHD 4E44A 3AZID 1TZYA 5GT0D 1ZLAA 1Q9CA 5B33B 4J8XC 4J8VA 2JSSA 4DQYB 3MGPB 3O62B 2RVQD 3MGQB 2NZDB 5DNNB 1TAFB 4XZQB 5GSUC 1M18D 3AFAB 4R8PA 1P3OB 2Y2IA 5E5AA 3AZKD 4NE5A 1P3BC 5AV8C 1KX3B 3KSYA 4Z2MH 4G92B 3LJAD 5B2JC 5AV6C 3TU4D 2LY8A 3LZ1A 1BH8B 2HIOD 2AROD 4EO5B 5BT1D 3WKJB 4YS3A 3B6FD 3W97C 4WJ3C 2YFWB 5G49B 4XUJD 4J8XA 5B1LD 4H9RB 2PYOC 1P34D 3REJC 1F66C 3EPKA 3KUYC 3AZNB 5GSUA 3KXBD 4KGCA 3W99B 1EQZC 1P3PB 5B0ZD 5B24C 4WU9B 5AV8A 3AV2D 5CPKB 1P3IB 5AVCD 5F99C 3UTAA 5B1MB 2G5IC 5GXQA 1B67A 5KDMB 3AN2A 3UT9B 1P3GB 1KX5C 2ZY3A 3W97A 3KWQD 3W96C 1AOIA 5AV9C 5CP6B 3X1TD 3AZHB 5GT3C 2F8NA 1ZLAB 5CPJC 2PYOA 1F66A 4NE3A 3KUYA 3REHC 3AZED 3AZIC 2FJ7D 5GT0C 4Z66D 3AZJA 3NQUB 3F6TA 3X1SD 1KU5A 4R8PB 3X1VD 2RVQC 3A6NA 3LELC 4KHAA 5AY8D 3LZ1B 3AZKC 2F8NH 1KX5A 3WAAD 4QLCA 3LJAC 3TU4C 3W98D 5B0YA 4YM6C 3AV1A 4YS3B 1P3FB 3W96A 2HIOC 2AROC 1P3AA 5CPJA 5BT1C 4CAYA 4J8XB 3B6FC 3REID 3B0DB 3C1CA 3REHA 3AZIA 1R4VA 4XUJC 5FUGA 1ID3C 5GSUB 2NQBD 1P34C 5AV8B 5BS7A 1HTAA 1M19D 3LELA 3O62A 3KXBC 4CSRA 5B2JB 5AV6B 4J8UD 5B0ZC 2NZDA 3P5JB 3AV2C 1BH9A 5AVCC 5JA4A 4YM6A 3W97B 3RELD 1BH8A 2G5HC 3KFUG 2F8NB 2PYOB 1KX4D 3WKJA 3B0CW 5B40D 3REJB 4XUJA 4H9OA 3X1TC 1F66B 3KUYB 1ID3A 5G49A 4ZUXD 4WNNB 3AZLD 1EQZB 4H9PA 3AZJB 3AZFC 3VH5T 5JRGA 3AZEC 2FJ7C 3LZ0D 4Z66C 2ZY4A 3A6NB 3AZNA 4KHAB 4H9SC 3X1SC 3X1VC 3WTPE 3EG5B 5CPKA 1P3IA 1KX5B 4QLCB 5AY8C 1P3LD 2Y2JA 4NFTA 5B1MA 3W96B 5AV9B 5KDMA 5GT3B 3AZGD 3WAAC 5CPJB 3W98C 2Y2OA 4CAYB 1U35D 1P3MD 5CPID 3C1CB 3REHB 3X1UD 3AZIB 5GT0B 5CP6A 1HQ3C 3AZHA 3AZFA 3REIC 1S32D 5B31G 3AL0C 3VH6T 4Z66A 3LELB 3A1IA 4CSRB 2NQBC 2FFFB 2YFVB 4JJND 1HQ3A 3NQUA 1M19C 1PZRA 1BH9B 2BG1A 5JA4B 3TU4B 2CV5D 3EPLA 4G91C 5B2ID 4YM6B 4J8UC 3WA9D 3MNND 5AV5D 4J8WD 2AROB 3W98A 3B0CT 4KUDA 3B6FB 3RELC 1P3FA 2CWEA 4LD9D 4XUJB 5DNMD
chains in the Genus database with same CATH topology
1ID3B 3REIA 1KX4C 3C1BD 1P34B 4H9PB 5B40C 5JRGB 4X23D 5B33D 5B32D 3KXBB 4ZUXC 3AZLC 3MGPD 5B0ZB 2ZM5A 3AV2B 1P3BA 1P3OD 3LZ0C 5B2JA 5AV6A 4WU8D 5B31C 4WZSB 3MVDD 1P3LC 4ZBJC 5B32G 3X1TB 3AZGC 5C3IC 3MGRD 2IO5C 3V9RA 1U35C 3AZFB 4Z5TD 1P3MC 5CPIC 3REKD 3REJA 3X1UC 3AZEB 2FJ7B 4Z66B 3B6GD 4WNNA 3X1SB 1EQZA 3X1VB 1S32C 5B24A 3LZ0A 5F99A 5AY8B 4JJNC 3VH5W 2JE5A 2J8PA 1M18C 5B31A 1P3KD 3W98B 2CV5C 1P3LA 5B2IC 2BYMB 3WA9C 4KUDB 2Y2HA 5AV5C 3MNNC 3UT9D 1P3GD 5AV9A 1HQ3B 5GT3A 3H0RC 3REIB 1ZLAD 3X1UA 4LD9C 1TZYD 2Y2LA 5DNMC 4J8VD 3UTBD 5GT0A 2NQBB 5AVBD 3H0MC 3C1BC 3VH5A 4X23C 2BYKB 5B1LC 5B33C 2W8SA 5B32C 1P3BB 4R8PD 4G91B 3MGPC 5E5AD 4J8UB 4JJNA 2VQRA 5BNVB 1M18A 2YFVA 3AZKA 3VH6W 3MGSD 3AZMD 3LJAA 3TU4A 3RELB 4WU8C 2HIOA 2AROA 3MVDC 1KX4B 3V9RB 4EO5C 5B40B 3B6FA 3KWQC 3MGRC 2DQNC 4Z5TC 5B1LA 3REKC 5B32A 1P34A 4H9NA 5B24B 4KGCD 3VH6A 3LZ0B 1M1AD 5F99B 2XD5A 3KXBA 3B6GC 3UTAD 5B0ZA 3AV2A 5B31B 5AVCA 5GXQD 1P3LB 3AN2D 4ZBJB 3AZGB 5C3IB 1P3KC 4DRBA 2IO5B 3UT9C 1AOID 5CPIB 1P3GC 2F8ND 3X1UB 2JCHA 3KWQA 3X1TA 1F66D 1S32B 1ZLAC 1A7WA 1TZYC 3AZJD 4J8VC 3UTBC 3AZEA 2FJ7A 5AVBC 4JJNB 3R45A 4WV4B 2Y2GA 1M18B 4H9SA 3X1SA 1WWIA 3A6ND 2ZY2A 3X1VA 3AZKB 2CV5B 4R8PC 5E5AC 3WA9B 1F1EA 5AV5B 3LJAB 5AY8A 1P3KA 4QLCD 1W2EA 3WTPD 5B0YD 2HIOB 3AV1D 3MGSC 3AZMC 1P3AD 3WAAA 1Z2CB 2BYMA 5DNMB 3AYWD 3C1CD 2ZY5A 4X23B 5B1LB 5B32B 1H3OA 3UTBA 4H9NB 3IP4C 5AVBA 2Y2KA 3B0DC 3EPJA 2NQBA 3LELD 4M6BA 3O62D 4KGCC 2BYKA 3MGQD 1N1JA 1M19A 2NZDD 5DNND 5AVCB 4XZQD 1M1AC 3AFAD 4J8UA 1WWSA 1JFIA 3UTAC 4WU8B 4YM6D 1KX3D 5BNVA 2UWXA 2Y2NA 3MGSA 2XD1A 4UUZA 5GXQC 3AZMA 3MVDB 3AN2C 2Y2PA 2L5AA 3RELA 3KWQB 3WKJD 3MGRB 4HGAC 4Z5TB 1AOIC 4H9QA 3REKB 1KX4A 1ID3D 2DF4C 5B40A 5JRGD 4ZUXA 3AZLA 3B6GB 1T3UA 3R45B 4DRAA 2HUEC 4AWLC 3AZJC 1M1AA 3AZND 3W99D 1P3PD 4WU9D 5CPKD 1P3ID 3A6NC 1P3KB 5B1MD 3WAAB 3EPHA 4QLCC 3WTPC 5B0YC 4J8WC 3AV1C 3AZGA 3H0LC 1P3AC 4H9OB 1U35A 1TZYB 1P3MA 5CP6D 3AZHD 5CPIA 3AZFD 2Y2QA 4J8VB 1H3OB 5BO0A 3UTBB 5AVBB 2F8NK 3AYWC 3C1CC 1S32A 5E5AB 1N1JB 1M19B 5BS7C 4E45A 1JFIB 3O62C 3MGQC 4Z2MG 3MGSB 2F2AC 2NZDC 5DNNC 4UUZB 4XZQC 3AZMB 5BNXA 3AFAC 2CV5A 1P3OC 5B2IA 3WA9A 3LZ1D 3WTPA 5AV5A 3MNNA 4J8WA 1KX3C 4KUDD 4G92C 4NE6A 1P3FD 2Y2MA 1ULYA 4YS3D 3NQJA 1HQ3D 4H9QB 4LD9A 3WKJC 3AYWA 5DNMA 4J8XD 4ZUXB 3AZLB 3C1BA 4KGCB 4X23A 5B33A 1M1AB 5JRGC 5GSUD 3MGPA 3UTAB 1P3BD 5AV8D 3MGQA 5DNNA 1TAFA 4XZQA 5GXQB 3AZNC 3AFAA 5B2JD 3W99C 5AV6D 3AN2B 1P3OA 1P3PC 4WU9C 1KX3A 5CPKC 1P3IC 4WU8A 4HGAB 5B1MC 1AOIB 3MVDA 3W97D 1U35B 1P3MB 5BO0B 2PYOD 3MGRA 2YFWA 3REJD 4Z5TA 2HUEB 5CP6C 4AWLB 3KUYD 3REKA 3AZHC 4H9RA 1EQZD 5B24D 3B0BA 3B6GA 5F99D 1B6WA 3W99A 1BFMA 1P3PA 4WU9A 5BNXB 5B31D 5B2IB 2F8NG 3WTPB 5B0YB 3MNNB 4J8WB 3AV1B 1KX5D 5CHLB 1P3AB 3LZ1C 2RIQA 3NQJB 3UT9A 5AV9D 3A1KA 1P3GA 3W96D 4KUDC 5GT3D 4LD9B 5CPJD 3AYWB 1P3FC 4YS3C 3FDDA 4UPKA 5FUGB 3C1BB 3REHD 4E44A 3AZID 1TZYA 5GT0D 1ZLAA 1Q9CA 5B33B 4J8XC 4J8VA 2JSSA 4DQYB 3MGPB 3O62B 2RVQD 3MGQB 2NZDB 5DNNB 1TAFB 4XZQB 5GSUC 1M18D 3AFAB 4R8PA 1P3OB 2Y2IA 5E5AA 3AZKD 4NE5A 1P3BC 5AV8C 1KX3B 3KSYA 4Z2MH 4G92B 3LJAD 5B2JC 5AV6C 3TU4D 2LY8A 3LZ1A 1BH8B 2HIOD 2AROD 4EO5B 5BT1D 3WKJB 4YS3A 3B6FD 3W97C 4WJ3C 2YFWB 5G49B 4XUJD 4J8XA 5B1LD 4H9RB 2PYOC 1P34D 3REJC 1F66C 3EPKA 3KUYC 3AZNB 5GSUA 3KXBD 4KGCA 3W99B 1EQZC 1P3PB 5B0ZD 5B24C 4WU9B 5AV8A 3AV2D 5CPKB 1P3IB 5AVCD 5F99C 3UTAA 5B1MB 2G5IC 5GXQA 1B67A 5KDMB 3AN2A 3UT9B 1P3GB 1KX5C 2ZY3A 3W97A 3KWQD 3W96C 1AOIA 5AV9C 5CP6B 3X1TD 3AZHB 5GT3C 2F8NA 1ZLAB 5CPJC 2PYOA 1F66A 4NE3A 3KUYA 3REHC 3AZED 3AZIC 2FJ7D 5GT0C 4Z66D 3AZJA 3NQUB 3F6TA 3X1SD 1KU5A 4R8PB 3X1VD 2RVQC 3A6NA 3LELC 4KHAA 5AY8D 3LZ1B 3AZKC 2F8NH 1KX5A 3WAAD 4QLCA 3LJAC 3TU4C 3W98D 5B0YA 4YM6C 3AV1A 4YS3B 1P3FB 3W96A 2HIOC 2AROC 1P3AA 5CPJA 5BT1C 4CAYA 4J8XB 3B6FC 3REID 3B0DB 3C1CA 3REHA 3AZIA 1R4VA 4XUJC 5FUGA 1ID3C 5GSUB 2NQBD 1P34C 5AV8B 5BS7A 1HTAA 1M19D 3LELA 3O62A 3KXBC 4CSRA 5B2JB 5AV6B 4J8UD 5B0ZC 2NZDA 3P5JB 3AV2C 1BH9A 5AVCC 5JA4A 4YM6A 3W97B 3RELD 1BH8A 2G5HC 3KFUG 2F8NB 2PYOB 1KX4D 3WKJA 3B0CW 5B40D 3REJB 4XUJA 4H9OA 3X1TC 1F66B 3KUYB 1ID3A 5G49A 4ZUXD 4WNNB 3AZLD 1EQZB 4H9PA 3AZJB 3AZFC 3VH5T 5JRGA 3AZEC 2FJ7C 3LZ0D 4Z66C 2ZY4A 3A6NB 3AZNA 4KHAB 4H9SC 3X1SC 3X1VC 3WTPE 3EG5B 5CPKA 1P3IA 1KX5B 4QLCB 5AY8C 1P3LD 2Y2JA 4NFTA 5B1MA 3W96B 5AV9B 5KDMA 5GT3B 3AZGD 3WAAC 5CPJB 3W98C 2Y2OA 4CAYB 1U35D 1P3MD 5CPID 3C1CB 3REHB 3X1UD 3AZIB 5GT0B 5CP6A 1HQ3C 3AZHA 3AZFA 3REIC 1S32D 5B31G 3AL0C 3VH6T 4Z66A 3LELB 3A1IA 4CSRB 2NQBC 2FFFB 2YFVB 4JJND 1HQ3A 3NQUA 1M19C 1PZRA 1BH9B 2BG1A 5JA4B 3TU4B 2CV5D 3EPLA 4G91C 5B2ID 4YM6B 4J8UC 3WA9D 3MNND 5AV5D 4J8WD 2AROB 3W98A 3B0CT 4KUDA 3B6FB 3RELC 1P3FA 2CWEA 4LD9D 4XUJB 5DNMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 B;  3REI A;  1KX4 C;  3C1B D;  1P34 B;  4H9P B;  5B40 C;  5JRG B;  4X23 D;  5B33 D;  5B32 D;  3KXB B;  4ZUX C;  3AZL C;  3MGP D;  5B0Z B;  3AV2 B;  1P3B A;  1P3O D;  3LZ0 C;  5B2J A;  5AV6 A;  4WU8 D;  5B31 C;  4WZS B;  3MVD D;  1P3L C;  4ZBJ C;  5B32 G;  3X1T B;  3AZG C;  5C3I C;  3MGR D;  2IO5 C;  3V9R A;  1U35 C;  3AZF B;  4Z5T D;  1P3M C;  5CPI C;  3REK D;  3REJ A;  3X1U C;  3AZE B;  2FJ7 B;  4Z66 B;  3B6G D;  4WNN A;  3X1S B;  1EQZ A;  3X1V B;  1S32 C;  5B24 A;  3LZ0 A;  5F99 A;  5AY8 B;  4JJN C;  3VH5 W;  1M18 C;  5B31 A;  1P3K D;  3W98 B;  2CV5 C;  1P3L A;  5B2I C;  2BYM B;  3WA9 C;  4KUD B;  3MNN C;  5AV5 C;  3UT9 D;  1P3G D;  5AV9 A;  1HQ3 B;  5GT3 A;  3REI B;  1ZLA D;  3X1U A;  4LD9 C;  1TZY D;  5DNM C;  4J8V D;  3UTB D;  5GT0 A;  2NQB B;  5AVB D;  3C1B C;  3VH5 A;  4X23 C;  2BYK B;  5B1L C;  5B33 C;  5B32 C;  1P3B B;  4R8P D;  4G91 B;  3MGP C;  5E5A D;  4J8U B;  4JJN A;  5BNV B;  1M18 A;  2YFV A;  3AZK A;  3VH6 W;  3MGS D;  3AZM D;  3LJA A;  3TU4 A;  3REL B;  4WU8 C;  2HIO A;  2ARO A;  3MVD C;  1KX4 B;  3V9R B;  4EO5 C;  5B40 B;  3B6F A;  3KWQ C;  3MGR C;  4Z5T C;  5B1L A;  3REK C;  5B32 A;  1P34 A;  4H9N A;  5B24 B;  4KGC D;  3VH6 A;  3LZ0 B;  1M1A D;  5F99 B;  3KXB A;  3B6G C;  3UTA D;  5B0Z A;  3AV2 A;  5B31 B;  5AVC A;  5GXQ D;  1P3L B;  3AN2 D;  4ZBJ B;  3AZG B;  5C3I B;  1P3K C;  4DRB A;  2IO5 B;  3UT9 C;  1AOI D;  5CPI B;  1P3G C;  2F8N D;  3X1U B;  3KWQ A;  3X1T A;  1F66 D;  1S32 B;  1ZLA C;  1A7W A;  1TZY C;  3AZJ D;  4J8V C;  3UTB C;  3AZE A;  2FJ7 A;  5AVB C;  4JJN B;  3R45 A;  4WV4 B;  1M18 B;  4H9S A;  3X1S A;  1WWI A;  3A6N D;  3X1V A;  3AZK B;  2CV5 B;  4R8P C;  5E5A C;  3WA9 B;  1F1E A;  5AV5 B;  3LJA B;  5AY8 A;  1P3K A;  4QLC D;  3WTP D;  5B0Y D;  2HIO B;  3AV1 D;  3MGS C;  3AZM C;  1P3A D;  3WAA A;  2BYM A;  5DNM B;  3AYW D;  3C1C D;  4X23 B;  5B1L B;  5B32 B;  1H3O A;  3UTB A;  4H9N B;  5AVB A;  3B0D C;  2NQB A;  3LEL D;  4M6B A;  3O62 D;  4KGC C;  2BYK A;  3MGQ D;  1N1J A;  1M19 A;  2NZD D;  5DNN D;  5AVC B;  4XZQ D;  1M1A C;  3AFA D;  4J8U A;  1WWS A;  1JFI A;  3UTA C;  4WU8 B;  4YM6 D;  1KX3 D;  5BNV A;  3MGS A;  4UUZ A;  3AZM A;  5GXQ C;  3MVD B;  3AN2 C;  2L5A A;  3REL A;  3KWQ B;  3WKJ D;  3MGR B;  4HGA C;  4Z5T B;  1AOI C;  4H9Q A;  3REK B;  1KX4 A;  1ID3 D;  5B40 A;  5JRG D;  4ZUX A;  3AZL A;  3B6G B;  3R45 B;  4DRA A;  2HUE C;  4AWL C;  3AZJ C;  1M1A A;  3AZN D;  3W99 D;  1P3P D;  4WU9 D;  5CPK D;  1P3I D;  3A6N C;  1P3K B;  5B1M D;  3WAA B;  4QLC C;  3WTP C;  5B0Y C;  4J8W C;  3AV1 C;  3AZG A;  1P3A C;  4H9O B;  1U35 A;  1TZY B;  1P3M A;  5CP6 D;  3AZH D;  5CPI A;  3AZF D;  4J8V B;  1H3O B;  5BO0 A;  3UTB B;  5AVB B;  2F8N K;  3AYW C;  3C1C C;  1S32 A;  5E5A B;  1N1J B;  1M19 B;  5BS7 C;  4E45 A;  1JFI B;  3O62 C;  3MGQ C;  4Z2M G;  3MGS B;  2NZD C;  5DNN C;  4UUZ B;  4XZQ C;  3AZM B;  5BNX A;  3AFA C;  2CV5 A;  1P3O C;  5B2I A;  3WA9 A;  3LZ1 D;  3WTP A;  5AV5 A;  3MNN A;  4J8W A;  1KX3 C;  4KUD D;  4G92 C;  4NE6 A;  1P3F D;  1ULY A;  4YS3 D;  3NQJ A;  1HQ3 D;  4H9Q B;  4LD9 A;  3WKJ C;  3AYW A;  5DNM A;  4J8X D;  4ZUX B;  3AZL B;  3C1B A;  4KGC B;  4X23 A;  5B33 A;  1M1A B;  5JRG C;  5GSU D;  3MGP A;  3UTA B;  1P3B D;  5AV8 D;  3MGQ A;  5DNN A;  1TAF A;  4XZQ A;  5GXQ B;  3AZN C;  3AFA A;  5B2J D;  3W99 C;  5AV6 D;  3AN2 B;  1P3O A;  1P3P C;  4WU9 C;  1KX3 A;  5CPK C;  1P3I C;  4WU8 A;  4HGA B;  5B1M C;  1AOI B;  3MVD A;  3W97 D;  1U35 B;  1P3M B;  5BO0 B;  2PYO D;  3MGR A;  2YFW A;  3REJ D;  4Z5T A;  2HUE B;  5CP6 C;  4AWL B;  3KUY D;  3REK A;  3AZH C;  4H9R A;  1EQZ D;  5B24 D;  3B0B A;  3B6G A;  5F99 D;  1B6W A;  3W99 A;  1BFM A;  1P3P A;  4WU9 A;  5BNX B;  5B31 D;  5B2I B;  2F8N G;  3WTP B;  5B0Y B;  3MNN B;  4J8W B;  3AV1 B;  1KX5 D;  5CHL B;  1P3A B;  3LZ1 C;  3NQJ B;  3UT9 A;  5AV9 D;  1P3G A;  3W96 D;  4KUD C;  5GT3 D;  4LD9 B;  5CPJ D;  3AYW B;  1P3F C;  4YS3 C;  5FUG B;  3C1B B;  3REH D;  4E44 A;  3AZI D;  1TZY A;  5GT0 D;  1ZLA A;  1Q9C A;  5B33 B;  4J8X C;  4J8V A;  2JSS A;  3MGP B;  3O62 B;  2RVQ D;  3MGQ B;  2NZD B;  5DNN B;  1TAF B;  4XZQ B;  5GSU C;  1M18 D;  3AFA B;  4R8P A;  1P3O B;  5E5A A;  3AZK D;  4NE5 A;  1P3B C;  5AV8 C;  1KX3 B;  3KSY A;  4Z2M H;  4G92 B;  3LJA D;  5B2J C;  5AV6 C;  3TU4 D;  2LY8 A;  3LZ1 A;  1BH8 B;  2HIO D;  2ARO D;  4EO5 B;  5BT1 D;  3WKJ B;  4YS3 A;  3B6F D;  3W97 C;  2YFW B;  5G49 B;  4XUJ D;  4J8X A;  5B1L D;  4H9R B;  2PYO C;  1P34 D;  3REJ C;  1F66 C;  3KUY C;  3AZN B;  5GSU A;  3KXB D;  4KGC A;  3W99 B;  1EQZ C;  1P3P B;  5B0Z D;  5B24 C;  4WU9 B;  5AV8 A;  3AV2 D;  5CPK B;  1P3I B;  5AVC D;  5F99 C;  3UTA A;  5B1M B;  5GXQ A;  1B67 A;  5KDM B;  3AN2 A;  3UT9 B;  1P3G B;  1KX5 C;  3W97 A;  3KWQ D;  3W96 C;  1AOI A;  5AV9 C;  3X1T D;  5CP6 B;  3AZH B;  5GT3 C;  2F8N A;  1ZLA B;  5CPJ C;  2PYO A;  1F66 A;  4NE3 A;  3KUY A;  3REH C;  3AZE D;  3AZI C;  2FJ7 D;  5GT0 C;  4Z66 D;  3AZJ A;  3NQU B;  3X1S D;  1KU5 A;  4R8P B;  3X1V D;  2RVQ C;  3A6N A;  3LEL C;  4KHA A;  5AY8 D;  3LZ1 B;  3AZK C;  2F8N H;  1KX5 A;  3WAA D;  4QLC A;  3LJA C;  3TU4 C;  3W98 D;  5B0Y A;  4YM6 C;  3AV1 A;  4YS3 B;  1P3F B;  3W96 A;  2HIO C;  2ARO C;  1P3A A;  5CPJ A;  5BT1 C;  4CAY A;  4J8X B;  3B6F C;  3REI D;  3B0D B;  3C1C A;  3REH A;  3AZI A;  1R4V A;  4XUJ C;  5FUG A;  1ID3 C;  5GSU B;  2NQB D;  1P34 C;  5AV8 B;  5BS7 A;  1HTA A;  1M19 D;  3LEL A;  3O62 A;  3KXB C;  4CSR A;  5B2J B;  5AV6 B;  4J8U D;  5B0Z C;  2NZD A;  3AV2 C;  1BH9 A;  5AVC C;  5JA4 A;  4YM6 A;  3W97 B;  3REL D;  1BH8 A;  2F8N B;  2PYO B;  1KX4 D;  3WKJ A;  3B0C W;  5B40 D;  3REJ B;  4XUJ A;  4H9O A;  3X1T C;  1F66 B;  3KUY B;  1ID3 A;  5G49 A;  4ZUX D;  4WNN B;  3AZL D;  1EQZ B;  4H9P A;  3AZJ B;  3AZF C;  3VH5 T;  5JRG A;  3AZE C;  2FJ7 C;  3LZ0 D;  4Z66 C;  3A6N B;  3AZN A;  4KHA B;  4H9S C;  3X1S C;  3X1V C;  3WTP E;  5CPK A;  1P3I A;  1KX5 B;  4QLC B;  5AY8 C;  1P3L D;  4NFT A;  5B1M A;  3W96 B;  5AV9 B;  5KDM A;  5GT3 B;  3AZG D;  3WAA C;  5CPJ B;  3W98 C;  4CAY B;  1U35 D;  1P3M D;  5CPI D;  3C1C B;  3REH B;  3X1U D;  3AZI B;  5GT0 B;  5CP6 A;  1HQ3 C;  3AZH A;  3AZF A;  3REI C;  1S32 D;  5B31 G;  3VH6 T;  4Z66 A;  3LEL B;  4CSR B;  2NQB C;  2YFV B;  4JJN D;  1HQ3 A;  3NQU A;  1M19 C;  1BH9 B;  5JA4 B;  3TU4 B;  2CV5 D;  4J8U C;  4G91 C;  5B2I D;  4YM6 B;  3WA9 D;  3MNN D;  5AV5 D;  4J8W D;  2ARO B;  3W98 A;  3B0C T;  4KUD A;  3B6F B;  3REL C;  1P3F A;  2CWE A;  4LD9 D;  4XUJ B;  5DNM D; 
#chains in the Genus database with same CATH topology
 1ID3 B;  3REI A;  1KX4 C;  3C1B D;  1P34 B;  4H9P B;  5B40 C;  5JRG B;  4X23 D;  5B33 D;  5B32 D;  3KXB B;  4ZUX C;  3AZL C;  3MGP D;  5B0Z B;  2ZM5 A;  3AV2 B;  1P3B A;  1P3O D;  3LZ0 C;  5B2J A;  5AV6 A;  4WU8 D;  5B31 C;  4WZS B;  3MVD D;  1P3L C;  4ZBJ C;  5B32 G;  3X1T B;  3AZG C;  5C3I C;  3MGR D;  2IO5 C;  3V9R A;  1U35 C;  3AZF B;  4Z5T D;  1P3M C;  5CPI C;  3REK D;  3REJ A;  3X1U C;  3AZE B;  2FJ7 B;  4Z66 B;  3B6G D;  4WNN A;  3X1S B;  1EQZ A;  3X1V B;  1S32 C;  5B24 A;  3LZ0 A;  5F99 A;  5AY8 B;  4JJN C;  3VH5 W;  2JE5 A;  2J8P A;  1M18 C;  5B31 A;  1P3K D;  3W98 B;  2CV5 C;  1P3L A;  5B2I C;  2BYM B;  3WA9 C;  4KUD B;  2Y2H A;  5AV5 C;  3MNN C;  3UT9 D;  1P3G D;  5AV9 A;  1HQ3 B;  5GT3 A;  3H0R C;  3REI B;  1ZLA D;  3X1U A;  4LD9 C;  1TZY D;  2Y2L A;  5DNM C;  4J8V D;  3UTB D;  5GT0 A;  2NQB B;  5AVB D;  3H0M C;  3C1B C;  3VH5 A;  4X23 C;  2BYK B;  5B1L C;  5B33 C;  2W8S A;  5B32 C;  1P3B B;  4R8P D;  4G91 B;  3MGP C;  5E5A D;  4J8U B;  4JJN A;  2VQR A;  5BNV B;  1M18 A;  2YFV A;  3AZK A;  3VH6 W;  3MGS D;  3AZM D;  3LJA A;  3TU4 A;  3REL B;  4WU8 C;  2HIO A;  2ARO A;  3MVD C;  1KX4 B;  3V9R B;  4EO5 C;  5B40 B;  3B6F A;  3KWQ C;  3MGR C;  2DQN C;  4Z5T C;  5B1L A;  3REK C;  5B32 A;  1P34 A;  4H9N A;  5B24 B;  4KGC D;  3VH6 A;  3LZ0 B;  1M1A D;  5F99 B;  2XD5 A;  3KXB A;  3B6G C;  3UTA D;  5B0Z A;  3AV2 A;  5B31 B;  5AVC A;  5GXQ D;  1P3L B;  3AN2 D;  4ZBJ B;  3AZG B;  5C3I B;  1P3K C;  4DRB A;  2IO5 B;  3UT9 C;  1AOI D;  5CPI B;  1P3G C;  2F8N D;  3X1U B;  2JCH A;  3KWQ A;  3X1T A;  1F66 D;  1S32 B;  1ZLA C;  1A7W A;  1TZY C;  3AZJ D;  4J8V C;  3UTB C;  3AZE A;  2FJ7 A;  5AVB C;  4JJN B;  3R45 A;  4WV4 B;  2Y2G A;  1M18 B;  4H9S A;  3X1S A;  1WWI A;  3A6N D;  2ZY2 A;  3X1V A;  3AZK B;  2CV5 B;  4R8P C;  5E5A C;  3WA9 B;  1F1E A;  5AV5 B;  3LJA B;  5AY8 A;  1P3K A;  4QLC D;  1W2E A;  3WTP D;  5B0Y D;  2HIO B;  3AV1 D;  3MGS C;  3AZM C;  1P3A D;  3WAA A;  1Z2C B;  2BYM A;  5DNM B;  3AYW D;  3C1C D;  2ZY5 A;  4X23 B;  5B1L B;  5B32 B;  1H3O A;  3UTB A;  4H9N B;  3IP4 C;  5AVB A;  2Y2K A;  3B0D C;  3EPJ A;  2NQB A;  3LEL D;  4M6B A;  3O62 D;  4KGC C;  2BYK A;  3MGQ D;  1N1J A;  1M19 A;  2NZD D;  5DNN D;  5AVC B;  4XZQ D;  1M1A C;  3AFA D;  4J8U A;  1WWS A;  1JFI A;  3UTA C;  4WU8 B;  4YM6 D;  1KX3 D;  5BNV A;  2UWX A;  2Y2N A;  3MGS A;  2XD1 A;  4UUZ A;  5GXQ C;  3AZM A;  3MVD B;  3AN2 C;  2Y2P A;  2L5A A;  3REL A;  3KWQ B;  3WKJ D;  3MGR B;  4HGA C;  4Z5T B;  1AOI C;  4H9Q A;  3REK B;  1KX4 A;  1ID3 D;  2DF4 C;  5B40 A;  5JRG D;  4ZUX A;  3AZL A;  3B6G B;  1T3U A;  3R45 B;  4DRA A;  2HUE C;  4AWL C;  3AZJ C;  1M1A A;  3AZN D;  3W99 D;  1P3P D;  4WU9 D;  5CPK D;  1P3I D;  3A6N C;  1P3K B;  5B1M D;  3WAA B;  3EPH A;  4QLC C;  3WTP C;  5B0Y C;  4J8W C;  3AV1 C;  3AZG A;  3H0L C;  1P3A C;  4H9O B;  1U35 A;  1TZY B;  1P3M A;  5CP6 D;  3AZH D;  5CPI A;  3AZF D;  2Y2Q A;  4J8V B;  1H3O B;  5BO0 A;  3UTB B;  5AVB B;  2F8N K;  3AYW C;  3C1C C;  1S32 A;  5E5A B;  1N1J B;  1M19 B;  5BS7 C;  4E45 A;  1JFI B;  3O62 C;  3MGQ C;  4Z2M G;  3MGS B;  2F2A C;  2NZD C;  5DNN C;  4UUZ B;  4XZQ C;  3AZM B;  5BNX A;  3AFA C;  2CV5 A;  1P3O C;  5B2I A;  3WA9 A;  3LZ1 D;  3WTP A;  5AV5 A;  3MNN A;  4J8W A;  1KX3 C;  4KUD D;  4G92 C;  4NE6 A;  1P3F D;  2Y2M A;  1ULY A;  4YS3 D;  3NQJ A;  1HQ3 D;  4H9Q B;  4LD9 A;  3WKJ C;  3AYW A;  5DNM A;  4J8X D;  4ZUX B;  3AZL B;  3C1B A;  4KGC B;  4X23 A;  5B33 A;  1M1A B;  5JRG C;  5GSU D;  3MGP A;  3UTA B;  1P3B D;  5AV8 D;  3MGQ A;  5DNN A;  1TAF A;  4XZQ A;  5GXQ B;  3AZN C;  3AFA A;  5B2J D;  3W99 C;  5AV6 D;  3AN2 B;  1P3O A;  1P3P C;  4WU9 C;  1KX3 A;  5CPK C;  1P3I C;  4WU8 A;  4HGA B;  5B1M C;  1AOI B;  3MVD A;  3W97 D;  1U35 B;  1P3M B;  5BO0 B;  2PYO D;  3MGR A;  2YFW A;  3REJ D;  4Z5T A;  2HUE B;  5CP6 C;  4AWL B;  3KUY D;  3REK A;  3AZH C;  4H9R A;  1EQZ D;  5B24 D;  3B0B A;  3B6G A;  5F99 D;  1B6W A;  3W99 A;  1BFM A;  1P3P A;  4WU9 A;  5BNX B;  5B31 D;  5B2I B;  2F8N G;  3WTP B;  5B0Y B;  3MNN B;  4J8W B;  3AV1 B;  1KX5 D;  5CHL B;  1P3A B;  3LZ1 C;  2RIQ A;  3NQJ B;  3UT9 A;  5AV9 D;  3A1K A;  1P3G A;  3W96 D;  4KUD C;  5GT3 D;  4LD9 B;  5CPJ D;  3AYW B;  1P3F C;  4YS3 C;  3FDD A;  4UPK A;  5FUG B;  3C1B B;  3REH D;  4E44 A;  3AZI D;  1TZY A;  5GT0 D;  1ZLA A;  1Q9C A;  5B33 B;  4J8X C;  4J8V A;  2JSS A;  4DQY B;  3MGP B;  3O62 B;  2RVQ D;  3MGQ B;  2NZD B;  5DNN B;  1TAF B;  4XZQ B;  5GSU C;  1M18 D;  3AFA B;  4R8P A;  1P3O B;  2Y2I A;  5E5A A;  3AZK D;  4NE5 A;  1P3B C;  5AV8 C;  1KX3 B;  3KSY A;  4Z2M H;  4G92 B;  3LJA D;  5B2J C;  5AV6 C;  3TU4 D;  2LY8 A;  3LZ1 A;  1BH8 B;  2HIO D;  2ARO D;  4EO5 B;  5BT1 D;  3WKJ B;  4YS3 A;  3B6F D;  3W97 C;  4WJ3 C;  2YFW B;  5G49 B;  4XUJ D;  4J8X A;  5B1L D;  4H9R B;  2PYO C;  1P34 D;  3REJ C;  1F66 C;  3EPK A;  3KUY C;  3AZN B;  5GSU A;  3KXB D;  4KGC A;  3W99 B;  1EQZ C;  1P3P B;  5B0Z D;  5B24 C;  4WU9 B;  5AV8 A;  3AV2 D;  5CPK B;  1P3I B;  5AVC D;  5F99 C;  3UTA A;  5B1M B;  2G5I C;  5GXQ A;  1B67 A;  5KDM B;  3AN2 A;  3UT9 B;  1P3G B;  1KX5 C;  2ZY3 A;  3W97 A;  3KWQ D;  3W96 C;  1AOI A;  5AV9 C;  5CP6 B;  3X1T D;  3AZH B;  5GT3 C;  2F8N A;  1ZLA B;  5CPJ C;  2PYO A;  1F66 A;  4NE3 A;  3KUY A;  3REH C;  3AZE D;  3AZI C;  2FJ7 D;  5GT0 C;  4Z66 D;  3AZJ A;  3NQU B;  3F6T A;  3X1S D;  1KU5 A;  4R8P B;  3X1V D;  2RVQ C;  3A6N A;  3LEL C;  4KHA A;  5AY8 D;  3LZ1 B;  3AZK C;  2F8N H;  1KX5 A;  3WAA D;  4QLC A;  3LJA C;  3TU4 C;  3W98 D;  5B0Y A;  4YM6 C;  3AV1 A;  4YS3 B;  1P3F B;  3W96 A;  2HIO C;  2ARO C;  1P3A A;  5CPJ A;  5BT1 C;  4CAY A;  4J8X B;  3B6F C;  3REI D;  3B0D B;  3C1C A;  3REH A;  3AZI A;  1R4V A;  4XUJ C;  5FUG A;  1ID3 C;  5GSU B;  2NQB D;  1P34 C;  5AV8 B;  5BS7 A;  1HTA A;  1M19 D;  3LEL A;  3O62 A;  3KXB C;  4CSR A;  5B2J B;  5AV6 B;  4J8U D;  5B0Z C;  2NZD A;  3P5J B;  3AV2 C;  1BH9 A;  5AVC C;  5JA4 A;  4YM6 A;  3W97 B;  3REL D;  1BH8 A;  2G5H C;  3KFU G;  2F8N B;  2PYO B;  1KX4 D;  3WKJ A;  3B0C W;  5B40 D;  3REJ B;  4XUJ A;  4H9O A;  3X1T C;  1F66 B;  3KUY B;  1ID3 A;  5G49 A;  4ZUX D;  4WNN B;  3AZL D;  1EQZ B;  4H9P A;  3AZJ B;  3AZF C;  3VH5 T;  5JRG A;  3AZE C;  2FJ7 C;  3LZ0 D;  4Z66 C;  2ZY4 A;  3A6N B;  3AZN A;  4KHA B;  4H9S C;  3X1S C;  3X1V C;  3WTP E;  3EG5 B;  5CPK A;  1P3I A;  1KX5 B;  4QLC B;  5AY8 C;  1P3L D;  2Y2J A;  4NFT A;  5B1M A;  3W96 B;  5AV9 B;  5KDM A;  5GT3 B;  3AZG D;  3WAA C;  5CPJ B;  3W98 C;  2Y2O A;  4CAY B;  1U35 D;  1P3M D;  5CPI D;  3C1C B;  3REH B;  3X1U D;  3AZI B;  5GT0 B;  5CP6 A;  1HQ3 C;  3AZH A;  3AZF A;  3REI C;  1S32 D;  5B31 G;  3AL0 C;  3VH6 T;  4Z66 A;  3LEL B;  3A1I A;  4CSR B;  2NQB C;  2FFF B;  2YFV B;  4JJN D;  1HQ3 A;  3NQU A;  1M19 C;  1PZR A;  1BH9 B;  2BG1 A;  5JA4 B;  3TU4 B;  2CV5 D;  3EPL A;  4G91 C;  5B2I D;  4YM6 B;  4J8U C;  3WA9 D;  3MNN D;  5AV5 D;  4J8W D;  2ARO B;  3W98 A;  3B0C T;  4KUD A;  3B6F B;  3REL C;  1P3F A;  2CWE A;  4LD9 D;  4XUJ B;  5DNM D; 
#chains in the Genus database with same CATH homology
 1ID3 B;  3REI A;  1KX4 C;  3C1B D;  1P34 B;  4H9P B;  5B40 C;  5JRG B;  4X23 D;  5B33 D;  5B32 D;  3KXB B;  4ZUX C;  3AZL C;  3MGP D;  5B0Z B;  2ZM5 A;  3AV2 B;  1P3B A;  1P3O D;  3LZ0 C;  5B2J A;  5AV6 A;  4WU8 D;  5B31 C;  4WZS B;  3MVD D;  1P3L C;  4ZBJ C;  5B32 G;  3X1T B;  3AZG C;  5C3I C;  3MGR D;  2IO5 C;  3V9R A;  1U35 C;  3AZF B;  4Z5T D;  1P3M C;  5CPI C;  3REK D;  3REJ A;  3X1U C;  3AZE B;  2FJ7 B;  4Z66 B;  3B6G D;  4WNN A;  3X1S B;  1EQZ A;  3X1V B;  1S32 C;  5B24 A;  3LZ0 A;  5F99 A;  5AY8 B;  4JJN C;  3VH5 W;  2JE5 A;  2J8P A;  1M18 C;  5B31 A;  1P3K D;  3W98 B;  2CV5 C;  1P3L A;  5B2I C;  2BYM B;  3WA9 C;  4KUD B;  2Y2H A;  5AV5 C;  3MNN C;  3UT9 D;  1P3G D;  5AV9 A;  1HQ3 B;  5GT3 A;  3H0R C;  3REI B;  1ZLA D;  3X1U A;  4LD9 C;  1TZY D;  2Y2L A;  5DNM C;  4J8V D;  3UTB D;  5GT0 A;  2NQB B;  5AVB D;  3H0M C;  3C1B C;  3VH5 A;  4X23 C;  2BYK B;  5B1L C;  5B33 C;  2W8S A;  5B32 C;  1P3B B;  4R8P D;  4G91 B;  3MGP C;  5E5A D;  4J8U B;  4JJN A;  2VQR A;  5BNV B;  1M18 A;  2YFV A;  3AZK A;  3VH6 W;  3MGS D;  3AZM D;  3LJA A;  3TU4 A;  3REL B;  4WU8 C;  2HIO A;  2ARO A;  3MVD C;  1KX4 B;  3V9R B;  4EO5 C;  5B40 B;  3B6F A;  3KWQ C;  3MGR C;  2DQN C;  4Z5T C;  5B1L A;  3REK C;  5B32 A;  1P34 A;  4H9N A;  5B24 B;  4KGC D;  3VH6 A;  3LZ0 B;  1M1A D;  5F99 B;  2XD5 A;  3KXB A;  3B6G C;  3UTA D;  5B0Z A;  3AV2 A;  5B31 B;  5AVC A;  5GXQ D;  1P3L B;  3AN2 D;  4ZBJ B;  3AZG B;  5C3I B;  1P3K C;  4DRB A;  2IO5 B;  3UT9 C;  1AOI D;  5CPI B;  1P3G C;  2F8N D;  3X1U B;  2JCH A;  3KWQ A;  3X1T A;  1F66 D;  1S32 B;  1ZLA C;  1A7W A;  1TZY C;  3AZJ D;  4J8V C;  3UTB C;  3AZE A;  2FJ7 A;  5AVB C;  4JJN B;  3R45 A;  4WV4 B;  2Y2G A;  1M18 B;  4H9S A;  3X1S A;  1WWI A;  3A6N D;  2ZY2 A;  3X1V A;  3AZK B;  2CV5 B;  4R8P C;  5E5A C;  3WA9 B;  1F1E A;  5AV5 B;  3LJA B;  5AY8 A;  1P3K A;  4QLC D;  1W2E A;  3WTP D;  5B0Y D;  2HIO B;  3AV1 D;  3MGS C;  3AZM C;  1P3A D;  3WAA A;  1Z2C B;  2BYM A;  5DNM B;  3AYW D;  3C1C D;  2ZY5 A;  4X23 B;  5B1L B;  5B32 B;  1H3O A;  3UTB A;  4H9N B;  3IP4 C;  5AVB A;  2Y2K A;  3B0D C;  3EPJ A;  2NQB A;  3LEL D;  4M6B A;  3O62 D;  4KGC C;  2BYK A;  3MGQ D;  1N1J A;  1M19 A;  2NZD D;  5DNN D;  5AVC B;  4XZQ D;  1M1A C;  3AFA D;  4J8U A;  1WWS A;  1JFI A;  3UTA C;  4WU8 B;  4YM6 D;  1KX3 D;  5BNV A;  2UWX A;  2Y2N A;  3MGS A;  2XD1 A;  4UUZ A;  5GXQ C;  3AZM A;  3MVD B;  3AN2 C;  2Y2P A;  2L5A A;  3REL A;  3KWQ B;  3WKJ D;  3MGR B;  4HGA C;  4Z5T B;  1AOI C;  4H9Q A;  3REK B;  1KX4 A;  1ID3 D;  2DF4 C;  5B40 A;  5JRG D;  4ZUX A;  3AZL A;  3B6G B;  1T3U A;  3R45 B;  4DRA A;  2HUE C;  4AWL C;  3AZJ C;  1M1A A;  3AZN D;  3W99 D;  1P3P D;  4WU9 D;  5CPK D;  1P3I D;  3A6N C;  1P3K B;  5B1M D;  3WAA B;  3EPH A;  4QLC C;  3WTP C;  5B0Y C;  4J8W C;  3AV1 C;  3AZG A;  3H0L C;  1P3A C;  4H9O B;  1U35 A;  1TZY B;  1P3M A;  5CP6 D;  3AZH D;  5CPI A;  3AZF D;  2Y2Q A;  4J8V B;  1H3O B;  5BO0 A;  3UTB B;  5AVB B;  2F8N K;  3AYW C;  3C1C C;  1S32 A;  5E5A B;  1N1J B;  1M19 B;  5BS7 C;  4E45 A;  1JFI B;  3O62 C;  3MGQ C;  4Z2M G;  3MGS B;  2F2A C;  2NZD C;  5DNN C;  4UUZ B;  4XZQ C;  3AZM B;  5BNX A;  3AFA C;  2CV5 A;  1P3O C;  5B2I A;  3WA9 A;  3LZ1 D;  3WTP A;  5AV5 A;  3MNN A;  4J8W A;  1KX3 C;  4KUD D;  4G92 C;  4NE6 A;  1P3F D;  2Y2M A;  1ULY A;  4YS3 D;  3NQJ A;  1HQ3 D;  4H9Q B;  4LD9 A;  3WKJ C;  3AYW A;  5DNM A;  4J8X D;  4ZUX B;  3AZL B;  3C1B A;  4KGC B;  4X23 A;  5B33 A;  1M1A B;  5JRG C;  5GSU D;  3MGP A;  3UTA B;  1P3B D;  5AV8 D;  3MGQ A;  5DNN A;  1TAF A;  4XZQ A;  5GXQ B;  3AZN C;  3AFA A;  5B2J D;  3W99 C;  5AV6 D;  3AN2 B;  1P3O A;  1P3P C;  4WU9 C;  1KX3 A;  5CPK C;  1P3I C;  4WU8 A;  4HGA B;  5B1M C;  1AOI B;  3MVD A;  3W97 D;  1U35 B;  1P3M B;  5BO0 B;  2PYO D;  3MGR A;  2YFW A;  3REJ D;  4Z5T A;  2HUE B;  5CP6 C;  4AWL B;  3KUY D;  3REK A;  3AZH C;  4H9R A;  1EQZ D;  5B24 D;  3B0B A;  3B6G A;  5F99 D;  1B6W A;  3W99 A;  1BFM A;  1P3P A;  4WU9 A;  5BNX B;  5B31 D;  5B2I B;  2F8N G;  3WTP B;  5B0Y B;  3MNN B;  4J8W B;  3AV1 B;  1KX5 D;  5CHL B;  1P3A B;  3LZ1 C;  2RIQ A;  3NQJ B;  3UT9 A;  5AV9 D;  3A1K A;  1P3G A;  3W96 D;  4KUD C;  5GT3 D;  4LD9 B;  5CPJ D;  3AYW B;  1P3F C;  4YS3 C;  3FDD A;  4UPK A;  5FUG B;  3C1B B;  3REH D;  4E44 A;  3AZI D;  1TZY A;  5GT0 D;  1ZLA A;  1Q9C A;  5B33 B;  4J8X C;  4J8V A;  2JSS A;  4DQY B;  3MGP B;  3O62 B;  2RVQ D;  3MGQ B;  2NZD B;  5DNN B;  1TAF B;  4XZQ B;  5GSU C;  1M18 D;  3AFA B;  4R8P A;  1P3O B;  2Y2I A;  5E5A A;  3AZK D;  4NE5 A;  1P3B C;  5AV8 C;  1KX3 B;  3KSY A;  4Z2M H;  4G92 B;  3LJA D;  5B2J C;  5AV6 C;  3TU4 D;  2LY8 A;  3LZ1 A;  1BH8 B;  2HIO D;  2ARO D;  4EO5 B;  5BT1 D;  3WKJ B;  4YS3 A;  3B6F D;  3W97 C;  4WJ3 C;  2YFW B;  5G49 B;  4XUJ D;  4J8X A;  5B1L D;  4H9R B;  2PYO C;  1P34 D;  3REJ C;  1F66 C;  3EPK A;  3KUY C;  3AZN B;  5GSU A;  3KXB D;  4KGC A;  3W99 B;  1EQZ C;  1P3P B;  5B0Z D;  5B24 C;  4WU9 B;  5AV8 A;  3AV2 D;  5CPK B;  1P3I B;  5AVC D;  5F99 C;  3UTA A;  5B1M B;  2G5I C;  5GXQ A;  1B67 A;  5KDM B;  3AN2 A;  3UT9 B;  1P3G B;  1KX5 C;  2ZY3 A;  3W97 A;  3KWQ D;  3W96 C;  1AOI A;  5AV9 C;  5CP6 B;  3X1T D;  3AZH B;  5GT3 C;  2F8N A;  1ZLA B;  5CPJ C;  2PYO A;  1F66 A;  4NE3 A;  3KUY A;  3REH C;  3AZE D;  3AZI C;  2FJ7 D;  5GT0 C;  4Z66 D;  3AZJ A;  3NQU B;  3F6T A;  3X1S D;  1KU5 A;  4R8P B;  3X1V D;  2RVQ C;  3A6N A;  3LEL C;  4KHA A;  5AY8 D;  3LZ1 B;  3AZK C;  2F8N H;  1KX5 A;  3WAA D;  4QLC A;  3LJA C;  3TU4 C;  3W98 D;  5B0Y A;  4YM6 C;  3AV1 A;  4YS3 B;  1P3F B;  3W96 A;  2HIO C;  2ARO C;  1P3A A;  5CPJ A;  5BT1 C;  4CAY A;  4J8X B;  3B6F C;  3REI D;  3B0D B;  3C1C A;  3REH A;  3AZI A;  1R4V A;  4XUJ C;  5FUG A;  1ID3 C;  5GSU B;  2NQB D;  1P34 C;  5AV8 B;  5BS7 A;  1HTA A;  1M19 D;  3LEL A;  3O62 A;  3KXB C;  4CSR A;  5B2J B;  5AV6 B;  4J8U D;  5B0Z C;  2NZD A;  3P5J B;  3AV2 C;  1BH9 A;  5AVC C;  5JA4 A;  4YM6 A;  3W97 B;  3REL D;  1BH8 A;  2G5H C;  3KFU G;  2F8N B;  2PYO B;  1KX4 D;  3WKJ A;  3B0C W;  5B40 D;  3REJ B;  4XUJ A;  4H9O A;  3X1T C;  1F66 B;  3KUY B;  1ID3 A;  5G49 A;  4ZUX D;  4WNN B;  3AZL D;  1EQZ B;  4H9P A;  3AZJ B;  3AZF C;  3VH5 T;  5JRG A;  3AZE C;  2FJ7 C;  3LZ0 D;  4Z66 C;  2ZY4 A;  3A6N B;  3AZN A;  4KHA B;  4H9S C;  3X1S C;  3X1V C;  3WTP E;  3EG5 B;  5CPK A;  1P3I A;  1KX5 B;  4QLC B;  5AY8 C;  1P3L D;  2Y2J A;  4NFT A;  5B1M A;  3W96 B;  5AV9 B;  5KDM A;  5GT3 B;  3AZG D;  3WAA C;  5CPJ B;  3W98 C;  2Y2O A;  4CAY B;  1U35 D;  1P3M D;  5CPI D;  3C1C B;  3REH B;  3X1U D;  3AZI B;  5GT0 B;  5CP6 A;  1HQ3 C;  3AZH A;  3AZF A;  3REI C;  1S32 D;  5B31 G;  3AL0 C;  3VH6 T;  4Z66 A;  3LEL B;  3A1I A;  4CSR B;  2NQB C;  2FFF B;  2YFV B;  4JJN D;  1HQ3 A;  3NQU A;  1M19 C;  1PZR A;  1BH9 B;  2BG1 A;  5JA4 B;  3TU4 B;  2CV5 D;  3EPL A;  4G91 C;  5B2I D;  4YM6 B;  4J8U C;  3WA9 D;  3MNN D;  5AV5 D;  4J8W D;  2ARO B;  3W98 A;  3B0C T;  4KUD A;  3B6F B;  3REL C;  1P3F A;  2CWE A;  4LD9 D;  4XUJ B;  5DNM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...