3AZIC

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziC00
1P3BC 1P34B 3AN2A 2BYKB 4J8WC 3REHA 3AZID 5AV8C 1BH9B 5BO0A 4YM6B 3X1UA 3WTPE 3MGSC 3KUYC 3UT9C 4Z66A 4X23C 4XZQC 2HUEB 3REIC 4J8UA 4CSRB 3MGPB 5B24B 1M18C 4KUDA 4XUJA 5B1MB 1P34A 5B33C 3A6NC 5CPKC 3R45B 1TZYC 4ZBJC 3WKJB 4LD9C 3REKC 5GT0B 3B0CT 3W96D 1P3OB 3UTAC 1P3LA 2F8NG 2YFWB 4R8PA 3MGPA 3REJB 3NQUB 1JFIB 3LJAA 3AZHD 5AV9B 3RELA 4KGCD 5AV5C 1EQZB 5AVCD 5AY8D 5CPIB 1F66A 5B2JA 3WKJA 4E45A 3AV1A 1TAFB 4H9OB 5BNVB 2PYOB 1N1JB 2YFWA 5G49A 4EO5B 1F1EA 5AV6C 5F99C 3NQUA 1JFIA 4G91C 3O62C 4J8WD 3AYWD 3AZGC 3UT9D 1BH8B 1KX3C 2YFVA 4WU9D 3W97C 4XZQD 5B0YC 3AFAC 5KDMB 3KWQC 3WAAC 1P3GC 1U35B 1M18D 5B2IC 5B31B 2NQBA 3AZMC 4KHAA 3LZ1A 3X1SB 1AOIB 1HQ3A 1TZYD 2CV5C 2F8NA 4YM6D 5B32B 1U35A 3W99C 5CP6A 3TU4B 1M1AB 3AV2A 3AZFC 5DNNB 3MVDB 3MGRB 5GXQB 1P3KB 3X1TA 5B24D 1P3FA 5B1MD 1AOIA 1M19A 5CPJC 5E5AA 2NZDC 5B32A 5GSUC 4H9SA 5GT0D 4QLCC 5AV6D 3AZIA 1P3OD 4JJNB 1P3MB 4H9PA 3REJD 3KXBC 3W98C 4Z2MH 3MGQB 3W96B 5AV9D 1B6WA 5JRGB 5B40C 4Z5TC 1EQZD 5CPID 4J8VB 3B6FC 3B6GC 3AZLC 3WTPB 4CAYA 5B0ZC 5AVCB 1S32C 4ZUXC 2PYOD 1ULYA 5C3IC 1ZLAC 4YS3B 1KU5A 4M6BA 3W96A 1BFMA 3C1BC 4H9QA 1P3PC 2CWEA 1P3BB 3AZHA 4J8WB 4KGCA 5AV8B 3MGSB 3KUYB 3VH5T 5AY8A 5AVCA 3UT9B 4X23B 3AZJC 3AZKC 5B1LC 4XZQB 3LZ0C 3AZNC 3AZEC 5B31D 3REIB 1M18B 3X1SD 3NQJA 3LELC 5B33B 4J8WA 3A6NB 3AYWA 3UT9A 5CPKB 4ZBJB 1TZYB 3TU4D 1M1AD 4NE5A 5BT1D 3X1VC 4WNNA 1KX5C 4WU9A 3REKB 4XZQA 5DNND 3MVDD 3MGRD 4LD9B 5GXQD 1P3KD 3UTAB 3B6FD 1M18A 3B6GD 3AZLD 1P3AC 3WA9C 1R4VA 4NE6A 5AV5B 4ZUXD 5GT3C 1TZYA 2BYKA 1ZLAD 5AVBC 1BH9A 4YM6A 4JJND 1P3MD 1P3PD 3MGQD 1ID3C 4NE3A 5JRGD 5AV6B 5F99B 3VH6T 4G91B 5BS7C 3O62B 1H3OB 4CSRA 4J8VD 4AWLC 5B24A 2IO5C 3AZGB 3AN2C 5B1MA 1KX3B 3X1UC 3WTPD 3W97B 4H9RB 5B0YB 3AFAB 3AZND 3KWQB 3WAAB 1P3GB 5FUGB 2LY8A 2L5AA 3R45A 4YS3D 4J8UC 5GT0A 5B2IB 5AV6A 1P3OA 1P3IC 3AZMB 4XUJC 2AROC 5B32G 3REJA 4DRAA 1P3BD 3X1VD 2CV5B 5AV9A 5AV8D 3MGSD 3KUYD 1EQZA 5CPIA 3W99B 4X23D 3AZFB 1P3LC 3REID 4R8PC 4E44A 1TAFA 4H9OA 2RVQC 5BNVA 3LJAC 2PYOA 1N1JA 3RELC 1B67A 3MNNC 1F66C 5CPJB 5B33D 3A6ND 5AVBD 2NZDB 5B2JC 1KX4C 5CPKD 1BH8A 5GSUB 3AV1C 4LD9D 3REKD 5KDMA 5BNXB 4QLCB 3UTAD 3KXBB 3W98B 3V9RB 4G92C 5B31A 5AV5D 5B40B 4Z5TB 3B6FB 3B6GB 3X1SA 3AZLB 5BNXA 5B0ZB 1S32B 1P3ID 4ZUXB 2AROD 2NQBC 3TU4A 5C3IB 5DNMC 1M1AA 3W98A 1ZLAB 5F99D 3V9RA 5DNNA 3MVDA 3MGRA 3O62D 3LZ1C 5GXQA 1P3KA 3C1BB 1HQ3C 3AZGD 1P3PB 4J8XB 3B6FA 1KX3D 3B6GA 3W97D 5B0YD 3AFAD 4H9NB 5CP6C 3KWQD 3WAAD 1P3GD 3AV2C 4ZUXA 3AZJB 3AZKB 5B1LB 3X1TC 3LZ0B 3AZNB 3AZEB 5B2ID 3MNND 1ZLAA 1P3FC 4JJNA 2BYMB 3AZMD 1P3MA 1M19C 5E5AC 1KX4D 3C1CC 3LELB 3MGQA 2CV5D 5JRGA 4J8VA 3W99D 4J8XC 3AZIC 3X1VB 3WTPA 3AZFD 1KX5B 3AZNA 5JA4B 4NFTA 3WA9B 1P3AB 4YS3A 5CPJD 3B0DC 2NZDD 1WWSA 2JSSA 5GSUD 4WU8C 5GT3B 1P3BA 5DNMD 4QLCD 3X1VA 5AV8A 5AVBB 3MGSA 3KSYA 3KUYA 3KXBD 4X23A 2HIOB 1ID3B 3UTBC 1Q9CA 5B40D 4Z5TD 3REIA 3B0CW 4AWLB 2IO5B 3AN2B 4KGCC 3X1UB 5AY8C 3VH5A 5B33A 2F8NH 5B0ZD 3A6NA 1S32D 5AVBA 5CPKA 4LD9A 3C1CD 3REKA 4J8UB 3C1BD 1P3IB 4XUJB 3UTAA 2HIOC 2AROB 2FJ7C 4J8XD 3AYWC 4HGAC 5AV5A 3REHC 4WU9C 3AZJD 3AZKD 5B1LD 3LZ0D 4Z66C 3AZED 1P3LB 5B31G 4R8PB 1P3IA 3LJAB 2AROA 3RELB 4WU8D 3LELD 3MNNB 4KUDC 5F99A 1F66B 3O62A 1H3OA 5B2JB 3AZGA 1P34C 1KX4B 3AV1B 1KX3A 4YM6C 1KX5D 3W97A 4H9RA 5B0YA 3AFAA 3KWQA 3WAAA 3UTBD 1P3GA 5G49B 5FUGA 3W98D 2HUEC 3VH6A 1P3AD 3WA9D 4G92B 3MGPC 5B24C 5B2IA 3MNNA 4WV4B 3AZMA 5B1MC 2YFVB 1KX4A 5GT3D 2CV5A 3B0BA 3WKJC 3W99A 2HIOD 5GT0C 2FJ7D 1P3OC 2NQBB 1ID3D 5DNMB 4KHAB 3AZFA 3REJC 3LZ1B 4UUZB 1HQ3B 3AN2D 5AV9C 3REHD 2F8NB 3X1UD 1EQZC 5CPIC 5CHLB 5CPJA 5CP6B 4Z66D 2NZDA 3AV2B 5GSUA 4J8UD 3X1TB 5DNMA 4QLCA 4KUDD 1P3FB 2PYOC 4XUJD 4EO5C 4UUZA 1M19B 3KXBA 5E5AB 1P34D 3C1CB 1HTAA 5B40A 4Z5TA 3AZLA 3AZIB 1U35C 1P3LD 4H9PB 1A7WA 4R8PD 3MGPD 5B0ZA 1S32A 2RVQD 3LJAD 3RELD 5B31C 3VH5W 3C1CA 1F66D 3B0DB 3X1SC 3C1BA 1AOIC 5B2JD 3WKJD 1P3PA 4WU8B 4J8XA 3AV1D 4CAYB 5B32C 4H9NA 4H9SC 3TU4C 1M1AC 5BT1C 5DNNC 3MVDC 3MGRC 3AZJA 4WZSB 5GXQC 5B1LA 3AZKA 3LZ0A 1P3KC 3AZEA 4H9QB 3UTBB 2BYMA 3AZHB 4WU8A 4KGCB 3LELA 5AY8B 4DRBA 4Z2MG 2NQBD 4JJNC 1KX5A 1P3MC 5JA4A 3LZ1D 3UTBA 1HQ3D 3NQJB 3W96C 3MGQC 5JRGC 2F8NK 2FJ7B 2F8ND 3WA9A 1P3AA 4J8VC 5CP6D 3AYWB 1U35D 4HGAB 3AV2D 3VH6W 4WNNB 3WTPC 3REHB 3AZHC 4WU9B 5BO0B 5GT3A 5AVCC 3X1TD 4Z66B 1P3FD 1AOID 4YS3C 1M19D 5E5AD 2HIOA 2FJ7A 1ID3A 4KUDB 5B32D 1WWIA 5BS7A
chains in the Genus database with same CATH superfamily
1P3BC 1P34B 3AN2A 2BYKB 4J8WC 3REHA 3AZID 5AV8C 1BH9B 5BO0A 4YM6B 3X1UA 3WTPE 3MGSC 3KUYC 2Y2QA 3UT9C 4Z66A 4X23C 4XZQC 2BG1A 2HUEB 3REIC 4J8UA 4CSRB 3MGPB 5B24B 1M18C 4KUDA 4XUJA 5B1MB 1P34A 5B33C 3A6NC 3EPHA 2XD5A 5CPKC 3R45B 1TZYC 4ZBJC 3WKJB 4LD9C 3REKC 5GT0B 3B0CT 3W96D 1P3OB 3UTAC 1P3LA 2F8NG 2YFWB 4R8PA 3MGPA 3REJB 3NQUB 1JFIB 3LJAA 2JCHA 5AV9B 3AZHD 3RELA 4KGCD 5AV5C 2VQRA 1EQZB 5AVCD 5AY8D 5CPIB 1F66A 5B2JA 3WKJA 4E45A 3AV1A 1TAFB 4H9OB 5BNVB 2PYOB 1N1JB 2YFWA 5G49A 4EO5B 1F1EA 3IP4C 5AV6C 5F99C 3NQUA 1JFIA 4G91C 3F6TA 3O62C 4J8WD 3AYWD 3AZGC 3UT9D 1BH8B 1KX3C 2YFVA 4WU9D 3W97C 4XZQD 5B0YC 3AFAC 5KDMB 3KWQC 3WAAC 1P3GC 1U35B 1M18D 2XD1A 5B2IC 5B31B 2NQBA 3AZMC 4KHAA 3LZ1A 3X1SB 1AOIB 1HQ3A 1TZYD 2CV5C 2F8NA 4YM6D 5B32B 1U35A 3W99C 5CP6A 3TU4B 1M1AB 3AV2A 3AZFC 2UWXA 5DNNB 3MVDB 3MGRB 5GXQB 1P3KB 3X1TA 5B24D 1P3FA 5B1MD 1AOIA 1M19A 3EPJA 5E5AA 5CPJC 2NZDC 5B32A 5GSUC 4H9SA 5GT0D 4QLCC 5AV6D 3AZIA 1P3OD 4JJNB 2RIQA 1P3MB 4H9PA 3REJD 3KXBC 2DQNC 3W98C 4Z2MH 3MGQB 3W96B 2Y2OA 1B6WA 5JRGB 5AV9D 5B40C 4Z5TC 1EQZD 5CPID 4J8VB 3B6FC 3B6GC 3AZLC 3WTPB 4CAYA 5B0ZC 5AVCB 1S32C 4ZUXC 2PYOD 2Y2NA 1ULYA 5C3IC 1ZLAC 4YS3B 1KU5A 4M6BA 3W96A 1BFMA 3C1BC 4H9QA 1P3PC 2CWEA 1P3BB 3AZHA 4J8WB 4KGCA 5AV8B 3MGSB 3KUYB 2G5IC 3VH5T 5AY8A 5AVCA 3UT9B 4X23B 3AZJC 3AZKC 5B1LC 4XZQB 3LZ0C 3AZNC 3AZEC 5B31D 3REIB 1M18B 3X1SD 3NQJA 3LELC 3A1IA 5B33B 4J8WA 3A6NB 3AYWA 2W8SA 3UT9A 4ZBJB 1TZYB 3TU4D 5CPKB 4NE5A 5BT1D 3X1VC 4WNNA 1M1AD 4WU9A 3REKB 4XZQA 5DNND 3MVDD 3MGRD 1KX5C 5GXQD 1P3KD 3UTAB 3B6FD 1M18A 3B6GD 3AZLD 1P3AC 3WA9C 1R4VA 4NE6A 5AV5B 4WJ3C 4ZUXD 5GT3C 1TZYA 2BYKA 1ZLAD 5AVBC 1BH9A 4YM6A 4JJND 1P3MD 1Z2CB 1P3PD 3MGQD 1ID3C 4NE3A 5AV6B 5JRGD 5F99B 3VH6T 4G91B 5BS7C 3O62B 1H3OB 4CSRA 4J8VD 4AWLC 5B24A 2IO5C 3AZGB 3AN2C 5B1MA 1KX3B 3X1UC 3WTPD 3W97B 4H9RB 5B0YB 3AFAB 3AZND 3KWQB 3WAAB 3FDDA 1P3GB 3P5JB 5FUGB 2LY8A 2L5AA 3R45A 2Y2LA 4YS3D 4J8UC 1W2EA 5GT0A 5B2IB 5AV6A 1P3OA 1P3IC 3AZMB 4XUJC 2AROC 5B32G 3REJA 4DRAA 1P3BD 3KFUG 3X1VD 2CV5B 5AV9A 5AV8D 3MGSD 3KUYD 1EQZA 5CPIA 2Y2JA 3W99B 4X23D 3AZFB 1P3LC 3REID 4R8PC 4E44A 1TAFA 4H9OA 2RVQC 5BNVA 3LJAC 2PYOA 1N1JA 3RELC 1B67A 3MNNC 1F66C 5CPJB 5B33D 3A6ND 5AVBD 2NZDB 5B2JC 1KX4C 5CPKD 1BH8A 5GSUB 3AV1C 4LD9D 3REKD 5KDMA 5BNXB 4QLCB 3UTAD 2JE5A 3KXBB 3W98B 3V9RB 4G92C 5B31A 5AV5D 5B40B 4Z5TB 3B6FB 3B6GB 3X1SA 3AZLB 2ZY2A 5BNXA 5B0ZB 1S32B 1P3ID 4ZUXB 2AROD 2NQBC 3TU4A 5C3IB 5DNMC 1M1AA 3W98A 1ZLAB 5F99D 3V9RA 5DNNA 3MVDA 3MGRA 3O62D 3LZ1C 5GXQA 1P3KA 3C1BB 1HQ3C 3AZGD 1P3PB 4J8XB 3B6FA 1KX3D 3B6GA 3W97D 5B0YD 3AFAD 4H9NB 5CP6C 3KWQD 3WAAD 1P3GD 3AV2C 1PZRA 4ZUXA 3AZJB 3AZKB 5B1LB 3X1TC 3LZ0B 3AZNB 3AZEB 5B2ID 3MNND 1ZLAA 1P3FC 4JJNA 2BYMB 3AZMD 1P3MA 1M19C 3A1KA 5E5AC 1KX4D 3C1CC 2Y2KA 3LELB 3MGQA 2CV5D 5JRGA 2Y2HA 4J8VA 3W99D 4J8XC 3AZIC 3X1VB 3WTPA 3AZFD 1KX5B 3AZNA 5JA4B 4NFTA 3WA9B 1P3AB 4YS3A 5CPJD 1T3UA 3B0DC 2NZDD 1WWSA 2JSSA 5GSUD 4WU8C 5GT3B 1P3BA 5DNMD 4QLCD 3X1VA 2G5HC 5AV8A 5AVBB 3MGSA 3KSYA 3KUYA 3KXBD 4X23A 2HIOB 1ID3B 2F2AC 3UTBC 1Q9CA 5B40D 4Z5TD 3REIA 3B0CW 4AWLB 2IO5B 3AN2B 4KGCC 3X1UB 5AY8C 3VH5A 5B33A 2F8NH 5B0ZD 3A6NA 1S32D 5AVBA 5CPKA 4LD9A 3C1CD 3REKA 4J8UB 3C1BD 1P3IB 4XUJB 2ZY4A 2HIOC 3UTAA 2AROB 2FJ7C 4J8XD 3AYWC 4HGAC 5AV5A 3REHC 4WU9C 3AZJD 3AZKD 5B1LD 3LZ0D 4Z66C 3AZED 1P3LB 5B31G 4R8PB 1P3IA 2DF4C 3LJAB 2AROA 3RELB 4WU8D 3LELD 3MNNB 4KUDC 5F99A 1F66B 3H0LC 3O62A 1H3OA 5B2JB 2ZM5A 3AZGA 1P34C 1KX4B 3AL0C 3AV1B 1KX3A 4YM6C 1KX5D 3W97A 4H9RA 5B0YA 3AFAA 3KWQA 3WAAA 2Y2GA 3UTBD 1P3GA 5G49B 5FUGA 3W98D 2FFFB 2HUEC 3VH6A 1P3AD 3WA9D 4G92B 3MGPC 5B24C 5B2IA 3MNNA 4WV4B 3AZMA 5B1MC 2YFVB 1KX4A 5GT3D 2Y2MA 2CV5A 3B0BA 3WKJC 3W99A 2HIOD 5GT0C 2FJ7D 1P3OC 2NQBB 1ID3D 5DNMB 4KHAB 4LD9B 3AZFA 3REJC 3LZ1B 4UUZB 1HQ3B 3EG5B 3AN2D 5AV9C 3REHD 2F8NB 3X1UD 1EQZC 5CPIC 5CHLB 5CPJA 5CP6B 4Z66D 2NZDA 3AV2B 2J8PA 5GSUA 4DQYB 4J8UD 3X1TB 5DNMA 4QLCA 4KUDD 1P3FB 2PYOC 4XUJD 4EO5C 4UUZA 1M19B 3KXBA 5E5AB 1P34D 3C1CB 1HTAA 5B40A 4Z5TA 3AZLA 3AZIB 1U35C 1P3LD 2Y2PA 4H9PB 1A7WA 4R8PD 3MGPD 2ZY3A 5B0ZA 1S32A 2RVQD 3LJAD 3RELD 5B31C 3H0RC 3VH5W 3C1CA 1F66D 3B0DB 2ZY5A 3X1SC 3C1BA 1AOIC 5B2JD 3WKJD 1P3PA 4WU8B 4J8XA 3AV1D 4CAYB 5B32C 4H9NA 4H9SC 2Y2IA 3TU4C 1M1AC 5BT1C 5DNNC 3MVDC 3MGRC 4UPKA 4WZSB 5GXQC 5B1LA 3AZJA 3LZ0A 3AZKA 1P3KC 3AZEA 4H9QB 3UTBB 2BYMA 3AZHB 4WU8A 4KGCB 3LELA 5AY8B 4DRBA 4Z2MG 2NQBD 4JJNC 1KX5A 1P3MC 3EPKA 5JA4A 3LZ1D 3UTBA 1HQ3D 3EPLA 3NQJB 3W96C 3MGQC 5JRGC 2F8NK 2FJ7B 2F8ND 3WA9A 1P3AA 4J8VC 5CP6D 3AYWB 1U35D 4HGAB 3AV2D 3VH6W 4WNNB 3WTPC 3REHB 3AZHC 4WU9B 5BO0B 3H0MC 5GT3A 5AVCC 3X1TD 4Z66B 1P3FD 1AOID 4YS3C 1M19D 5E5AD 2HIOA 2FJ7A 1ID3A 4KUDB 5B32D 1WWIA 5BS7A
chains in the Genus database with same CATH topology
1P3BC 1P34B 3AN2A 2BYKB 4J8WC 3REHA 3AZID 5AV8C 1BH9B 5BO0A 4YM6B 3X1UA 3WTPE 3MGSC 3KUYC 2Y2QA 3UT9C 4Z66A 4X23C 4XZQC 2BG1A 2HUEB 3REIC 4J8UA 4CSRB 3MGPB 5B24B 1M18C 4KUDA 4XUJA 5B1MB 1P34A 5B33C 3A6NC 3EPHA 2XD5A 5CPKC 3R45B 1TZYC 4ZBJC 3WKJB 4LD9C 3REKC 5GT0B 3B0CT 3W96D 1P3OB 3UTAC 1P3LA 2F8NG 2YFWB 4R8PA 3MGPA 3REJB 3NQUB 1JFIB 3LJAA 2JCHA 5AV9B 3AZHD 3RELA 4KGCD 5AV5C 2VQRA 1EQZB 5AVCD 5AY8D 5CPIB 1F66A 5B2JA 3WKJA 4E45A 3AV1A 1TAFB 4H9OB 5BNVB 2PYOB 1N1JB 2YFWA 5G49A 4EO5B 1F1EA 3IP4C 5AV6C 5F99C 3NQUA 1JFIA 4G91C 3F6TA 3O62C 4J8WD 3AYWD 3AZGC 3UT9D 1BH8B 1KX3C 2YFVA 4WU9D 3W97C 4XZQD 5B0YC 3AFAC 5KDMB 3KWQC 3WAAC 1P3GC 1U35B 1M18D 2XD1A 5B2IC 5B31B 2NQBA 3AZMC 4KHAA 3LZ1A 3X1SB 1AOIB 1HQ3A 1TZYD 2CV5C 2F8NA 4YM6D 5B32B 1U35A 3W99C 5CP6A 3TU4B 1M1AB 3AV2A 3AZFC 2UWXA 5DNNB 3MVDB 3MGRB 5GXQB 1P3KB 3X1TA 5B24D 1P3FA 5B1MD 1AOIA 1M19A 3EPJA 5E5AA 5CPJC 2NZDC 5B32A 5GSUC 4H9SA 5GT0D 4QLCC 5AV6D 3AZIA 1P3OD 4JJNB 2RIQA 1P3MB 4H9PA 3REJD 3KXBC 2DQNC 3W98C 4Z2MH 3MGQB 3W96B 2Y2OA 1B6WA 5JRGB 5AV9D 5B40C 4Z5TC 1EQZD 5CPID 4J8VB 3B6FC 3B6GC 3AZLC 3WTPB 4CAYA 5B0ZC 5AVCB 1S32C 4ZUXC 2PYOD 2Y2NA 1ULYA 5C3IC 1ZLAC 4YS3B 1KU5A 4M6BA 3W96A 1BFMA 3C1BC 4H9QA 1P3PC 2CWEA 1P3BB 3AZHA 4J8WB 4KGCA 5AV8B 3MGSB 3KUYB 2G5IC 3VH5T 5AY8A 5AVCA 3UT9B 4X23B 3AZJC 3AZKC 5B1LC 4XZQB 3LZ0C 3AZNC 3AZEC 5B31D 3REIB 1M18B 3X1SD 3NQJA 3LELC 3A1IA 5B33B 4J8WA 3A6NB 3AYWA 2W8SA 3UT9A 4ZBJB 1TZYB 3TU4D 5CPKB 4NE5A 5BT1D 3X1VC 4WNNA 1M1AD 4WU9A 3REKB 4XZQA 5DNND 3MVDD 3MGRD 1KX5C 5GXQD 1P3KD 3UTAB 3B6FD 1M18A 3B6GD 3AZLD 1P3AC 3WA9C 1R4VA 4NE6A 5AV5B 4WJ3C 4ZUXD 5GT3C 1TZYA 2BYKA 1ZLAD 5AVBC 1BH9A 4YM6A 4JJND 1P3MD 1Z2CB 1P3PD 3MGQD 1ID3C 4NE3A 5AV6B 5JRGD 5F99B 3VH6T 4G91B 5BS7C 3O62B 1H3OB 4CSRA 4J8VD 4AWLC 5B24A 2IO5C 3AZGB 3AN2C 5B1MA 1KX3B 3X1UC 3WTPD 3W97B 4H9RB 5B0YB 3AFAB 3AZND 3KWQB 3WAAB 3FDDA 1P3GB 3P5JB 5FUGB 2LY8A 2L5AA 3R45A 2Y2LA 4YS3D 4J8UC 1W2EA 5GT0A 5B2IB 5AV6A 1P3OA 1P3IC 3AZMB 4XUJC 2AROC 5B32G 3REJA 4DRAA 1P3BD 3KFUG 3X1VD 2CV5B 5AV9A 5AV8D 3MGSD 3KUYD 1EQZA 5CPIA 2Y2JA 3W99B 4X23D 3AZFB 1P3LC 3REID 4R8PC 4E44A 1TAFA 4H9OA 2RVQC 5BNVA 3LJAC 2PYOA 1N1JA 3RELC 1B67A 3MNNC 1F66C 5CPJB 5B33D 3A6ND 5AVBD 2NZDB 5B2JC 1KX4C 5CPKD 1BH8A 5GSUB 3AV1C 4LD9D 3REKD 5KDMA 5BNXB 4QLCB 3UTAD 2JE5A 3KXBB 3W98B 3V9RB 4G92C 5B31A 5AV5D 5B40B 4Z5TB 3B6FB 3B6GB 3X1SA 3AZLB 2ZY2A 5BNXA 5B0ZB 1S32B 1P3ID 4ZUXB 2AROD 2NQBC 3TU4A 5C3IB 5DNMC 1M1AA 3W98A 1ZLAB 5F99D 3V9RA 5DNNA 3MVDA 3MGRA 3O62D 3LZ1C 5GXQA 1P3KA 3C1BB 1HQ3C 3AZGD 1P3PB 4J8XB 3B6FA 1KX3D 3B6GA 3W97D 5B0YD 3AFAD 4H9NB 5CP6C 3KWQD 3WAAD 1P3GD 3AV2C 1PZRA 4ZUXA 3AZJB 3AZKB 5B1LB 3X1TC 3LZ0B 3AZNB 3AZEB 5B2ID 3MNND 1ZLAA 1P3FC 4JJNA 2BYMB 3AZMD 1P3MA 1M19C 3A1KA 5E5AC 1KX4D 3C1CC 2Y2KA 3LELB 3MGQA 2CV5D 5JRGA 2Y2HA 4J8VA 3W99D 4J8XC 3AZIC 3X1VB 3WTPA 3AZFD 1KX5B 3AZNA 5JA4B 4NFTA 3WA9B 1P3AB 4YS3A 5CPJD 1T3UA 3B0DC 2NZDD 1WWSA 2JSSA 5GSUD 4WU8C 5GT3B 1P3BA 5DNMD 4QLCD 3X1VA 2G5HC 5AV8A 5AVBB 3MGSA 3KSYA 3KUYA 3KXBD 4X23A 2HIOB 1ID3B 2F2AC 3UTBC 1Q9CA 5B40D 4Z5TD 3REIA 3B0CW 4AWLB 2IO5B 3AN2B 4KGCC 3X1UB 5AY8C 3VH5A 5B33A 2F8NH 5B0ZD 3A6NA 1S32D 5AVBA 5CPKA 4LD9A 3C1CD 3REKA 4J8UB 3C1BD 1P3IB 4XUJB 2ZY4A 2HIOC 3UTAA 2AROB 2FJ7C 4J8XD 3AYWC 4HGAC 5AV5A 3REHC 4WU9C 3AZJD 3AZKD 5B1LD 3LZ0D 4Z66C 3AZED 1P3LB 5B31G 4R8PB 1P3IA 2DF4C 3LJAB 2AROA 3RELB 4WU8D 3LELD 3MNNB 4KUDC 5F99A 1F66B 3H0LC 3O62A 1H3OA 5B2JB 2ZM5A 3AZGA 1P34C 1KX4B 3AL0C 3AV1B 1KX3A 4YM6C 1KX5D 3W97A 4H9RA 5B0YA 3AFAA 3KWQA 3WAAA 2Y2GA 3UTBD 1P3GA 5G49B 5FUGA 3W98D 2FFFB 2HUEC 3VH6A 1P3AD 3WA9D 4G92B 3MGPC 5B24C 5B2IA 3MNNA 4WV4B 3AZMA 5B1MC 2YFVB 1KX4A 5GT3D 2Y2MA 2CV5A 3B0BA 3WKJC 3W99A 2HIOD 5GT0C 2FJ7D 1P3OC 2NQBB 1ID3D 5DNMB 4KHAB 4LD9B 3AZFA 3REJC 3LZ1B 4UUZB 1HQ3B 3EG5B 3AN2D 5AV9C 3REHD 2F8NB 3X1UD 1EQZC 5CPIC 5CHLB 5CPJA 5CP6B 4Z66D 2NZDA 3AV2B 2J8PA 5GSUA 4DQYB 4J8UD 3X1TB 5DNMA 4QLCA 4KUDD 1P3FB 2PYOC 4XUJD 4EO5C 4UUZA 1M19B 3KXBA 5E5AB 1P34D 3C1CB 1HTAA 5B40A 4Z5TA 3AZLA 3AZIB 1U35C 1P3LD 2Y2PA 4H9PB 1A7WA 4R8PD 3MGPD 2ZY3A 5B0ZA 1S32A 2RVQD 3LJAD 3RELD 5B31C 3H0RC 3VH5W 3C1CA 1F66D 3B0DB 2ZY5A 3X1SC 3C1BA 1AOIC 5B2JD 3WKJD 1P3PA 4WU8B 4J8XA 3AV1D 4CAYB 5B32C 4H9NA 4H9SC 2Y2IA 3TU4C 1M1AC 5BT1C 5DNNC 3MVDC 3MGRC 4UPKA 4WZSB 5GXQC 5B1LA 3AZJA 3LZ0A 3AZKA 1P3KC 3AZEA 4H9QB 3UTBB 2BYMA 3AZHB 4WU8A 4KGCB 3LELA 5AY8B 4DRBA 4Z2MG 2NQBD 4JJNC 1KX5A 1P3MC 3EPKA 5JA4A 3LZ1D 3UTBA 1HQ3D 3EPLA 3NQJB 3W96C 3MGQC 5JRGC 2F8NK 2FJ7B 2F8ND 3WA9A 1P3AA 4J8VC 5CP6D 3AYWB 1U35D 4HGAB 3AV2D 3VH6W 4WNNB 3WTPC 3REHB 3AZHC 4WU9B 5BO0B 3H0MC 5GT3A 5AVCC 3X1TD 4Z66B 1P3FD 1AOID 4YS3C 1M19D 5E5AD 2HIOA 2FJ7A 1ID3A 4KUDB 5B32D 1WWIA 5BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B C;  1P34 B;  3AN2 A;  2BYK B;  4J8W C;  3REH A;  3AZI D;  5AV8 C;  1BH9 B;  5BO0 A;  4YM6 B;  3X1U A;  3WTP E;  3MGS C;  3KUY C;  3UT9 C;  4Z66 A;  4X23 C;  4XZQ C;  2HUE B;  3REI C;  4J8U A;  4CSR B;  3MGP B;  5B24 B;  1M18 C;  4KUD A;  4XUJ A;  5B1M B;  1P34 A;  5B33 C;  3A6N C;  5CPK C;  3R45 B;  1TZY C;  4ZBJ C;  3WKJ B;  4LD9 C;  3REK C;  5GT0 B;  3B0C T;  3W96 D;  1P3O B;  3UTA C;  1P3L A;  2F8N G;  2YFW B;  4R8P A;  3MGP A;  3REJ B;  3NQU B;  1JFI B;  3LJA A;  3AZH D;  5AV9 B;  3REL A;  4KGC D;  5AV5 C;  1EQZ B;  5AVC D;  5AY8 D;  5CPI B;  1F66 A;  5B2J A;  3WKJ A;  4E45 A;  3AV1 A;  1TAF B;  4H9O B;  5BNV B;  2PYO B;  1N1J B;  2YFW A;  5G49 A;  4EO5 B;  1F1E A;  5AV6 C;  5F99 C;  3NQU A;  1JFI A;  4G91 C;  3O62 C;  4J8W D;  3AYW D;  3AZG C;  3UT9 D;  1BH8 B;  1KX3 C;  2YFV A;  4WU9 D;  3W97 C;  4XZQ D;  5B0Y C;  3AFA C;  5KDM B;  3KWQ C;  3WAA C;  1P3G C;  1U35 B;  1M18 D;  5B2I C;  5B31 B;  2NQB A;  3AZM C;  4KHA A;  3LZ1 A;  3X1S B;  1AOI B;  1HQ3 A;  1TZY D;  2CV5 C;  2F8N A;  4YM6 D;  5B32 B;  1U35 A;  3W99 C;  5CP6 A;  3TU4 B;  1M1A B;  3AV2 A;  3AZF C;  5DNN B;  3MVD B;  3MGR B;  5GXQ B;  1P3K B;  3X1T A;  5B24 D;  1P3F A;  5B1M D;  1AOI A;  1M19 A;  5CPJ C;  5E5A A;  2NZD C;  5B32 A;  5GSU C;  4H9S A;  5GT0 D;  4QLC C;  5AV6 D;  3AZI A;  1P3O D;  4JJN B;  1P3M B;  4H9P A;  3REJ D;  3KXB C;  3W98 C;  4Z2M H;  3MGQ B;  3W96 B;  5AV9 D;  1B6W A;  5JRG B;  5B40 C;  4Z5T C;  1EQZ D;  5CPI D;  4J8V B;  3B6F C;  3B6G C;  3AZL C;  3WTP B;  4CAY A;  5B0Z C;  5AVC B;  1S32 C;  4ZUX C;  2PYO D;  1ULY A;  5C3I C;  1ZLA C;  4YS3 B;  1KU5 A;  4M6B A;  3W96 A;  1BFM A;  3C1B C;  4H9Q A;  1P3P C;  2CWE A;  1P3B B;  3AZH A;  4J8W B;  4KGC A;  5AV8 B;  3MGS B;  3KUY B;  3VH5 T;  5AY8 A;  5AVC A;  3UT9 B;  4X23 B;  3AZJ C;  3AZK C;  5B1L C;  4XZQ B;  3LZ0 C;  3AZN C;  3AZE C;  5B31 D;  3REI B;  1M18 B;  3X1S D;  3NQJ A;  3LEL C;  5B33 B;  4J8W A;  3A6N B;  3AYW A;  3UT9 A;  5CPK B;  4ZBJ B;  1TZY B;  3TU4 D;  1M1A D;  4NE5 A;  5BT1 D;  3X1V C;  4WNN A;  1KX5 C;  4WU9 A;  3REK B;  4XZQ A;  5DNN D;  3MVD D;  3MGR D;  4LD9 B;  5GXQ D;  1P3K D;  3UTA B;  3B6F D;  1M18 A;  3B6G D;  3AZL D;  1P3A C;  3WA9 C;  1R4V A;  4NE6 A;  5AV5 B;  4ZUX D;  5GT3 C;  1TZY A;  2BYK A;  1ZLA D;  5AVB C;  1BH9 A;  4YM6 A;  4JJN D;  1P3M D;  1P3P D;  3MGQ D;  1ID3 C;  4NE3 A;  5JRG D;  5AV6 B;  5F99 B;  3VH6 T;  4G91 B;  5BS7 C;  3O62 B;  1H3O B;  4CSR A;  4J8V D;  4AWL C;  5B24 A;  2IO5 C;  3AZG B;  3AN2 C;  5B1M A;  1KX3 B;  3X1U C;  3WTP D;  3W97 B;  4H9R B;  5B0Y B;  3AFA B;  3AZN D;  3KWQ B;  3WAA B;  1P3G B;  5FUG B;  2LY8 A;  2L5A A;  3R45 A;  4YS3 D;  4J8U C;  5GT0 A;  5B2I B;  5AV6 A;  1P3O A;  1P3I C;  3AZM B;  4XUJ C;  2ARO C;  5B32 G;  3REJ A;  4DRA A;  1P3B D;  3X1V D;  2CV5 B;  5AV9 A;  5AV8 D;  3MGS D;  3KUY D;  1EQZ A;  5CPI A;  3W99 B;  4X23 D;  3AZF B;  1P3L C;  3REI D;  4R8P C;  4E44 A;  1TAF A;  4H9O A;  2RVQ C;  5BNV A;  3LJA C;  2PYO A;  1N1J A;  3REL C;  1B67 A;  3MNN C;  1F66 C;  5CPJ B;  5B33 D;  3A6N D;  5AVB D;  2NZD B;  5B2J C;  1KX4 C;  5CPK D;  1BH8 A;  5GSU B;  3AV1 C;  4LD9 D;  3REK D;  5KDM A;  5BNX B;  4QLC B;  3UTA D;  3KXB B;  3W98 B;  3V9R B;  4G92 C;  5B31 A;  5AV5 D;  5B40 B;  4Z5T B;  3B6F B;  3B6G B;  3X1S A;  3AZL B;  5BNX A;  5B0Z B;  1S32 B;  1P3I D;  4ZUX B;  2ARO D;  2NQB C;  3TU4 A;  5C3I B;  5DNM C;  1M1A A;  3W98 A;  1ZLA B;  5F99 D;  3V9R A;  5DNN A;  3MVD A;  3MGR A;  3O62 D;  3LZ1 C;  5GXQ A;  1P3K A;  3C1B B;  1HQ3 C;  3AZG D;  1P3P B;  4J8X B;  3B6F A;  1KX3 D;  3B6G A;  3W97 D;  5B0Y D;  3AFA D;  4H9N B;  5CP6 C;  3KWQ D;  3WAA D;  1P3G D;  3AV2 C;  4ZUX A;  3AZJ B;  3AZK B;  5B1L B;  3X1T C;  3LZ0 B;  3AZN B;  3AZE B;  5B2I D;  3MNN D;  1ZLA A;  1P3F C;  4JJN A;  2BYM B;  3AZM D;  1P3M A;  1M19 C;  5E5A C;  1KX4 D;  3C1C C;  3LEL B;  3MGQ A;  2CV5 D;  5JRG A;  4J8V A;  3W99 D;  4J8X C;  3AZI C;  3X1V B;  3WTP A;  3AZF D;  1KX5 B;  3AZN A;  5JA4 B;  4NFT A;  3WA9 B;  1P3A B;  4YS3 A;  5CPJ D;  3B0D C;  2NZD D;  1WWS A;  2JSS A;  5GSU D;  4WU8 C;  5GT3 B;  1P3B A;  5DNM D;  4QLC D;  3X1V A;  5AV8 A;  5AVB B;  3MGS A;  3KSY A;  3KUY A;  3KXB D;  4X23 A;  2HIO B;  1ID3 B;  3UTB C;  1Q9C A;  5B40 D;  4Z5T D;  3REI A;  3B0C W;  4AWL B;  2IO5 B;  3AN2 B;  4KGC C;  3X1U B;  5AY8 C;  3VH5 A;  5B33 A;  2F8N H;  5B0Z D;  3A6N A;  1S32 D;  5AVB A;  5CPK A;  4LD9 A;  3C1C D;  3REK A;  4J8U B;  3C1B D;  1P3I B;  4XUJ B;  3UTA A;  2HIO C;  2ARO B;  2FJ7 C;  4J8X D;  3AYW C;  4HGA C;  5AV5 A;  3REH C;  4WU9 C;  3AZJ D;  3AZK D;  5B1L D;  3LZ0 D;  4Z66 C;  3AZE D;  1P3L B;  5B31 G;  4R8P B;  1P3I A;  3LJA B;  2ARO A;  3REL B;  4WU8 D;  3LEL D;  3MNN B;  4KUD C;  5F99 A;  1F66 B;  3O62 A;  1H3O A;  5B2J B;  3AZG A;  1P34 C;  1KX4 B;  3AV1 B;  1KX3 A;  4YM6 C;  1KX5 D;  3W97 A;  4H9R A;  5B0Y A;  3AFA A;  3KWQ A;  3WAA A;  3UTB D;  1P3G A;  5G49 B;  5FUG A;  3W98 D;  2HUE C;  3VH6 A;  1P3A D;  3WA9 D;  4G92 B;  3MGP C;  5B24 C;  5B2I A;  3MNN A;  4WV4 B;  3AZM A;  5B1M C;  2YFV B;  1KX4 A;  5GT3 D;  2CV5 A;  3B0B A;  3WKJ C;  3W99 A;  2HIO D;  5GT0 C;  2FJ7 D;  1P3O C;  2NQB B;  1ID3 D;  5DNM B;  4KHA B;  3AZF A;  3REJ C;  3LZ1 B;  4UUZ B;  1HQ3 B;  3AN2 D;  5AV9 C;  3REH D;  2F8N B;  3X1U D;  1EQZ C;  5CPI C;  5CHL B;  5CPJ A;  5CP6 B;  4Z66 D;  2NZD A;  3AV2 B;  5GSU A;  4J8U D;  3X1T B;  5DNM A;  4QLC A;  4KUD D;  1P3F B;  2PYO C;  4XUJ D;  4EO5 C;  4UUZ A;  1M19 B;  3KXB A;  5E5A B;  1P34 D;  3C1C B;  1HTA A;  5B40 A;  4Z5T A;  3AZL A;  3AZI B;  1U35 C;  1P3L D;  4H9P B;  1A7W A;  4R8P D;  3MGP D;  5B0Z A;  1S32 A;  2RVQ D;  3LJA D;  3REL D;  5B31 C;  3VH5 W;  3C1C A;  1F66 D;  3B0D B;  3X1S C;  3C1B A;  1AOI C;  5B2J D;  3WKJ D;  1P3P A;  4WU8 B;  4J8X A;  3AV1 D;  4CAY B;  5B32 C;  4H9N A;  4H9S C;  3TU4 C;  1M1A C;  5BT1 C;  5DNN C;  3MVD C;  3MGR C;  3AZJ A;  4WZS B;  5GXQ C;  5B1L A;  3AZK A;  3LZ0 A;  1P3K C;  3AZE A;  4H9Q B;  3UTB B;  2BYM A;  3AZH B;  4WU8 A;  4KGC B;  3LEL A;  5AY8 B;  4DRB A;  4Z2M G;  2NQB D;  4JJN C;  1KX5 A;  1P3M C;  5JA4 A;  3LZ1 D;  3UTB A;  1HQ3 D;  3NQJ B;  3W96 C;  3MGQ C;  5JRG C;  2F8N K;  2FJ7 B;  2F8N D;  3WA9 A;  1P3A A;  4J8V C;  5CP6 D;  3AYW B;  1U35 D;  4HGA B;  3AV2 D;  3VH6 W;  4WNN B;  3WTP C;  3REH B;  3AZH C;  4WU9 B;  5BO0 B;  5GT3 A;  5AVC C;  3X1T D;  4Z66 B;  1P3F D;  1AOI D;  4YS3 C;  1M19 D;  5E5A D;  2HIO A;  2FJ7 A;  1ID3 A;  4KUD B;  5B32 D;  1WWI A;  5BS7 A; 
#chains in the Genus database with same CATH topology
 1P3B C;  1P34 B;  3AN2 A;  2BYK B;  4J8W C;  3REH A;  3AZI D;  5AV8 C;  1BH9 B;  5BO0 A;  4YM6 B;  3X1U A;  3WTP E;  3MGS C;  3KUY C;  2Y2Q A;  3UT9 C;  4Z66 A;  4X23 C;  4XZQ C;  2BG1 A;  2HUE B;  3REI C;  4J8U A;  4CSR B;  3MGP B;  5B24 B;  1M18 C;  4KUD A;  4XUJ A;  5B1M B;  1P34 A;  5B33 C;  3A6N C;  3EPH A;  2XD5 A;  5CPK C;  3R45 B;  1TZY C;  4ZBJ C;  3WKJ B;  4LD9 C;  3REK C;  5GT0 B;  3B0C T;  3W96 D;  1P3O B;  3UTA C;  1P3L A;  2F8N G;  2YFW B;  4R8P A;  3MGP A;  3REJ B;  3NQU B;  1JFI B;  3LJA A;  2JCH A;  5AV9 B;  3AZH D;  3REL A;  4KGC D;  5AV5 C;  2VQR A;  1EQZ B;  5AVC D;  5AY8 D;  5CPI B;  1F66 A;  5B2J A;  3WKJ A;  4E45 A;  3AV1 A;  1TAF B;  4H9O B;  5BNV B;  2PYO B;  1N1J B;  2YFW A;  5G49 A;  4EO5 B;  1F1E A;  3IP4 C;  5AV6 C;  5F99 C;  3NQU A;  1JFI A;  4G91 C;  3F6T A;  3O62 C;  4J8W D;  3AYW D;  3AZG C;  3UT9 D;  1BH8 B;  1KX3 C;  2YFV A;  4WU9 D;  3W97 C;  4XZQ D;  5B0Y C;  3AFA C;  5KDM B;  3KWQ C;  3WAA C;  1P3G C;  1U35 B;  1M18 D;  2XD1 A;  5B2I C;  5B31 B;  2NQB A;  3AZM C;  4KHA A;  3LZ1 A;  3X1S B;  1AOI B;  1HQ3 A;  1TZY D;  2CV5 C;  2F8N A;  4YM6 D;  5B32 B;  1U35 A;  3W99 C;  5CP6 A;  3TU4 B;  1M1A B;  3AV2 A;  3AZF C;  2UWX A;  5DNN B;  3MVD B;  3MGR B;  5GXQ B;  1P3K B;  3X1T A;  5B24 D;  1P3F A;  5B1M D;  1AOI A;  1M19 A;  3EPJ A;  5E5A A;  5CPJ C;  2NZD C;  5B32 A;  5GSU C;  4H9S A;  5GT0 D;  4QLC C;  5AV6 D;  3AZI A;  1P3O D;  4JJN B;  2RIQ A;  1P3M B;  4H9P A;  3REJ D;  3KXB C;  2DQN C;  3W98 C;  4Z2M H;  3MGQ B;  3W96 B;  2Y2O A;  1B6W A;  5JRG B;  5AV9 D;  5B40 C;  4Z5T C;  1EQZ D;  5CPI D;  4J8V B;  3B6F C;  3B6G C;  3AZL C;  3WTP B;  4CAY A;  5B0Z C;  5AVC B;  1S32 C;  4ZUX C;  2PYO D;  2Y2N A;  1ULY A;  5C3I C;  1ZLA C;  4YS3 B;  1KU5 A;  4M6B A;  3W96 A;  1BFM A;  3C1B C;  4H9Q A;  1P3P C;  2CWE A;  1P3B B;  3AZH A;  4J8W B;  4KGC A;  5AV8 B;  3MGS B;  3KUY B;  2G5I C;  3VH5 T;  5AY8 A;  5AVC A;  3UT9 B;  4X23 B;  3AZJ C;  3AZK C;  5B1L C;  4XZQ B;  3LZ0 C;  3AZN C;  3AZE C;  5B31 D;  3REI B;  1M18 B;  3X1S D;  3NQJ A;  3LEL C;  3A1I A;  5B33 B;  4J8W A;  3A6N B;  3AYW A;  2W8S A;  3UT9 A;  4ZBJ B;  1TZY B;  3TU4 D;  5CPK B;  4NE5 A;  5BT1 D;  3X1V C;  4WNN A;  1M1A D;  4WU9 A;  3REK B;  4XZQ A;  5DNN D;  3MVD D;  3MGR D;  1KX5 C;  5GXQ D;  1P3K D;  3UTA B;  3B6F D;  1M18 A;  3B6G D;  3AZL D;  1P3A C;  3WA9 C;  1R4V A;  4NE6 A;  5AV5 B;  4WJ3 C;  4ZUX D;  5GT3 C;  1TZY A;  2BYK A;  1ZLA D;  5AVB C;  1BH9 A;  4YM6 A;  4JJN D;  1P3M D;  1Z2C B;  1P3P D;  3MGQ D;  1ID3 C;  4NE3 A;  5AV6 B;  5JRG D;  5F99 B;  3VH6 T;  4G91 B;  5BS7 C;  3O62 B;  1H3O B;  4CSR A;  4J8V D;  4AWL C;  5B24 A;  2IO5 C;  3AZG B;  3AN2 C;  5B1M A;  1KX3 B;  3X1U C;  3WTP D;  3W97 B;  4H9R B;  5B0Y B;  3AFA B;  3AZN D;  3KWQ B;  3WAA B;  3FDD A;  1P3G B;  3P5J B;  5FUG B;  2LY8 A;  2L5A A;  3R45 A;  2Y2L A;  4YS3 D;  4J8U C;  1W2E A;  5GT0 A;  5B2I B;  5AV6 A;  1P3O A;  1P3I C;  3AZM B;  4XUJ C;  2ARO C;  5B32 G;  3REJ A;  4DRA A;  1P3B D;  3KFU G;  3X1V D;  2CV5 B;  5AV9 A;  5AV8 D;  3MGS D;  3KUY D;  1EQZ A;  5CPI A;  2Y2J A;  3W99 B;  4X23 D;  3AZF B;  1P3L C;  3REI D;  4R8P C;  4E44 A;  1TAF A;  4H9O A;  2RVQ C;  5BNV A;  3LJA C;  2PYO A;  1N1J A;  3REL C;  1B67 A;  3MNN C;  1F66 C;  5CPJ B;  5B33 D;  3A6N D;  5AVB D;  2NZD B;  5B2J C;  1KX4 C;  5CPK D;  1BH8 A;  5GSU B;  3AV1 C;  4LD9 D;  3REK D;  5KDM A;  5BNX B;  4QLC B;  3UTA D;  2JE5 A;  3KXB B;  3W98 B;  3V9R B;  4G92 C;  5B31 A;  5AV5 D;  5B40 B;  4Z5T B;  3B6F B;  3B6G B;  3X1S A;  3AZL B;  2ZY2 A;  5BNX A;  5B0Z B;  1S32 B;  1P3I D;  4ZUX B;  2ARO D;  2NQB C;  3TU4 A;  5C3I B;  5DNM C;  1M1A A;  3W98 A;  1ZLA B;  5F99 D;  3V9R A;  5DNN A;  3MVD A;  3MGR A;  3O62 D;  3LZ1 C;  5GXQ A;  1P3K A;  3C1B B;  1HQ3 C;  3AZG D;  1P3P B;  4J8X B;  3B6F A;  1KX3 D;  3B6G A;  3W97 D;  5B0Y D;  3AFA D;  4H9N B;  5CP6 C;  3KWQ D;  3WAA D;  1P3G D;  3AV2 C;  1PZR A;  4ZUX A;  3AZJ B;  3AZK B;  5B1L B;  3X1T C;  3LZ0 B;  3AZN B;  3AZE B;  5B2I D;  3MNN D;  1ZLA A;  1P3F C;  4JJN A;  2BYM B;  3AZM D;  1P3M A;  1M19 C;  3A1K A;  5E5A C;  1KX4 D;  3C1C C;  2Y2K A;  3LEL B;  3MGQ A;  2CV5 D;  5JRG A;  2Y2H A;  4J8V A;  3W99 D;  4J8X C;  3AZI C;  3X1V B;  3WTP A;  3AZF D;  1KX5 B;  3AZN A;  5JA4 B;  4NFT A;  3WA9 B;  1P3A B;  4YS3 A;  5CPJ D;  1T3U A;  3B0D C;  2NZD D;  1WWS A;  2JSS A;  5GSU D;  4WU8 C;  5GT3 B;  1P3B A;  5DNM D;  4QLC D;  3X1V A;  2G5H C;  5AV8 A;  5AVB B;  3MGS A;  3KSY A;  3KUY A;  3KXB D;  4X23 A;  2HIO B;  1ID3 B;  2F2A C;  3UTB C;  1Q9C A;  5B40 D;  4Z5T D;  3REI A;  3B0C W;  4AWL B;  2IO5 B;  3AN2 B;  4KGC C;  3X1U B;  5AY8 C;  3VH5 A;  5B33 A;  2F8N H;  5B0Z D;  3A6N A;  1S32 D;  5AVB A;  5CPK A;  4LD9 A;  3C1C D;  3REK A;  4J8U B;  3C1B D;  1P3I B;  4XUJ B;  2ZY4 A;  2HIO C;  3UTA A;  2ARO B;  2FJ7 C;  4J8X D;  3AYW C;  4HGA C;  5AV5 A;  3REH C;  4WU9 C;  3AZJ D;  3AZK D;  5B1L D;  3LZ0 D;  4Z66 C;  3AZE D;  1P3L B;  5B31 G;  4R8P B;  1P3I A;  2DF4 C;  3LJA B;  2ARO A;  3REL B;  4WU8 D;  3LEL D;  3MNN B;  4KUD C;  5F99 A;  1F66 B;  3H0L C;  3O62 A;  1H3O A;  5B2J B;  2ZM5 A;  3AZG A;  1P34 C;  1KX4 B;  3AL0 C;  3AV1 B;  1KX3 A;  4YM6 C;  1KX5 D;  3W97 A;  4H9R A;  5B0Y A;  3AFA A;  3KWQ A;  3WAA A;  2Y2G A;  3UTB D;  1P3G A;  5G49 B;  5FUG A;  3W98 D;  2FFF B;  2HUE C;  3VH6 A;  1P3A D;  3WA9 D;  4G92 B;  3MGP C;  5B24 C;  5B2I A;  3MNN A;  4WV4 B;  3AZM A;  5B1M C;  2YFV B;  1KX4 A;  5GT3 D;  2Y2M A;  2CV5 A;  3B0B A;  3WKJ C;  3W99 A;  2HIO D;  5GT0 C;  2FJ7 D;  1P3O C;  2NQB B;  1ID3 D;  5DNM B;  4KHA B;  4LD9 B;  3AZF A;  3REJ C;  3LZ1 B;  4UUZ B;  1HQ3 B;  3EG5 B;  3AN2 D;  5AV9 C;  3REH D;  2F8N B;  3X1U D;  1EQZ C;  5CPI C;  5CHL B;  5CPJ A;  5CP6 B;  4Z66 D;  2NZD A;  3AV2 B;  2J8P A;  5GSU A;  4DQY B;  4J8U D;  3X1T B;  5DNM A;  4QLC A;  4KUD D;  1P3F B;  2PYO C;  4XUJ D;  4EO5 C;  4UUZ A;  1M19 B;  3KXB A;  5E5A B;  1P34 D;  3C1C B;  1HTA A;  5B40 A;  4Z5T A;  3AZL A;  3AZI B;  1U35 C;  1P3L D;  2Y2P A;  4H9P B;  1A7W A;  4R8P D;  3MGP D;  2ZY3 A;  5B0Z A;  1S32 A;  2RVQ D;  3LJA D;  3REL D;  5B31 C;  3H0R C;  3VH5 W;  3C1C A;  1F66 D;  3B0D B;  2ZY5 A;  3X1S C;  3C1B A;  1AOI C;  5B2J D;  3WKJ D;  1P3P A;  4WU8 B;  4J8X A;  3AV1 D;  4CAY B;  5B32 C;  4H9N A;  4H9S C;  2Y2I A;  3TU4 C;  1M1A C;  5BT1 C;  5DNN C;  3MVD C;  3MGR C;  4UPK A;  4WZS B;  5GXQ C;  5B1L A;  3AZJ A;  3LZ0 A;  3AZK A;  1P3K C;  3AZE A;  4H9Q B;  3UTB B;  2BYM A;  3AZH B;  4WU8 A;  4KGC B;  3LEL A;  5AY8 B;  4DRB A;  4Z2M G;  2NQB D;  4JJN C;  1KX5 A;  1P3M C;  3EPK A;  5JA4 A;  3LZ1 D;  3UTB A;  1HQ3 D;  3EPL A;  3NQJ B;  3W96 C;  3MGQ C;  5JRG C;  2F8N K;  2FJ7 B;  2F8N D;  3WA9 A;  1P3A A;  4J8V C;  5CP6 D;  3AYW B;  1U35 D;  4HGA B;  3AV2 D;  3VH6 W;  4WNN B;  3WTP C;  3REH B;  3AZH C;  4WU9 B;  5BO0 B;  3H0M C;  5GT3 A;  5AVC C;  3X1T D;  4Z66 B;  1P3F D;  1AOI D;  4YS3 C;  1M19 D;  5E5A D;  2HIO A;  2FJ7 A;  1ID3 A;  4KUD B;  5B32 D;  1WWI A;  5BS7 A; 
#chains in the Genus database with same CATH homology
 1P3B C;  1P34 B;  3AN2 A;  2BYK B;  4J8W C;  3REH A;  3AZI D;  5AV8 C;  1BH9 B;  5BO0 A;  4YM6 B;  3X1U A;  3WTP E;  3MGS C;  3KUY C;  2Y2Q A;  3UT9 C;  4Z66 A;  4X23 C;  4XZQ C;  2BG1 A;  2HUE B;  3REI C;  4J8U A;  4CSR B;  3MGP B;  5B24 B;  1M18 C;  4KUD A;  4XUJ A;  5B1M B;  1P34 A;  5B33 C;  3A6N C;  3EPH A;  2XD5 A;  5CPK C;  3R45 B;  1TZY C;  4ZBJ C;  3WKJ B;  4LD9 C;  3REK C;  5GT0 B;  3B0C T;  3W96 D;  1P3O B;  3UTA C;  1P3L A;  2F8N G;  2YFW B;  4R8P A;  3MGP A;  3REJ B;  3NQU B;  1JFI B;  3LJA A;  2JCH A;  5AV9 B;  3AZH D;  3REL A;  4KGC D;  5AV5 C;  2VQR A;  1EQZ B;  5AVC D;  5AY8 D;  5CPI B;  1F66 A;  5B2J A;  3WKJ A;  4E45 A;  3AV1 A;  1TAF B;  4H9O B;  5BNV B;  2PYO B;  1N1J B;  2YFW A;  5G49 A;  4EO5 B;  1F1E A;  3IP4 C;  5AV6 C;  5F99 C;  3NQU A;  1JFI A;  4G91 C;  3F6T A;  3O62 C;  4J8W D;  3AYW D;  3AZG C;  3UT9 D;  1BH8 B;  1KX3 C;  2YFV A;  4WU9 D;  3W97 C;  4XZQ D;  5B0Y C;  3AFA C;  5KDM B;  3KWQ C;  3WAA C;  1P3G C;  1U35 B;  1M18 D;  2XD1 A;  5B2I C;  5B31 B;  2NQB A;  3AZM C;  4KHA A;  3LZ1 A;  3X1S B;  1AOI B;  1HQ3 A;  1TZY D;  2CV5 C;  2F8N A;  4YM6 D;  5B32 B;  1U35 A;  3W99 C;  5CP6 A;  3TU4 B;  1M1A B;  3AV2 A;  3AZF C;  2UWX A;  5DNN B;  3MVD B;  3MGR B;  5GXQ B;  1P3K B;  3X1T A;  5B24 D;  1P3F A;  5B1M D;  1AOI A;  1M19 A;  3EPJ A;  5E5A A;  5CPJ C;  2NZD C;  5B32 A;  5GSU C;  4H9S A;  5GT0 D;  4QLC C;  5AV6 D;  3AZI A;  1P3O D;  4JJN B;  2RIQ A;  1P3M B;  4H9P A;  3REJ D;  3KXB C;  2DQN C;  3W98 C;  4Z2M H;  3MGQ B;  3W96 B;  2Y2O A;  1B6W A;  5JRG B;  5AV9 D;  5B40 C;  4Z5T C;  1EQZ D;  5CPI D;  4J8V B;  3B6F C;  3B6G C;  3AZL C;  3WTP B;  4CAY A;  5B0Z C;  5AVC B;  1S32 C;  4ZUX C;  2PYO D;  2Y2N A;  1ULY A;  5C3I C;  1ZLA C;  4YS3 B;  1KU5 A;  4M6B A;  3W96 A;  1BFM A;  3C1B C;  4H9Q A;  1P3P C;  2CWE A;  1P3B B;  3AZH A;  4J8W B;  4KGC A;  5AV8 B;  3MGS B;  3KUY B;  2G5I C;  3VH5 T;  5AY8 A;  5AVC A;  3UT9 B;  4X23 B;  3AZJ C;  3AZK C;  5B1L C;  4XZQ B;  3LZ0 C;  3AZN C;  3AZE C;  5B31 D;  3REI B;  1M18 B;  3X1S D;  3NQJ A;  3LEL C;  3A1I A;  5B33 B;  4J8W A;  3A6N B;  3AYW A;  2W8S A;  3UT9 A;  4ZBJ B;  1TZY B;  3TU4 D;  5CPK B;  4NE5 A;  5BT1 D;  3X1V C;  4WNN A;  1M1A D;  4WU9 A;  3REK B;  4XZQ A;  5DNN D;  3MVD D;  3MGR D;  1KX5 C;  5GXQ D;  1P3K D;  3UTA B;  3B6F D;  1M18 A;  3B6G D;  3AZL D;  1P3A C;  3WA9 C;  1R4V A;  4NE6 A;  5AV5 B;  4WJ3 C;  4ZUX D;  5GT3 C;  1TZY A;  2BYK A;  1ZLA D;  5AVB C;  1BH9 A;  4YM6 A;  4JJN D;  1P3M D;  1Z2C B;  1P3P D;  3MGQ D;  1ID3 C;  4NE3 A;  5AV6 B;  5JRG D;  5F99 B;  3VH6 T;  4G91 B;  5BS7 C;  3O62 B;  1H3O B;  4CSR A;  4J8V D;  4AWL C;  5B24 A;  2IO5 C;  3AZG B;  3AN2 C;  5B1M A;  1KX3 B;  3X1U C;  3WTP D;  3W97 B;  4H9R B;  5B0Y B;  3AFA B;  3AZN D;  3KWQ B;  3WAA B;  3FDD A;  1P3G B;  3P5J B;  5FUG B;  2LY8 A;  2L5A A;  3R45 A;  2Y2L A;  4YS3 D;  4J8U C;  1W2E A;  5GT0 A;  5B2I B;  5AV6 A;  1P3O A;  1P3I C;  3AZM B;  4XUJ C;  2ARO C;  5B32 G;  3REJ A;  4DRA A;  1P3B D;  3KFU G;  3X1V D;  2CV5 B;  5AV9 A;  5AV8 D;  3MGS D;  3KUY D;  1EQZ A;  5CPI A;  2Y2J A;  3W99 B;  4X23 D;  3AZF B;  1P3L C;  3REI D;  4R8P C;  4E44 A;  1TAF A;  4H9O A;  2RVQ C;  5BNV A;  3LJA C;  2PYO A;  1N1J A;  3REL C;  1B67 A;  3MNN C;  1F66 C;  5CPJ B;  5B33 D;  3A6N D;  5AVB D;  2NZD B;  5B2J C;  1KX4 C;  5CPK D;  1BH8 A;  5GSU B;  3AV1 C;  4LD9 D;  3REK D;  5KDM A;  5BNX B;  4QLC B;  3UTA D;  2JE5 A;  3KXB B;  3W98 B;  3V9R B;  4G92 C;  5B31 A;  5AV5 D;  5B40 B;  4Z5T B;  3B6F B;  3B6G B;  3X1S A;  3AZL B;  2ZY2 A;  5BNX A;  5B0Z B;  1S32 B;  1P3I D;  4ZUX B;  2ARO D;  2NQB C;  3TU4 A;  5C3I B;  5DNM C;  1M1A A;  3W98 A;  1ZLA B;  5F99 D;  3V9R A;  5DNN A;  3MVD A;  3MGR A;  3O62 D;  3LZ1 C;  5GXQ A;  1P3K A;  3C1B B;  1HQ3 C;  3AZG D;  1P3P B;  4J8X B;  3B6F A;  1KX3 D;  3B6G A;  3W97 D;  5B0Y D;  3AFA D;  4H9N B;  5CP6 C;  3KWQ D;  3WAA D;  1P3G D;  3AV2 C;  1PZR A;  4ZUX A;  3AZJ B;  3AZK B;  5B1L B;  3X1T C;  3LZ0 B;  3AZN B;  3AZE B;  5B2I D;  3MNN D;  1ZLA A;  1P3F C;  4JJN A;  2BYM B;  3AZM D;  1P3M A;  1M19 C;  3A1K A;  5E5A C;  1KX4 D;  3C1C C;  2Y2K A;  3LEL B;  3MGQ A;  2CV5 D;  5JRG A;  2Y2H A;  4J8V A;  3W99 D;  4J8X C;  3AZI C;  3X1V B;  3WTP A;  3AZF D;  1KX5 B;  3AZN A;  5JA4 B;  4NFT A;  3WA9 B;  1P3A B;  4YS3 A;  5CPJ D;  1T3U A;  3B0D C;  2NZD D;  1WWS A;  2JSS A;  5GSU D;  4WU8 C;  5GT3 B;  1P3B A;  5DNM D;  4QLC D;  3X1V A;  2G5H C;  5AV8 A;  5AVB B;  3MGS A;  3KSY A;  3KUY A;  3KXB D;  4X23 A;  2HIO B;  1ID3 B;  2F2A C;  3UTB C;  1Q9C A;  5B40 D;  4Z5T D;  3REI A;  3B0C W;  4AWL B;  2IO5 B;  3AN2 B;  4KGC C;  3X1U B;  5AY8 C;  3VH5 A;  5B33 A;  2F8N H;  5B0Z D;  3A6N A;  1S32 D;  5AVB A;  5CPK A;  4LD9 A;  3C1C D;  3REK A;  4J8U B;  3C1B D;  1P3I B;  4XUJ B;  2ZY4 A;  2HIO C;  3UTA A;  2ARO B;  2FJ7 C;  4J8X D;  3AYW C;  4HGA C;  5AV5 A;  3REH C;  4WU9 C;  3AZJ D;  3AZK D;  5B1L D;  3LZ0 D;  4Z66 C;  3AZE D;  1P3L B;  5B31 G;  4R8P B;  1P3I A;  2DF4 C;  3LJA B;  2ARO A;  3REL B;  4WU8 D;  3LEL D;  3MNN B;  4KUD C;  5F99 A;  1F66 B;  3H0L C;  3O62 A;  1H3O A;  5B2J B;  2ZM5 A;  3AZG A;  1P34 C;  1KX4 B;  3AL0 C;  3AV1 B;  1KX3 A;  4YM6 C;  1KX5 D;  3W97 A;  4H9R A;  5B0Y A;  3AFA A;  3KWQ A;  3WAA A;  2Y2G A;  3UTB D;  1P3G A;  5G49 B;  5FUG A;  3W98 D;  2FFF B;  2HUE C;  3VH6 A;  1P3A D;  3WA9 D;  4G92 B;  3MGP C;  5B24 C;  5B2I A;  3MNN A;  4WV4 B;  3AZM A;  5B1M C;  2YFV B;  1KX4 A;  5GT3 D;  2Y2M A;  2CV5 A;  3B0B A;  3WKJ C;  3W99 A;  2HIO D;  5GT0 C;  2FJ7 D;  1P3O C;  2NQB B;  1ID3 D;  5DNM B;  4KHA B;  4LD9 B;  3AZF A;  3REJ C;  3LZ1 B;  4UUZ B;  1HQ3 B;  3EG5 B;  3AN2 D;  5AV9 C;  3REH D;  2F8N B;  3X1U D;  1EQZ C;  5CPI C;  5CHL B;  5CPJ A;  5CP6 B;  4Z66 D;  2NZD A;  3AV2 B;  2J8P A;  5GSU A;  4DQY B;  4J8U D;  3X1T B;  5DNM A;  4QLC A;  4KUD D;  1P3F B;  2PYO C;  4XUJ D;  4EO5 C;  4UUZ A;  1M19 B;  3KXB A;  5E5A B;  1P34 D;  3C1C B;  1HTA A;  5B40 A;  4Z5T A;  3AZL A;  3AZI B;  1U35 C;  1P3L D;  2Y2P A;  4H9P B;  1A7W A;  4R8P D;  3MGP D;  2ZY3 A;  5B0Z A;  1S32 A;  2RVQ D;  3LJA D;  3REL D;  5B31 C;  3H0R C;  3VH5 W;  3C1C A;  1F66 D;  3B0D B;  2ZY5 A;  3X1S C;  3C1B A;  1AOI C;  5B2J D;  3WKJ D;  1P3P A;  4WU8 B;  4J8X A;  3AV1 D;  4CAY B;  5B32 C;  4H9N A;  4H9S C;  2Y2I A;  3TU4 C;  1M1A C;  5BT1 C;  5DNN C;  3MVD C;  3MGR C;  4UPK A;  4WZS B;  5GXQ C;  5B1L A;  3AZJ A;  3LZ0 A;  3AZK A;  1P3K C;  3AZE A;  4H9Q B;  3UTB B;  2BYM A;  3AZH B;  4WU8 A;  4KGC B;  3LEL A;  5AY8 B;  4DRB A;  4Z2M G;  2NQB D;  4JJN C;  1KX5 A;  1P3M C;  3EPK A;  5JA4 A;  3LZ1 D;  3UTB A;  1HQ3 D;  3EPL A;  3NQJ B;  3W96 C;  3MGQ C;  5JRG C;  2F8N K;  2FJ7 B;  2F8N D;  3WA9 A;  1P3A A;  4J8V C;  5CP6 D;  3AYW B;  1U35 D;  4HGA B;  3AV2 D;  3VH6 W;  4WNN B;  3WTP C;  3REH B;  3AZH C;  4WU9 B;  5BO0 B;  3H0M C;  5GT3 A;  5AVC C;  3X1T D;  4Z66 B;  1P3F D;  1AOI D;  4YS3 C;  1M19 D;  5E5A D;  2HIO A;  2FJ7 A;  1ID3 A;  4KUD B;  5B32 D;  1WWI A;  5BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...