3AZHB

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhB00
5B24B 3A6NC 1M1AA 1M1AC 5BNXA 3AZGD 5CPJD 4XUJC 5JRGB 3UT9D 3MGSC 1M18C 4ZUXD 2AROA 4E45A 3AFAA 3MVDA 1M1AD 1KX5A 5AV5B 1KX5C 1ULYA 3B6GC 3AZLC 2AROD 4UUZA 3B6FB 4WNNA 4JJNC 3MNNC 4WU8A 1HQ3A 4CAYA 3MVDD 3AFAD 1KX5D 3W98A 1TAFA 4HGAC 1H3OA 4KUDB 4WV4B 1ID3A 3WAAB 4WU8D 4Z5TA 1HQ3D 3AZEB 5JA4A 4X23A 3W98D 2HUEC 2YFWB 4J8WA 4J8WC 3W99C 3X1TB 3AYWA 1ID3D 4Z5TD 4H9SA 3WTPB 5E5AA 1P3PD 4X23D 4AWLC 4J8WD 5B0ZB 3AYWD 1B67A 3REIC 3VH5A 3VH5W 5E5AD 1P3KB 3LJAB 4EO5C 3AV1A 2IO5C 4H9RB 1P3GC 5AV6A 5AV6C 4J8XC 4J8XA 4QLCB 3AN2A 5B1LB 3UTBA 3X1VC 1P3BC 2FJ7B 3AZHC 2PYOA 3KWQB 5B2IA 3AV1D 5CPJB 3TU4A 5AV6D 4J8XD 3R45B 1JFIA 3AN2D 2YFVB 3UTBD 2PYOD 5B40A 5BNXB 5B2ID 3X1UC 1WWIA 3B0CW 3C1CC 3TU4D 5CPKB 4G92C 4R8PC 2AROB 4CSRB 4R8PA 5B24C 3MGPD 3MVDB 5B40D 3LELD 5JRGA 3AZFB 1S32B 5BO0A 4WU8B 4CAYB 5AV5A 5KDMB 3REJA 5JRGD 4KHAB 3B6FC 3C1BA 1H3OB 3NQJB 1ID3B 4Z5TB 1P3AA 2CV5A 1P3PB 5AV5D 3REJD 5JA4B 4X23B 3AZIA 3MGQC 3AYWB 3C1BD 4KUDA 3WAAC 1P3AD 4YM6B 2CV5D 5E5AB 1P3IC 3AZEA 3AZEC 3AZID 5CPIA 4J8UB 3X1TA 5BNVA 4H9NA 4XZQC 5B0YA 4KUDD 1WWSA 3WKJB 3WTPA 5B31G 3AZED 5CPID 3REHB 3AV1B 5B0ZA 3X1TD 3W96A 5B0YD 3WTPD 1P3KA 3WA9B 3LJAC 3LJAA 5B2IB 1Q9CA 3TU4B 4LD9B 4H9RA 5B0ZD 3AZKB 3W96D 1KX3C 4QLCC 1JFIB 5B1LC 1P3KD 3V9RA 3MGPB 2FJ7A 2FJ7C 5B40B 3LJAD 3LELB 3KWQA 5CPJC 4ZUXC 2YFVA 4DRBA 1KU5A 2FJ7D 3KWQD 5GXQA 1BH9B 5AVBB 5CPKA 5CPKC 4H9QB 2AROC 4CSRA 5BO0B 5B31B 3AFAC 3MVDC 3REJB 5GXQD 5AY8B 1BH8B 5CPKD 1P3OB 3AZFC 3AZFA 1M19B 1S32C 1S32A 3C1BB 3AV2A 5AVCB 5B2JB 4WU8C 1HQ3C 1P3AB 2CV5B 4M6BA 5KDMA 3AZIB 3W98C 2NQBD 2HIOA 3UTAB 3AZFD 5GT0A 4KHAA 1S32D 3AV2D 3NQJA 1ID3C 5CP6B 5G49B 4Z5TC 1P3PC 1P3PA 4X23C 5CPIB 1EQZB 2HIOD 1P3LB 5GT0D 3AYWC 5BNVB 4H9NB 5B0YB 4YM6A 4H9SC 5E5AC 3X1SB 3W97B 2NZDA 2CWEA 4J8UA 4J8UC 4Z2MH 3W96B 1U35B 1ZLAB 4YM6D 3WKJA 5B1MA 3WKJC 3REHA 2NZDD 3AV1C 4G91B 4J8UD 1B6WA 3AN2C 2BYMB 3UTBC 5B1MD 3V9RB 3WKJD 3WA9A 2PYOC 3REHD 4ZBJC 5DNMA 5B2IC 3TU4C 4LD9C 3KXBB 3AZKA 4LD9A 5DNNB 3WA9D 3MGPC 3WTPE 3MGPA 5B40C 5DNMD 3LELA 3LELC 5GXQB 4LD9D 3AZKD 1KX4B 3O62A 4J8VA 2F8NK 1BH9A 5JRGC 2NQBB 5AVBC 5AVBA 4WU9B 3AZJB 5AV8B 3O62D 4H9QA 4J8VD 3AV2B 2LY8A 3VH6A 5B31A 5B31C 2RVQD 5AV5C 3REJC 5AY8C 5AY8A 2HIOB 1BH8A 5AVBD 1P3OC 1P3OA 1M19A 5GT0B 3RELA 4H9OA 3C1BC 4DRAA 5AVCA 5B31D 5B2JA 5B2JC 1P3AC 4E44A 5B32G 2CV5C 3AZIC 5AY8D 1M19D 1P3OD 3UTAA 3RELD 3B0DB 2JSSA 4KUDC 5AVCD 5CP6A 5CP6C 5G49A 5GT3B 5B2JD 3AZNA 1P34A 5CPIC 1EQZA 4JJNB 2NZDB 3KUYB 3UTAD 1P3LA 1R4VA 3AZMB 3X1TC 5AV9A 5B0YC 5CP6D 1P34D 3AZND 3LZ0B 5B1MB 3WTPC 3X1SA 3X1SC 1EQZD 3W97A 1P3LD 5B0ZC 2F8NH 5AV9D 3W96C 1U35C 1U35A 1ZLAA 1F66A 1ZLAC 4NFTA 4WZSB 1P3KC 3X1SD 3MGRD 5DNMB 1P3MA 3W97D 3B0BA 4G91C 1U35D 2BYMA 1ZLAD 1F66D 5B32B 1P3MD 3KWQC 3REIB 3KXBA 5DNNC 5DNNA 3O62B 5BT1D 4J8VB 5GSUD 1P3GB 5GXQC 1A7WA 1P3FB 3KXBD 1KX4A 5DNND 1KX4C 3VH6T 1AOIB 1TZYD 3REKB 4H9PA 2NQBA 2NQBC 4WU9A 3AZJA 3AZJC 5AV8A 3RELB 1KX4D 4H9OB 5F99B 4KGCA 4YS3A 3X1UB 3AV2C 4G92B 5B33B 2HIOC 3A6NA 4NE6A 5BS7A 5BS7C 5AV8D 4WU9D 5GT0C 3AZJD 4KGCD 4YS3D 4XUJA 1M18A 3MGSA 1P34B 3AZNB 2BYKA 5FUGA 3NQUB 2F8NG 3A6ND 4Z66B 3B6GA 5AV9B 2L5AA 3B0DC 4XUJD 3AZLA 1M18D 3MGSD 5GT3C 5GT3A 4YM6C 3MGRB 4JJNA 3MNNA 2NZDC 3KUYA 3KUYC 3AZMA 3AZMC 3B6GD 3MGQB 3AZLD 1F1EA 5GT3D 1F66B 3LZ0A 5B1MC 3LZ0C 5C3IB 3REHC 1P3MB 4JJND 3MNND 3KUYD 1P3IB 3AZMD 5GSUB 3LZ0D 3W99A 3WA9C 5DNMC 1N1JB 4XZQB 3AZKC 4NE5A 5B32A 5B32C 3W99D 1TZYB 2F8NB 3REIA 3O62C 4J8VC 5CHLB 5B32D 1P3GA 2RVQC 3KSYA 1KX3B 3REID 3LZ1B 4NE3A 4H9PB 1P3FA 1P3FC 3X1VA 1P3BA 3AZHA 3AZGB 4KGCB 4YS3B 3UT9B 1P3GD 1AOIA 1AOIC 3VH6W 4ZUXB 3REKA 3REKC 1P3FD 3A6NB 1M19C 3X1VD 1P3BD 3RELC 1M1AB 5F99A 5F99C 3AZHD 3X1UA 4XUJB 1M18B 3C1CA 5AVCC 3MGSB 1AOID 2BYKB 5B33A 5B33C 3REKD 5FUGB 4Z2MG 5B24A 3UTAC 3AFAB 5F99D 1KX5B 3B6GB 3X1UD 3AZLB 3C1CD 1P34C 3AZNC 4R8PD 4UUZB 5B33D 1EQZC 4WNNB 3NQUA 3MNNB 5B24D 1P3LC 1HQ3B 4Z66A 4Z66C 5AV9C 3W98B 1HTAA 1TAFB 3B6FA 4HGAB 3MGRA 3MGRC 3W97C 4Z66D 3MGQA 2HUEB 4J8WB 1F66C 3W99B 5C3IC 3B6FD 1P3MC 3WAAA 1P3IA 5BT1C 3MGQD 4AWLB 2YFWA 5GSUA 5GSUC 1N1JA 4XZQA 3WAAD 3VH5T 3KXBC 1P3ID 4EO5B 2IO5B 1TZYA 1TZYC 5AV6B 4J8XB 2F8NA 4XZQD 3AN2B 3UTBB 3X1VB 1P3BB 3AZHB 2PYOB 4ZBJB 1BFMA 2F8ND 1KX3A 3LZ1A 4QLCA 3LZ1C 5B1LA 4WU9C 5AV8C 3B0CT 3AZGA 3AZGC 4YS3C 4KGCC 5CPJA 3C1CB 3UT9A 3UT9C 4ZUXA 4R8PB 3R45A 1KX3D 3LZ1D 4QLCD 5B1LD
chains in the Genus database with same CATH superfamily
5B24B 3A6NC 1M1AA 1M1AC 5BNXA 3AZGD 5CPJD 4XUJC 5JRGB 3F6TA 3MGSC 3UT9D 1M18C 4ZUXD 2AROA 3EPLA 2ZM5A 4E45A 3AFAA 3MVDA 1M1AD 1KX5A 5AV5B 1KX5C 1ULYA 3B6GC 3AZLC 2Y2MA 2AROD 4UUZA 3B6FB 1T3UA 4WNNA 4JJNC 3MNNC 4WU8A 1HQ3A 4CAYA 3MVDD 3AFAD 1KX5D 2ZY2A 3W98A 1TAFA 2Y2NA 4HGAC 1H3OA 4KUDB 2Y2OA 4WV4B 1ID3A 3WAAB 4WU8D 4Z5TA 1HQ3D 3AZEB 5JA4A 4X23A 3W98D 2HUEC 2YFWB 4J8WA 4J8WC 3W99C 3X1TB 3AYWA 1ID3D 4Z5TD 4H9SA 3WTPB 5E5AA 1P3PD 4X23D 3AL0C 1W2EA 4AWLC 4J8WD 5B0ZB 3AYWD 2DF4C 1B67A 3REIC 3VH5A 3VH5W 5E5AD 1P3KB 3LJAB 4EO5C 2Y2KA 3AV1A 2IO5C 4H9RB 1P3GC 2XD5A 5AV6A 5AV6C 4J8XC 4J8XA 4QLCB 3AN2A 5B1LB 3H0LC 3UTBA 3X1VC 1P3BC 2FJ7B 3AZHC 2PYOA 3KWQB 5B2IA 3AV1D 5CPJB 3TU4A 5AV6D 4J8XD 3R45B 1JFIA 3AN2D 2YFVB 3UTBD 2PYOD 5B40A 5BNXB 5B2ID 3X1UC 1WWIA 3B0CW 3C1CC 3TU4D 5CPKB 4G92C 4R8PC 2AROB 4CSRB 4R8PA 1Z2CB 5B24C 3MGPD 3MVDB 5B40D 3LELD 5JRGA 3AZFB 1S32B 3EPHA 5BO0A 4WU8B 4CAYB 5AV5A 5KDMB 3REJA 5JRGD 4KHAB 3A1KA 3B6FC 3C1BA 1H3OB 3NQJB 1ID3B 4Z5TB 1P3AA 2CV5A 1P3PB 5AV5D 3REJD 5JA4B 4X23B 3AZIA 3MGQC 2DQNC 3AYWB 3C1BD 4KUDA 3WAAC 1P3AD 4YM6B 2CV5D 5E5AB 1P3IC 3AZEA 3AZEC 3AZID 5CPIA 4J8UB 3X1TA 5BNVA 4H9NA 4XZQC 5B0YA 4KUDD 1WWSA 3WKJB 3WTPA 5B31G 3AZED 5CPID 3REHB 3AV1B 3EG5B 5B0ZA 3X1TD 3W96A 5B0YD 3WTPD 1P3KA 3WA9B 3LJAC 3LJAA 5B2IB 1Q9CA 3TU4B 4LD9B 2FFFB 4H9RA 5B0ZD 3AZKB 3W96D 1KX3C 4QLCC 1JFIB 5B1LC 1P3KD 3V9RA 3MGPB 2FJ7A 2FJ7C 5B40B 3LJAD 3LELB 3KWQA 5CPJC 4ZUXC 2YFVA 4DRBA 1KU5A 2FJ7D 2W8SA 5GXQA 3KWQD 1BH9B 5AVBB 5CPKA 5CPKC 4H9QB 2AROC 4CSRA 5BO0B 5B31B 3AFAC 3MVDC 3REJB 5GXQD 5AY8B 1BH8B 5CPKD 1P3OB 3AZFC 3H0RC 3AZFA 1M19B 1S32C 1S32A 3C1BB 3AV2A 5AVCB 5B2JB 4WU8C 1HQ3C 1P3AB 2CV5B 4M6BA 5KDMA 3AZIB 3W98C 2NQBD 2HIOA 3UTAB 3AZFD 5GT0A 4KHAA 1S32D 3AV2D 3NQJA 1ID3C 5CP6B 5G49B 4Z5TC 1P3PC 1P3PA 4X23C 5CPIB 1EQZB 2HIOD 1P3LB 5GT0D 3AYWC 5BNVB 4H9NB 5B0YB 4YM6A 4H9SC 5E5AC 3X1SB 3W97B 2NZDA 2CWEA 4J8UA 4J8UC 4Z2MH 3W96B 1U35B 1ZLAB 4YM6D 3WKJA 5B1MA 3WKJC 3REHA 2NZDD 3AV1C 4G91B 4J8UD 1B6WA 3AN2C 2BYMB 3UTBC 5B1MD 3V9RB 3WKJD 3WA9A 2PYOC 3REHD 4ZBJC 5DNMA 5B2IC 3TU4C 4LD9C 3KXBB 3AZKA 4LD9A 5DNNB 3EPKA 2BG1A 2Y2LA 3WA9D 3MGPC 3WTPE 3MGPA 5B40C 5DNMD 3LELA 3LELC 5GXQB 2JE5A 4LD9D 3AZKD 1KX4B 3O62A 4J8VA 2F8NK 1BH9A 5JRGC 2NQBB 5AVBC 5AVBA 4WU9B 3AZJB 5AV8B 3O62D 4H9QA 4J8VD 3AV2B 2LY8A 3VH6A 5B31A 5B31C 4DQYB 2RVQD 5AV5C 3REJC 5AY8C 5AY8A 2HIOB 1BH8A 5AVBD 1P3OC 1P3OA 1M19A 5GT0B 3RELA 4H9OA 3C1BC 4DRAA 5AVCA 3FDDA 5B31D 5B2JA 5B2JC 1P3AC 4E44A 5B32G 2CV5C 2ZY5A 3AZIC 5AY8D 1M19D 1P3OD 3UTAA 3RELD 3H0MC 3B0DB 2JSSA 4KUDC 5CP6A 5CP6C 5AVCD 5G49A 5GT3B 5B2JD 3AZNA 1P34A 2Y2QA 5CPIC 1EQZA 4JJNB 2NZDB 3KUYB 3UTAD 1P3LA 3EPJA 1R4VA 3AZMB 3X1TC 5AV9A 5B0YC 5CP6D 1P34D 3AZND 3LZ0B 5B1MB 3WTPC 3X1SA 3X1SC 1EQZD 3KFUG 3W97A 1P3LD 5B0ZC 2F8NH 5AV9D 3W96C 1U35C 1U35A 1ZLAA 1F66A 1ZLAC 4NFTA 4WZSB 1P3KC 3X1SD 3MGRD 5DNMB 1P3MA 3W97D 3B0BA 4G91C 1U35D 2BYMA 1ZLAD 1F66D 5B32B 1P3MD 3KWQC 3REIB 3KXBA 5DNNC 5DNNA 3O62B 5BT1D 4J8VB 5GSUD 1P3GB 5GXQC 1A7WA 1P3FB 3KXBD 1KX4A 5DNND 1KX4C 3VH6T 1PZRA 1AOIB 1TZYD 3REKB 4H9PA 2NQBA 2NQBC 4WU9A 3AZJA 3AZJC 5AV8A 3RELB 1KX4D 4H9OB 5F99B 4KGCA 4YS3A 3X1UB 3AV2C 4G92B 5B33B 2HIOC 3A6NA 4NE6A 5BS7A 5BS7C 5AV8D 2ZY4A 5GT0C 4WU9D 3AZJD 4KGCD 4YS3D 2UWXA 4XUJA 1M18A 3MGSA 3A1IA 1P34B 3AZNB 2BYKA 2ZY3A 5FUGA 3NQUB 2F8NG 3A6ND 4Z66B 3B6GA 5AV9B 2L5AA 3B0DC 4XUJD 3AZLA 1M18D 3MGSD 5GT3C 5GT3A 2G5HC 4YM6C 3MGRB 4JJNA 3MNNA 2NZDC 3KUYA 3KUYC 3AZMA 3AZMC 3B6GD 2RIQA 3MGQB 3AZLD 2XD1A 1F1EA 5GT3D 1F66B 3LZ0A 5B1MC 3LZ0C 5C3IB 3REHC 1P3MB 4JJND 3MNND 3KUYD 1P3IB 3AZMD 5GSUB 3LZ0D 3W99A 3WA9C 5DNMC 1N1JB 2Y2HA 4XZQB 2VQRA 3AZKC 4NE5A 5B32A 5B32C 3W99D 1TZYB 2F8NB 3REIA 3O62C 2G5IC 4J8VC 5CHLB 5B32D 1P3GA 2RVQC 2F2AC 3KSYA 1KX3B 3REID 3LZ1B 4NE3A 4H9PB 1P3FA 1P3FC 3X1VA 1P3BA 3AZHA 3AZGB 4KGCB 4YS3B 3UT9B 1P3GD 1AOIA 1AOIC 3VH6W 4ZUXB 3REKA 3REKC 1P3FD 3A6NB 1M19C 3X1VD 1P3BD 3RELC 1M1AB 5F99A 5F99C 3AZHD 3X1UA 2J8PA 4XUJB 1M18B 3C1CA 5AVCC 3MGSB 1AOID 2BYKB 5B33A 5B33C 3REKD 5FUGB 4Z2MG 5B24A 3UTAC 3IP4C 3AFAB 5F99D 1KX5B 3B6GB 3X1UD 3AZLB 3C1CD 1P34C 3AZNC 4R8PD 4UUZB 5B33D 1EQZC 4WNNB 3NQUA 3MNNB 5B24D 1P3LC 1HQ3B 4Z66A 4Z66C 5AV9C 3W98B 1HTAA 1TAFB 2Y2GA 3B6FA 4HGAB 3MGRA 3MGRC 3W97C 4Z66D 3MGQA 2HUEB 4J8WB 1F66C 3W99B 5C3IC 3B6FD 1P3MC 4WJ3C 3WAAA 2JCHA 1P3IA 5BT1C 3MGQD 4AWLB 2YFWA 5GSUA 5GSUC 2Y2IA 1N1JA 4XZQA 3WAAD 3VH5T 2Y2JA 3KXBC 1P3ID 2Y2PA 4EO5B 2IO5B 1TZYA 1TZYC 5AV6B 4J8XB 2F8NA 4XZQD 4UPKA 3AN2B 3UTBB 3X1VB 1P3BB 3AZHB 2PYOB 4ZBJB 1BFMA 3P5JB 2F8ND 1KX3A 3LZ1A 4QLCA 3LZ1C 5B1LA 4WU9C 5AV8C 3B0CT 3AZGA 3AZGC 4YS3C 4KGCC 5CPJA 3C1CB 3UT9A 3UT9C 4ZUXA 4R8PB 3R45A 1KX3D 3LZ1D 4QLCD 5B1LD
chains in the Genus database with same CATH topology
5B24B 3A6NC 1M1AA 1M1AC 5BNXA 3AZGD 5CPJD 4XUJC 5JRGB 3F6TA 3MGSC 3UT9D 1M18C 4ZUXD 2AROA 3EPLA 2ZM5A 4E45A 3AFAA 3MVDA 1M1AD 1KX5A 5AV5B 1KX5C 1ULYA 3B6GC 3AZLC 2Y2MA 2AROD 4UUZA 3B6FB 1T3UA 4WNNA 4JJNC 3MNNC 4WU8A 1HQ3A 4CAYA 3MVDD 3AFAD 1KX5D 2ZY2A 3W98A 1TAFA 2Y2NA 4HGAC 1H3OA 4KUDB 2Y2OA 4WV4B 1ID3A 3WAAB 4WU8D 4Z5TA 1HQ3D 3AZEB 5JA4A 4X23A 3W98D 2HUEC 2YFWB 4J8WA 4J8WC 3W99C 3X1TB 3AYWA 1ID3D 4Z5TD 4H9SA 3WTPB 5E5AA 1P3PD 4X23D 3AL0C 1W2EA 4AWLC 4J8WD 5B0ZB 3AYWD 2DF4C 1B67A 3REIC 3VH5A 3VH5W 5E5AD 1P3KB 3LJAB 4EO5C 2Y2KA 3AV1A 2IO5C 4H9RB 1P3GC 2XD5A 5AV6A 5AV6C 4J8XC 4J8XA 4QLCB 3AN2A 5B1LB 3H0LC 3UTBA 3X1VC 1P3BC 2FJ7B 3AZHC 2PYOA 3KWQB 5B2IA 3AV1D 5CPJB 3TU4A 5AV6D 4J8XD 3R45B 1JFIA 3AN2D 2YFVB 3UTBD 2PYOD 5B40A 5BNXB 5B2ID 3X1UC 1WWIA 3B0CW 3C1CC 3TU4D 5CPKB 4G92C 4R8PC 2AROB 4CSRB 4R8PA 1Z2CB 5B24C 3MGPD 3MVDB 5B40D 3LELD 5JRGA 3AZFB 1S32B 3EPHA 5BO0A 4WU8B 4CAYB 5AV5A 5KDMB 3REJA 5JRGD 4KHAB 3A1KA 3B6FC 3C1BA 1H3OB 3NQJB 1ID3B 4Z5TB 1P3AA 2CV5A 1P3PB 5AV5D 3REJD 5JA4B 4X23B 3AZIA 3MGQC 2DQNC 3AYWB 3C1BD 4KUDA 3WAAC 1P3AD 4YM6B 2CV5D 5E5AB 1P3IC 3AZEA 3AZEC 3AZID 5CPIA 4J8UB 3X1TA 5BNVA 4H9NA 4XZQC 5B0YA 4KUDD 1WWSA 3WKJB 3WTPA 5B31G 3AZED 5CPID 3REHB 3AV1B 3EG5B 5B0ZA 3X1TD 3W96A 5B0YD 3WTPD 1P3KA 3WA9B 3LJAC 3LJAA 5B2IB 1Q9CA 3TU4B 4LD9B 2FFFB 4H9RA 5B0ZD 3AZKB 3W96D 1KX3C 4QLCC 1JFIB 5B1LC 1P3KD 3V9RA 3MGPB 2FJ7A 2FJ7C 5B40B 3LJAD 3LELB 3KWQA 5CPJC 4ZUXC 2YFVA 4DRBA 1KU5A 2FJ7D 2W8SA 5GXQA 3KWQD 1BH9B 5AVBB 5CPKA 5CPKC 4H9QB 2AROC 4CSRA 5BO0B 5B31B 3AFAC 3MVDC 3REJB 5GXQD 5AY8B 1BH8B 5CPKD 1P3OB 3AZFC 3H0RC 3AZFA 1M19B 1S32C 1S32A 3C1BB 3AV2A 5AVCB 5B2JB 4WU8C 1HQ3C 1P3AB 2CV5B 4M6BA 5KDMA 3AZIB 3W98C 2NQBD 2HIOA 3UTAB 3AZFD 5GT0A 4KHAA 1S32D 3AV2D 3NQJA 1ID3C 5CP6B 5G49B 4Z5TC 1P3PC 1P3PA 4X23C 5CPIB 1EQZB 2HIOD 1P3LB 5GT0D 3AYWC 5BNVB 4H9NB 5B0YB 4YM6A 4H9SC 5E5AC 3X1SB 3W97B 2NZDA 2CWEA 4J8UA 4J8UC 4Z2MH 3W96B 1U35B 1ZLAB 4YM6D 3WKJA 5B1MA 3WKJC 3REHA 2NZDD 3AV1C 4G91B 4J8UD 1B6WA 3AN2C 2BYMB 3UTBC 5B1MD 3V9RB 3WKJD 3WA9A 2PYOC 3REHD 4ZBJC 5DNMA 5B2IC 3TU4C 4LD9C 3KXBB 3AZKA 4LD9A 5DNNB 3EPKA 2BG1A 2Y2LA 3WA9D 3MGPC 3WTPE 3MGPA 5B40C 5DNMD 3LELA 3LELC 5GXQB 2JE5A 4LD9D 3AZKD 1KX4B 3O62A 4J8VA 2F8NK 1BH9A 5JRGC 2NQBB 5AVBC 5AVBA 4WU9B 3AZJB 5AV8B 3O62D 4H9QA 4J8VD 3AV2B 2LY8A 3VH6A 5B31A 5B31C 4DQYB 2RVQD 5AV5C 3REJC 5AY8C 5AY8A 2HIOB 1BH8A 5AVBD 1P3OC 1P3OA 1M19A 5GT0B 3RELA 4H9OA 3C1BC 4DRAA 5AVCA 3FDDA 5B31D 5B2JA 5B2JC 1P3AC 4E44A 5B32G 2CV5C 2ZY5A 3AZIC 5AY8D 1M19D 1P3OD 3UTAA 3RELD 3H0MC 3B0DB 2JSSA 4KUDC 5CP6A 5CP6C 5AVCD 5G49A 5GT3B 5B2JD 3AZNA 1P34A 2Y2QA 5CPIC 1EQZA 4JJNB 2NZDB 3KUYB 3UTAD 1P3LA 3EPJA 1R4VA 3AZMB 3X1TC 5AV9A 5B0YC 5CP6D 1P34D 3AZND 3LZ0B 5B1MB 3WTPC 3X1SA 3X1SC 1EQZD 3KFUG 3W97A 1P3LD 5B0ZC 2F8NH 5AV9D 3W96C 1U35C 1U35A 1ZLAA 1F66A 1ZLAC 4NFTA 4WZSB 1P3KC 3X1SD 3MGRD 5DNMB 1P3MA 3W97D 3B0BA 4G91C 1U35D 2BYMA 1ZLAD 1F66D 5B32B 1P3MD 3KWQC 3REIB 3KXBA 5DNNC 5DNNA 3O62B 5BT1D 4J8VB 5GSUD 1P3GB 5GXQC 1A7WA 1P3FB 3KXBD 1KX4A 5DNND 1KX4C 3VH6T 1PZRA 1AOIB 1TZYD 3REKB 4H9PA 2NQBA 2NQBC 4WU9A 3AZJA 3AZJC 5AV8A 3RELB 1KX4D 4H9OB 5F99B 4KGCA 4YS3A 3X1UB 3AV2C 4G92B 5B33B 2HIOC 3A6NA 4NE6A 5BS7A 5BS7C 5AV8D 2ZY4A 5GT0C 4WU9D 3AZJD 4KGCD 4YS3D 2UWXA 4XUJA 1M18A 3MGSA 3A1IA 1P34B 3AZNB 2BYKA 2ZY3A 5FUGA 3NQUB 2F8NG 3A6ND 4Z66B 3B6GA 5AV9B 2L5AA 3B0DC 4XUJD 3AZLA 1M18D 3MGSD 5GT3C 5GT3A 2G5HC 4YM6C 3MGRB 4JJNA 3MNNA 2NZDC 3KUYA 3KUYC 3AZMA 3AZMC 3B6GD 2RIQA 3MGQB 3AZLD 2XD1A 1F1EA 5GT3D 1F66B 3LZ0A 5B1MC 3LZ0C 5C3IB 3REHC 1P3MB 4JJND 3MNND 3KUYD 1P3IB 3AZMD 5GSUB 3LZ0D 3W99A 3WA9C 5DNMC 1N1JB 2Y2HA 4XZQB 2VQRA 3AZKC 4NE5A 5B32A 5B32C 3W99D 1TZYB 2F8NB 3REIA 3O62C 2G5IC 4J8VC 5CHLB 5B32D 1P3GA 2RVQC 2F2AC 3KSYA 1KX3B 3REID 3LZ1B 4NE3A 4H9PB 1P3FA 1P3FC 3X1VA 1P3BA 3AZHA 3AZGB 4KGCB 4YS3B 3UT9B 1P3GD 1AOIA 1AOIC 3VH6W 4ZUXB 3REKA 3REKC 1P3FD 3A6NB 1M19C 3X1VD 1P3BD 3RELC 1M1AB 5F99A 5F99C 3AZHD 3X1UA 2J8PA 4XUJB 1M18B 3C1CA 5AVCC 3MGSB 1AOID 2BYKB 5B33A 5B33C 3REKD 5FUGB 4Z2MG 5B24A 3UTAC 3IP4C 3AFAB 5F99D 1KX5B 3B6GB 3X1UD 3AZLB 3C1CD 1P34C 3AZNC 4R8PD 4UUZB 5B33D 1EQZC 4WNNB 3NQUA 3MNNB 5B24D 1P3LC 1HQ3B 4Z66A 4Z66C 5AV9C 3W98B 1HTAA 1TAFB 2Y2GA 3B6FA 4HGAB 3MGRA 3MGRC 3W97C 4Z66D 3MGQA 2HUEB 4J8WB 1F66C 3W99B 5C3IC 3B6FD 1P3MC 4WJ3C 3WAAA 2JCHA 1P3IA 5BT1C 3MGQD 4AWLB 2YFWA 5GSUA 5GSUC 2Y2IA 1N1JA 4XZQA 3WAAD 3VH5T 2Y2JA 3KXBC 1P3ID 2Y2PA 4EO5B 2IO5B 1TZYA 1TZYC 5AV6B 4J8XB 2F8NA 4XZQD 4UPKA 3AN2B 3UTBB 3X1VB 1P3BB 3AZHB 2PYOB 4ZBJB 1BFMA 3P5JB 2F8ND 1KX3A 3LZ1A 4QLCA 3LZ1C 5B1LA 4WU9C 5AV8C 3B0CT 3AZGA 3AZGC 4YS3C 4KGCC 5CPJA 3C1CB 3UT9A 3UT9C 4ZUXA 4R8PB 3R45A 1KX3D 3LZ1D 4QLCD 5B1LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  3A6N C;  1M1A A;  1M1A C;  5BNX A;  3AZG D;  5CPJ D;  4XUJ C;  5JRG B;  3UT9 D;  3MGS C;  1M18 C;  4ZUX D;  2ARO A;  4E45 A;  3AFA A;  3MVD A;  1M1A D;  1KX5 A;  5AV5 B;  1KX5 C;  1ULY A;  3B6G C;  3AZL C;  2ARO D;  4UUZ A;  3B6F B;  4WNN A;  4JJN C;  3MNN C;  4WU8 A;  1HQ3 A;  4CAY A;  3MVD D;  3AFA D;  1KX5 D;  3W98 A;  1TAF A;  4HGA C;  1H3O A;  4KUD B;  4WV4 B;  1ID3 A;  3WAA B;  4WU8 D;  4Z5T A;  1HQ3 D;  3AZE B;  5JA4 A;  4X23 A;  3W98 D;  2HUE C;  2YFW B;  4J8W A;  4J8W C;  3W99 C;  3X1T B;  3AYW A;  1ID3 D;  4Z5T D;  4H9S A;  3WTP B;  5E5A A;  1P3P D;  4X23 D;  4AWL C;  4J8W D;  5B0Z B;  3AYW D;  1B67 A;  3REI C;  3VH5 A;  3VH5 W;  5E5A D;  1P3K B;  3LJA B;  4EO5 C;  3AV1 A;  2IO5 C;  4H9R B;  1P3G C;  5AV6 A;  5AV6 C;  4J8X C;  4J8X A;  4QLC B;  3AN2 A;  5B1L B;  3UTB A;  3X1V C;  1P3B C;  2FJ7 B;  3AZH C;  2PYO A;  3KWQ B;  5B2I A;  3AV1 D;  5CPJ B;  3TU4 A;  5AV6 D;  4J8X D;  3R45 B;  1JFI A;  3AN2 D;  2YFV B;  3UTB D;  2PYO D;  5B40 A;  5BNX B;  5B2I D;  3X1U C;  1WWI A;  3B0C W;  3C1C C;  3TU4 D;  5CPK B;  4G92 C;  4R8P C;  2ARO B;  4CSR B;  4R8P A;  5B24 C;  3MGP D;  3MVD B;  5B40 D;  3LEL D;  5JRG A;  3AZF B;  1S32 B;  5BO0 A;  4WU8 B;  4CAY B;  5AV5 A;  5KDM B;  3REJ A;  5JRG D;  4KHA B;  3B6F C;  3C1B A;  1H3O B;  3NQJ B;  1ID3 B;  4Z5T B;  1P3A A;  2CV5 A;  1P3P B;  5AV5 D;  3REJ D;  5JA4 B;  4X23 B;  3AZI A;  3MGQ C;  3AYW B;  3C1B D;  4KUD A;  3WAA C;  1P3A D;  4YM6 B;  2CV5 D;  5E5A B;  1P3I C;  3AZE A;  3AZE C;  3AZI D;  5CPI A;  4J8U B;  3X1T A;  5BNV A;  4H9N A;  4XZQ C;  5B0Y A;  4KUD D;  1WWS A;  3WKJ B;  3WTP A;  5B31 G;  3AZE D;  5CPI D;  3REH B;  3AV1 B;  5B0Z A;  3X1T D;  3W96 A;  5B0Y D;  3WTP D;  1P3K A;  3WA9 B;  3LJA C;  3LJA A;  5B2I B;  1Q9C A;  3TU4 B;  4LD9 B;  4H9R A;  5B0Z D;  3AZK B;  3W96 D;  1KX3 C;  4QLC C;  1JFI B;  5B1L C;  1P3K D;  3V9R A;  3MGP B;  2FJ7 A;  2FJ7 C;  5B40 B;  3LJA D;  3LEL B;  3KWQ A;  5CPJ C;  4ZUX C;  2YFV A;  4DRB A;  1KU5 A;  2FJ7 D;  3KWQ D;  5GXQ A;  1BH9 B;  5AVB B;  5CPK A;  5CPK C;  4H9Q B;  2ARO C;  4CSR A;  5BO0 B;  5B31 B;  3AFA C;  3MVD C;  3REJ B;  5GXQ D;  5AY8 B;  1BH8 B;  5CPK D;  1P3O B;  3AZF C;  3AZF A;  1M19 B;  1S32 C;  1S32 A;  3C1B B;  3AV2 A;  5AVC B;  5B2J B;  4WU8 C;  1HQ3 C;  1P3A B;  2CV5 B;  4M6B A;  5KDM A;  3AZI B;  3W98 C;  2NQB D;  2HIO A;  3UTA B;  3AZF D;  5GT0 A;  4KHA A;  1S32 D;  3AV2 D;  3NQJ A;  1ID3 C;  5CP6 B;  5G49 B;  4Z5T C;  1P3P C;  1P3P A;  4X23 C;  5CPI B;  1EQZ B;  2HIO D;  1P3L B;  5GT0 D;  3AYW C;  5BNV B;  4H9N B;  5B0Y B;  4YM6 A;  4H9S C;  5E5A C;  3X1S B;  3W97 B;  2NZD A;  2CWE A;  4J8U A;  4J8U C;  4Z2M H;  3W96 B;  1U35 B;  1ZLA B;  4YM6 D;  3WKJ A;  5B1M A;  3WKJ C;  3REH A;  2NZD D;  3AV1 C;  4G91 B;  4J8U D;  1B6W A;  3AN2 C;  2BYM B;  3UTB C;  5B1M D;  3V9R B;  3WKJ D;  3WA9 A;  2PYO C;  3REH D;  4ZBJ C;  5DNM A;  5B2I C;  3TU4 C;  4LD9 C;  3KXB B;  3AZK A;  4LD9 A;  5DNN B;  3WA9 D;  3MGP C;  3WTP E;  3MGP A;  5B40 C;  5DNM D;  3LEL A;  3LEL C;  5GXQ B;  4LD9 D;  3AZK D;  1KX4 B;  3O62 A;  4J8V A;  2F8N K;  1BH9 A;  5JRG C;  2NQB B;  5AVB C;  5AVB A;  4WU9 B;  3AZJ B;  5AV8 B;  3O62 D;  4H9Q A;  4J8V D;  3AV2 B;  2LY8 A;  3VH6 A;  5B31 A;  5B31 C;  2RVQ D;  5AV5 C;  3REJ C;  5AY8 C;  5AY8 A;  2HIO B;  1BH8 A;  5AVB D;  1P3O C;  1P3O A;  1M19 A;  5GT0 B;  3REL A;  4H9O A;  3C1B C;  4DRA A;  5AVC A;  5B31 D;  5B2J A;  5B2J C;  1P3A C;  4E44 A;  5B32 G;  2CV5 C;  3AZI C;  5AY8 D;  1M19 D;  1P3O D;  3UTA A;  3REL D;  3B0D B;  2JSS A;  4KUD C;  5AVC D;  5CP6 A;  5CP6 C;  5G49 A;  5GT3 B;  5B2J D;  3AZN A;  1P34 A;  5CPI C;  1EQZ A;  4JJN B;  2NZD B;  3KUY B;  3UTA D;  1P3L A;  1R4V A;  3AZM B;  3X1T C;  5AV9 A;  5B0Y C;  5CP6 D;  1P34 D;  3AZN D;  3LZ0 B;  5B1M B;  3WTP C;  3X1S A;  3X1S C;  1EQZ D;  3W97 A;  1P3L D;  5B0Z C;  2F8N H;  5AV9 D;  3W96 C;  1U35 C;  1U35 A;  1ZLA A;  1F66 A;  1ZLA C;  4NFT A;  4WZS B;  1P3K C;  3X1S D;  3MGR D;  5DNM B;  1P3M A;  3W97 D;  3B0B A;  4G91 C;  1U35 D;  2BYM A;  1ZLA D;  1F66 D;  5B32 B;  1P3M D;  3KWQ C;  3REI B;  3KXB A;  5DNN C;  5DNN A;  3O62 B;  5BT1 D;  4J8V B;  5GSU D;  1P3G B;  5GXQ C;  1A7W A;  1P3F B;  3KXB D;  1KX4 A;  5DNN D;  1KX4 C;  3VH6 T;  1AOI B;  1TZY D;  3REK B;  4H9P A;  2NQB A;  2NQB C;  4WU9 A;  3AZJ A;  3AZJ C;  5AV8 A;  3REL B;  1KX4 D;  4H9O B;  5F99 B;  4KGC A;  4YS3 A;  3X1U B;  3AV2 C;  4G92 B;  5B33 B;  2HIO C;  3A6N A;  4NE6 A;  5BS7 A;  5BS7 C;  5AV8 D;  4WU9 D;  5GT0 C;  3AZJ D;  4KGC D;  4YS3 D;  4XUJ A;  1M18 A;  3MGS A;  1P34 B;  3AZN B;  2BYK A;  5FUG A;  3NQU B;  2F8N G;  3A6N D;  4Z66 B;  3B6G A;  5AV9 B;  2L5A A;  3B0D C;  4XUJ D;  3AZL A;  1M18 D;  3MGS D;  5GT3 C;  5GT3 A;  4YM6 C;  3MGR B;  4JJN A;  3MNN A;  2NZD C;  3KUY A;  3KUY C;  3AZM A;  3AZM C;  3B6G D;  3MGQ B;  3AZL D;  1F1E A;  5GT3 D;  1F66 B;  3LZ0 A;  5B1M C;  3LZ0 C;  5C3I B;  3REH C;  1P3M B;  4JJN D;  3MNN D;  3KUY D;  1P3I B;  3AZM D;  5GSU B;  3LZ0 D;  3W99 A;  3WA9 C;  5DNM C;  1N1J B;  4XZQ B;  3AZK C;  4NE5 A;  5B32 A;  5B32 C;  3W99 D;  1TZY B;  2F8N B;  3REI A;  3O62 C;  4J8V C;  5CHL B;  5B32 D;  1P3G A;  2RVQ C;  3KSY A;  1KX3 B;  3REI D;  3LZ1 B;  4NE3 A;  4H9P B;  1P3F A;  1P3F C;  3X1V A;  1P3B A;  3AZH A;  3AZG B;  4KGC B;  4YS3 B;  3UT9 B;  1P3G D;  1AOI A;  1AOI C;  3VH6 W;  4ZUX B;  3REK A;  3REK C;  1P3F D;  3A6N B;  1M19 C;  3X1V D;  1P3B D;  3REL C;  1M1A B;  5F99 A;  5F99 C;  3AZH D;  3X1U A;  4XUJ B;  1M18 B;  3C1C A;  5AVC C;  3MGS B;  1AOI D;  2BYK B;  5B33 A;  5B33 C;  3REK D;  5FUG B;  4Z2M G;  5B24 A;  3UTA C;  3AFA B;  5F99 D;  1KX5 B;  3B6G B;  3X1U D;  3AZL B;  3C1C D;  1P34 C;  3AZN C;  4R8P D;  4UUZ B;  5B33 D;  1EQZ C;  4WNN B;  3NQU A;  3MNN B;  5B24 D;  1P3L C;  1HQ3 B;  4Z66 A;  4Z66 C;  5AV9 C;  3W98 B;  1HTA A;  1TAF B;  3B6F A;  4HGA B;  3MGR A;  3MGR C;  3W97 C;  4Z66 D;  3MGQ A;  2HUE B;  4J8W B;  1F66 C;  3W99 B;  5C3I C;  3B6F D;  1P3M C;  3WAA A;  1P3I A;  5BT1 C;  3MGQ D;  4AWL B;  2YFW A;  5GSU A;  5GSU C;  1N1J A;  4XZQ A;  3WAA D;  3VH5 T;  3KXB C;  1P3I D;  4EO5 B;  2IO5 B;  1TZY A;  1TZY C;  5AV6 B;  4J8X B;  2F8N A;  4XZQ D;  3AN2 B;  3UTB B;  3X1V B;  1P3B B;  3AZH B;  2PYO B;  4ZBJ B;  1BFM A;  2F8N D;  1KX3 A;  3LZ1 A;  4QLC A;  3LZ1 C;  5B1L A;  4WU9 C;  5AV8 C;  3B0C T;  3AZG A;  3AZG C;  4YS3 C;  4KGC C;  5CPJ A;  3C1C B;  3UT9 A;  3UT9 C;  4ZUX A;  4R8P B;  3R45 A;  1KX3 D;  3LZ1 D;  4QLC D;  5B1L D; 
#chains in the Genus database with same CATH topology
 5B24 B;  3A6N C;  1M1A A;  1M1A C;  5BNX A;  3AZG D;  5CPJ D;  4XUJ C;  5JRG B;  3F6T A;  3MGS C;  3UT9 D;  1M18 C;  4ZUX D;  2ARO A;  3EPL A;  2ZM5 A;  4E45 A;  3AFA A;  3MVD A;  1M1A D;  1KX5 A;  5AV5 B;  1KX5 C;  1ULY A;  3B6G C;  3AZL C;  2Y2M A;  2ARO D;  4UUZ A;  3B6F B;  1T3U A;  4WNN A;  4JJN C;  3MNN C;  4WU8 A;  1HQ3 A;  4CAY A;  3MVD D;  3AFA D;  1KX5 D;  2ZY2 A;  3W98 A;  1TAF A;  2Y2N A;  4HGA C;  1H3O A;  4KUD B;  2Y2O A;  4WV4 B;  1ID3 A;  3WAA B;  4WU8 D;  4Z5T A;  1HQ3 D;  3AZE B;  5JA4 A;  4X23 A;  3W98 D;  2HUE C;  2YFW B;  4J8W A;  4J8W C;  3W99 C;  3X1T B;  3AYW A;  1ID3 D;  4Z5T D;  4H9S A;  3WTP B;  5E5A A;  1P3P D;  4X23 D;  3AL0 C;  1W2E A;  4AWL C;  4J8W D;  5B0Z B;  3AYW D;  2DF4 C;  1B67 A;  3REI C;  3VH5 A;  3VH5 W;  5E5A D;  1P3K B;  3LJA B;  4EO5 C;  2Y2K A;  3AV1 A;  2IO5 C;  4H9R B;  1P3G C;  2XD5 A;  5AV6 A;  5AV6 C;  4J8X C;  4J8X A;  4QLC B;  3AN2 A;  5B1L B;  3H0L C;  3UTB A;  3X1V C;  1P3B C;  2FJ7 B;  3AZH C;  2PYO A;  3KWQ B;  5B2I A;  3AV1 D;  5CPJ B;  3TU4 A;  5AV6 D;  4J8X D;  3R45 B;  1JFI A;  3AN2 D;  2YFV B;  3UTB D;  2PYO D;  5B40 A;  5BNX B;  5B2I D;  3X1U C;  1WWI A;  3B0C W;  3C1C C;  3TU4 D;  5CPK B;  4G92 C;  4R8P C;  2ARO B;  4CSR B;  4R8P A;  1Z2C B;  5B24 C;  3MGP D;  3MVD B;  5B40 D;  3LEL D;  5JRG A;  3AZF B;  1S32 B;  3EPH A;  5BO0 A;  4WU8 B;  4CAY B;  5AV5 A;  5KDM B;  3REJ A;  5JRG D;  4KHA B;  3A1K A;  3B6F C;  3C1B A;  1H3O B;  3NQJ B;  1ID3 B;  4Z5T B;  1P3A A;  2CV5 A;  1P3P B;  5AV5 D;  3REJ D;  5JA4 B;  4X23 B;  3AZI A;  3MGQ C;  2DQN C;  3AYW B;  3C1B D;  4KUD A;  3WAA C;  1P3A D;  4YM6 B;  2CV5 D;  5E5A B;  1P3I C;  3AZE A;  3AZE C;  3AZI D;  5CPI A;  4J8U B;  3X1T A;  5BNV A;  4H9N A;  4XZQ C;  5B0Y A;  4KUD D;  1WWS A;  3WKJ B;  3WTP A;  5B31 G;  3AZE D;  5CPI D;  3REH B;  3AV1 B;  3EG5 B;  5B0Z A;  3X1T D;  3W96 A;  5B0Y D;  3WTP D;  1P3K A;  3WA9 B;  3LJA C;  3LJA A;  5B2I B;  1Q9C A;  3TU4 B;  4LD9 B;  2FFF B;  4H9R A;  5B0Z D;  3AZK B;  3W96 D;  1KX3 C;  4QLC C;  1JFI B;  5B1L C;  1P3K D;  3V9R A;  3MGP B;  2FJ7 A;  2FJ7 C;  5B40 B;  3LJA D;  3LEL B;  3KWQ A;  5CPJ C;  4ZUX C;  2YFV A;  4DRB A;  1KU5 A;  2FJ7 D;  2W8S A;  5GXQ A;  3KWQ D;  1BH9 B;  5AVB B;  5CPK A;  5CPK C;  4H9Q B;  2ARO C;  4CSR A;  5BO0 B;  5B31 B;  3AFA C;  3MVD C;  3REJ B;  5GXQ D;  5AY8 B;  1BH8 B;  5CPK D;  1P3O B;  3AZF C;  3H0R C;  3AZF A;  1M19 B;  1S32 C;  1S32 A;  3C1B B;  3AV2 A;  5AVC B;  5B2J B;  4WU8 C;  1HQ3 C;  1P3A B;  2CV5 B;  4M6B A;  5KDM A;  3AZI B;  3W98 C;  2NQB D;  2HIO A;  3UTA B;  3AZF D;  5GT0 A;  4KHA A;  1S32 D;  3AV2 D;  3NQJ A;  1ID3 C;  5CP6 B;  5G49 B;  4Z5T C;  1P3P C;  1P3P A;  4X23 C;  5CPI B;  1EQZ B;  2HIO D;  1P3L B;  5GT0 D;  3AYW C;  5BNV B;  4H9N B;  5B0Y B;  4YM6 A;  4H9S C;  5E5A C;  3X1S B;  3W97 B;  2NZD A;  2CWE A;  4J8U A;  4J8U C;  4Z2M H;  3W96 B;  1U35 B;  1ZLA B;  4YM6 D;  3WKJ A;  5B1M A;  3WKJ C;  3REH A;  2NZD D;  3AV1 C;  4G91 B;  4J8U D;  1B6W A;  3AN2 C;  2BYM B;  3UTB C;  5B1M D;  3V9R B;  3WKJ D;  3WA9 A;  2PYO C;  3REH D;  4ZBJ C;  5DNM A;  5B2I C;  3TU4 C;  4LD9 C;  3KXB B;  3AZK A;  4LD9 A;  5DNN B;  3EPK A;  2BG1 A;  2Y2L A;  3WA9 D;  3MGP C;  3WTP E;  3MGP A;  5B40 C;  5DNM D;  3LEL A;  3LEL C;  5GXQ B;  2JE5 A;  4LD9 D;  3AZK D;  1KX4 B;  3O62 A;  4J8V A;  2F8N K;  1BH9 A;  5JRG C;  2NQB B;  5AVB C;  5AVB A;  4WU9 B;  3AZJ B;  5AV8 B;  3O62 D;  4H9Q A;  4J8V D;  3AV2 B;  2LY8 A;  3VH6 A;  5B31 A;  5B31 C;  4DQY B;  2RVQ D;  5AV5 C;  3REJ C;  5AY8 C;  5AY8 A;  2HIO B;  1BH8 A;  5AVB D;  1P3O C;  1P3O A;  1M19 A;  5GT0 B;  3REL A;  4H9O A;  3C1B C;  4DRA A;  5AVC A;  3FDD A;  5B31 D;  5B2J A;  5B2J C;  1P3A C;  4E44 A;  5B32 G;  2CV5 C;  2ZY5 A;  3AZI C;  5AY8 D;  1M19 D;  1P3O D;  3UTA A;  3REL D;  3H0M C;  3B0D B;  2JSS A;  4KUD C;  5CP6 A;  5CP6 C;  5AVC D;  5G49 A;  5GT3 B;  5B2J D;  3AZN A;  1P34 A;  2Y2Q A;  5CPI C;  1EQZ A;  4JJN B;  2NZD B;  3KUY B;  3UTA D;  1P3L A;  3EPJ A;  1R4V A;  3AZM B;  3X1T C;  5AV9 A;  5B0Y C;  5CP6 D;  1P34 D;  3AZN D;  3LZ0 B;  5B1M B;  3WTP C;  3X1S A;  3X1S C;  1EQZ D;  3KFU G;  3W97 A;  1P3L D;  5B0Z C;  2F8N H;  5AV9 D;  3W96 C;  1U35 C;  1U35 A;  1ZLA A;  1F66 A;  1ZLA C;  4NFT A;  4WZS B;  1P3K C;  3X1S D;  3MGR D;  5DNM B;  1P3M A;  3W97 D;  3B0B A;  4G91 C;  1U35 D;  2BYM A;  1ZLA D;  1F66 D;  5B32 B;  1P3M D;  3KWQ C;  3REI B;  3KXB A;  5DNN C;  5DNN A;  3O62 B;  5BT1 D;  4J8V B;  5GSU D;  1P3G B;  5GXQ C;  1A7W A;  1P3F B;  3KXB D;  1KX4 A;  5DNN D;  1KX4 C;  3VH6 T;  1PZR A;  1AOI B;  1TZY D;  3REK B;  4H9P A;  2NQB A;  2NQB C;  4WU9 A;  3AZJ A;  3AZJ C;  5AV8 A;  3REL B;  1KX4 D;  4H9O B;  5F99 B;  4KGC A;  4YS3 A;  3X1U B;  3AV2 C;  4G92 B;  5B33 B;  2HIO C;  3A6N A;  4NE6 A;  5BS7 A;  5BS7 C;  5AV8 D;  2ZY4 A;  5GT0 C;  4WU9 D;  3AZJ D;  4KGC D;  4YS3 D;  2UWX A;  4XUJ A;  1M18 A;  3MGS A;  3A1I A;  1P34 B;  3AZN B;  2BYK A;  2ZY3 A;  5FUG A;  3NQU B;  2F8N G;  3A6N D;  4Z66 B;  3B6G A;  5AV9 B;  2L5A A;  3B0D C;  4XUJ D;  3AZL A;  1M18 D;  3MGS D;  5GT3 C;  5GT3 A;  2G5H C;  4YM6 C;  3MGR B;  4JJN A;  3MNN A;  2NZD C;  3KUY A;  3KUY C;  3AZM A;  3AZM C;  3B6G D;  2RIQ A;  3MGQ B;  3AZL D;  2XD1 A;  1F1E A;  5GT3 D;  1F66 B;  3LZ0 A;  5B1M C;  3LZ0 C;  5C3I B;  3REH C;  1P3M B;  4JJN D;  3MNN D;  3KUY D;  1P3I B;  3AZM D;  5GSU B;  3LZ0 D;  3W99 A;  3WA9 C;  5DNM C;  1N1J B;  2Y2H A;  4XZQ B;  2VQR A;  3AZK C;  4NE5 A;  5B32 A;  5B32 C;  3W99 D;  1TZY B;  2F8N B;  3REI A;  3O62 C;  2G5I C;  4J8V C;  5CHL B;  5B32 D;  1P3G A;  2RVQ C;  2F2A C;  3KSY A;  1KX3 B;  3REI D;  3LZ1 B;  4NE3 A;  4H9P B;  1P3F A;  1P3F C;  3X1V A;  1P3B A;  3AZH A;  3AZG B;  4KGC B;  4YS3 B;  3UT9 B;  1P3G D;  1AOI A;  1AOI C;  3VH6 W;  4ZUX B;  3REK A;  3REK C;  1P3F D;  3A6N B;  1M19 C;  3X1V D;  1P3B D;  3REL C;  1M1A B;  5F99 A;  5F99 C;  3AZH D;  3X1U A;  2J8P A;  4XUJ B;  1M18 B;  3C1C A;  5AVC C;  3MGS B;  1AOI D;  2BYK B;  5B33 A;  5B33 C;  3REK D;  5FUG B;  4Z2M G;  5B24 A;  3UTA C;  3IP4 C;  3AFA B;  5F99 D;  1KX5 B;  3B6G B;  3X1U D;  3AZL B;  3C1C D;  1P34 C;  3AZN C;  4R8P D;  4UUZ B;  5B33 D;  1EQZ C;  4WNN B;  3NQU A;  3MNN B;  5B24 D;  1P3L C;  1HQ3 B;  4Z66 A;  4Z66 C;  5AV9 C;  3W98 B;  1HTA A;  1TAF B;  2Y2G A;  3B6F A;  4HGA B;  3MGR A;  3MGR C;  3W97 C;  4Z66 D;  3MGQ A;  2HUE B;  4J8W B;  1F66 C;  3W99 B;  5C3I C;  3B6F D;  1P3M C;  4WJ3 C;  3WAA A;  2JCH A;  1P3I A;  5BT1 C;  3MGQ D;  4AWL B;  2YFW A;  5GSU A;  5GSU C;  2Y2I A;  1N1J A;  4XZQ A;  3WAA D;  3VH5 T;  2Y2J A;  3KXB C;  1P3I D;  2Y2P A;  4EO5 B;  2IO5 B;  1TZY A;  1TZY C;  5AV6 B;  4J8X B;  2F8N A;  4XZQ D;  4UPK A;  3AN2 B;  3UTB B;  3X1V B;  1P3B B;  3AZH B;  2PYO B;  4ZBJ B;  1BFM A;  3P5J B;  2F8N D;  1KX3 A;  3LZ1 A;  4QLC A;  3LZ1 C;  5B1L A;  4WU9 C;  5AV8 C;  3B0C T;  3AZG A;  3AZG C;  4YS3 C;  4KGC C;  5CPJ A;  3C1C B;  3UT9 A;  3UT9 C;  4ZUX A;  4R8P B;  3R45 A;  1KX3 D;  3LZ1 D;  4QLC D;  5B1L D; 
#chains in the Genus database with same CATH homology
 5B24 B;  3A6N C;  1M1A A;  1M1A C;  5BNX A;  3AZG D;  5CPJ D;  4XUJ C;  5JRG B;  3F6T A;  3MGS C;  3UT9 D;  1M18 C;  4ZUX D;  2ARO A;  3EPL A;  2ZM5 A;  4E45 A;  3AFA A;  3MVD A;  1M1A D;  1KX5 A;  5AV5 B;  1KX5 C;  1ULY A;  3B6G C;  3AZL C;  2Y2M A;  2ARO D;  4UUZ A;  3B6F B;  1T3U A;  4WNN A;  4JJN C;  3MNN C;  4WU8 A;  1HQ3 A;  4CAY A;  3MVD D;  3AFA D;  1KX5 D;  2ZY2 A;  3W98 A;  1TAF A;  2Y2N A;  4HGA C;  1H3O A;  4KUD B;  2Y2O A;  4WV4 B;  1ID3 A;  3WAA B;  4WU8 D;  4Z5T A;  1HQ3 D;  3AZE B;  5JA4 A;  4X23 A;  3W98 D;  2HUE C;  2YFW B;  4J8W A;  4J8W C;  3W99 C;  3X1T B;  3AYW A;  1ID3 D;  4Z5T D;  4H9S A;  3WTP B;  5E5A A;  1P3P D;  4X23 D;  3AL0 C;  1W2E A;  4AWL C;  4J8W D;  5B0Z B;  3AYW D;  2DF4 C;  1B67 A;  3REI C;  3VH5 A;  3VH5 W;  5E5A D;  1P3K B;  3LJA B;  4EO5 C;  2Y2K A;  3AV1 A;  2IO5 C;  4H9R B;  1P3G C;  2XD5 A;  5AV6 A;  5AV6 C;  4J8X C;  4J8X A;  4QLC B;  3AN2 A;  5B1L B;  3H0L C;  3UTB A;  3X1V C;  1P3B C;  2FJ7 B;  3AZH C;  2PYO A;  3KWQ B;  5B2I A;  3AV1 D;  5CPJ B;  3TU4 A;  5AV6 D;  4J8X D;  3R45 B;  1JFI A;  3AN2 D;  2YFV B;  3UTB D;  2PYO D;  5B40 A;  5BNX B;  5B2I D;  3X1U C;  1WWI A;  3B0C W;  3C1C C;  3TU4 D;  5CPK B;  4G92 C;  4R8P C;  2ARO B;  4CSR B;  4R8P A;  1Z2C B;  5B24 C;  3MGP D;  3MVD B;  5B40 D;  3LEL D;  5JRG A;  3AZF B;  1S32 B;  3EPH A;  5BO0 A;  4WU8 B;  4CAY B;  5AV5 A;  5KDM B;  3REJ A;  5JRG D;  4KHA B;  3A1K A;  3B6F C;  3C1B A;  1H3O B;  3NQJ B;  1ID3 B;  4Z5T B;  1P3A A;  2CV5 A;  1P3P B;  5AV5 D;  3REJ D;  5JA4 B;  4X23 B;  3AZI A;  3MGQ C;  2DQN C;  3AYW B;  3C1B D;  4KUD A;  3WAA C;  1P3A D;  4YM6 B;  2CV5 D;  5E5A B;  1P3I C;  3AZE A;  3AZE C;  3AZI D;  5CPI A;  4J8U B;  3X1T A;  5BNV A;  4H9N A;  4XZQ C;  5B0Y A;  4KUD D;  1WWS A;  3WKJ B;  3WTP A;  5B31 G;  3AZE D;  5CPI D;  3REH B;  3AV1 B;  3EG5 B;  5B0Z A;  3X1T D;  3W96 A;  5B0Y D;  3WTP D;  1P3K A;  3WA9 B;  3LJA C;  3LJA A;  5B2I B;  1Q9C A;  3TU4 B;  4LD9 B;  2FFF B;  4H9R A;  5B0Z D;  3AZK B;  3W96 D;  1KX3 C;  4QLC C;  1JFI B;  5B1L C;  1P3K D;  3V9R A;  3MGP B;  2FJ7 A;  2FJ7 C;  5B40 B;  3LJA D;  3LEL B;  3KWQ A;  5CPJ C;  4ZUX C;  2YFV A;  4DRB A;  1KU5 A;  2FJ7 D;  2W8S A;  5GXQ A;  3KWQ D;  1BH9 B;  5AVB B;  5CPK A;  5CPK C;  4H9Q B;  2ARO C;  4CSR A;  5BO0 B;  5B31 B;  3AFA C;  3MVD C;  3REJ B;  5GXQ D;  5AY8 B;  1BH8 B;  5CPK D;  1P3O B;  3AZF C;  3H0R C;  3AZF A;  1M19 B;  1S32 C;  1S32 A;  3C1B B;  3AV2 A;  5AVC B;  5B2J B;  4WU8 C;  1HQ3 C;  1P3A B;  2CV5 B;  4M6B A;  5KDM A;  3AZI B;  3W98 C;  2NQB D;  2HIO A;  3UTA B;  3AZF D;  5GT0 A;  4KHA A;  1S32 D;  3AV2 D;  3NQJ A;  1ID3 C;  5CP6 B;  5G49 B;  4Z5T C;  1P3P C;  1P3P A;  4X23 C;  5CPI B;  1EQZ B;  2HIO D;  1P3L B;  5GT0 D;  3AYW C;  5BNV B;  4H9N B;  5B0Y B;  4YM6 A;  4H9S C;  5E5A C;  3X1S B;  3W97 B;  2NZD A;  2CWE A;  4J8U A;  4J8U C;  4Z2M H;  3W96 B;  1U35 B;  1ZLA B;  4YM6 D;  3WKJ A;  5B1M A;  3WKJ C;  3REH A;  2NZD D;  3AV1 C;  4G91 B;  4J8U D;  1B6W A;  3AN2 C;  2BYM B;  3UTB C;  5B1M D;  3V9R B;  3WKJ D;  3WA9 A;  2PYO C;  3REH D;  4ZBJ C;  5DNM A;  5B2I C;  3TU4 C;  4LD9 C;  3KXB B;  3AZK A;  4LD9 A;  5DNN B;  3EPK A;  2BG1 A;  2Y2L A;  3WA9 D;  3MGP C;  3WTP E;  3MGP A;  5B40 C;  5DNM D;  3LEL A;  3LEL C;  5GXQ B;  2JE5 A;  4LD9 D;  3AZK D;  1KX4 B;  3O62 A;  4J8V A;  2F8N K;  1BH9 A;  5JRG C;  2NQB B;  5AVB C;  5AVB A;  4WU9 B;  3AZJ B;  5AV8 B;  3O62 D;  4H9Q A;  4J8V D;  3AV2 B;  2LY8 A;  3VH6 A;  5B31 A;  5B31 C;  4DQY B;  2RVQ D;  5AV5 C;  3REJ C;  5AY8 C;  5AY8 A;  2HIO B;  1BH8 A;  5AVB D;  1P3O C;  1P3O A;  1M19 A;  5GT0 B;  3REL A;  4H9O A;  3C1B C;  4DRA A;  5AVC A;  3FDD A;  5B31 D;  5B2J A;  5B2J C;  1P3A C;  4E44 A;  5B32 G;  2CV5 C;  2ZY5 A;  3AZI C;  5AY8 D;  1M19 D;  1P3O D;  3UTA A;  3REL D;  3H0M C;  3B0D B;  2JSS A;  4KUD C;  5CP6 A;  5CP6 C;  5AVC D;  5G49 A;  5GT3 B;  5B2J D;  3AZN A;  1P34 A;  2Y2Q A;  5CPI C;  1EQZ A;  4JJN B;  2NZD B;  3KUY B;  3UTA D;  1P3L A;  3EPJ A;  1R4V A;  3AZM B;  3X1T C;  5AV9 A;  5B0Y C;  5CP6 D;  1P34 D;  3AZN D;  3LZ0 B;  5B1M B;  3WTP C;  3X1S A;  3X1S C;  1EQZ D;  3KFU G;  3W97 A;  1P3L D;  5B0Z C;  2F8N H;  5AV9 D;  3W96 C;  1U35 C;  1U35 A;  1ZLA A;  1F66 A;  1ZLA C;  4NFT A;  4WZS B;  1P3K C;  3X1S D;  3MGR D;  5DNM B;  1P3M A;  3W97 D;  3B0B A;  4G91 C;  1U35 D;  2BYM A;  1ZLA D;  1F66 D;  5B32 B;  1P3M D;  3KWQ C;  3REI B;  3KXB A;  5DNN C;  5DNN A;  3O62 B;  5BT1 D;  4J8V B;  5GSU D;  1P3G B;  5GXQ C;  1A7W A;  1P3F B;  3KXB D;  1KX4 A;  5DNN D;  1KX4 C;  3VH6 T;  1PZR A;  1AOI B;  1TZY D;  3REK B;  4H9P A;  2NQB A;  2NQB C;  4WU9 A;  3AZJ A;  3AZJ C;  5AV8 A;  3REL B;  1KX4 D;  4H9O B;  5F99 B;  4KGC A;  4YS3 A;  3X1U B;  3AV2 C;  4G92 B;  5B33 B;  2HIO C;  3A6N A;  4NE6 A;  5BS7 A;  5BS7 C;  5AV8 D;  2ZY4 A;  5GT0 C;  4WU9 D;  3AZJ D;  4KGC D;  4YS3 D;  2UWX A;  4XUJ A;  1M18 A;  3MGS A;  3A1I A;  1P34 B;  3AZN B;  2BYK A;  2ZY3 A;  5FUG A;  3NQU B;  2F8N G;  3A6N D;  4Z66 B;  3B6G A;  5AV9 B;  2L5A A;  3B0D C;  4XUJ D;  3AZL A;  1M18 D;  3MGS D;  5GT3 C;  5GT3 A;  2G5H C;  4YM6 C;  3MGR B;  4JJN A;  3MNN A;  2NZD C;  3KUY A;  3KUY C;  3AZM A;  3AZM C;  3B6G D;  2RIQ A;  3MGQ B;  3AZL D;  2XD1 A;  1F1E A;  5GT3 D;  1F66 B;  3LZ0 A;  5B1M C;  3LZ0 C;  5C3I B;  3REH C;  1P3M B;  4JJN D;  3MNN D;  3KUY D;  1P3I B;  3AZM D;  5GSU B;  3LZ0 D;  3W99 A;  3WA9 C;  5DNM C;  1N1J B;  2Y2H A;  4XZQ B;  2VQR A;  3AZK C;  4NE5 A;  5B32 A;  5B32 C;  3W99 D;  1TZY B;  2F8N B;  3REI A;  3O62 C;  2G5I C;  4J8V C;  5CHL B;  5B32 D;  1P3G A;  2RVQ C;  2F2A C;  3KSY A;  1KX3 B;  3REI D;  3LZ1 B;  4NE3 A;  4H9P B;  1P3F A;  1P3F C;  3X1V A;  1P3B A;  3AZH A;  3AZG B;  4KGC B;  4YS3 B;  3UT9 B;  1P3G D;  1AOI A;  1AOI C;  3VH6 W;  4ZUX B;  3REK A;  3REK C;  1P3F D;  3A6N B;  1M19 C;  3X1V D;  1P3B D;  3REL C;  1M1A B;  5F99 A;  5F99 C;  3AZH D;  3X1U A;  2J8P A;  4XUJ B;  1M18 B;  3C1C A;  5AVC C;  3MGS B;  1AOI D;  2BYK B;  5B33 A;  5B33 C;  3REK D;  5FUG B;  4Z2M G;  5B24 A;  3UTA C;  3IP4 C;  3AFA B;  5F99 D;  1KX5 B;  3B6G B;  3X1U D;  3AZL B;  3C1C D;  1P34 C;  3AZN C;  4R8P D;  4UUZ B;  5B33 D;  1EQZ C;  4WNN B;  3NQU A;  3MNN B;  5B24 D;  1P3L C;  1HQ3 B;  4Z66 A;  4Z66 C;  5AV9 C;  3W98 B;  1HTA A;  1TAF B;  2Y2G A;  3B6F A;  4HGA B;  3MGR A;  3MGR C;  3W97 C;  4Z66 D;  3MGQ A;  2HUE B;  4J8W B;  1F66 C;  3W99 B;  5C3I C;  3B6F D;  1P3M C;  4WJ3 C;  3WAA A;  2JCH A;  1P3I A;  5BT1 C;  3MGQ D;  4AWL B;  2YFW A;  5GSU A;  5GSU C;  2Y2I A;  1N1J A;  4XZQ A;  3WAA D;  3VH5 T;  2Y2J A;  3KXB C;  1P3I D;  2Y2P A;  4EO5 B;  2IO5 B;  1TZY A;  1TZY C;  5AV6 B;  4J8X B;  2F8N A;  4XZQ D;  4UPK A;  3AN2 B;  3UTB B;  3X1V B;  1P3B B;  3AZH B;  2PYO B;  4ZBJ B;  1BFM A;  3P5J B;  2F8N D;  1KX3 A;  3LZ1 A;  4QLC A;  3LZ1 C;  5B1L A;  4WU9 C;  5AV8 C;  3B0C T;  3AZG A;  3AZG C;  4YS3 C;  4KGC C;  5CPJ A;  3C1C B;  3UT9 A;  3UT9 C;  4ZUX A;  4R8P B;  3R45 A;  1KX3 D;  3LZ1 D;  4QLC D;  5B1L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...