3AZHB

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhB00
3AN2B 3NQJA 3KXBB 1ZLAB 5B0YC 5AVBD 2AROD 4H9SC 3WTPD 3B0DC 3W98C 3RELD 1WWIA 1P3GD 4JJND 1KX5B 1P3BB 1P3LA 5F99B 1P3IA 5CP6B 3C1BC 4H9QB 4Z2MG 5E5AC 5CHLB 5FUGA 5AY8D 1KX4D 1TAFB 3W96D 4X23A 3AZMD 3LZ1C 1TZYD 3X1VB 1P3OD 5AVBC 2AROC 3O62A 3UT9A 3WAAB 3WTPC 1EQZB 5CPJB 3RELC 1P3GC 3MVDD 1AOIB 2BYMA 5B0YB 1B6WA 4JJNC 1AOIC 3AV2D 2FJ7A 3TU4A 3W98B 5B33A 5GT3C 5B1LA 3KUYB 4G91B 3X1UD 1HQ3A 4XUJA 1HTAA 4YS3B 4AWLB 2F8NA 2HIOA 5AY8C 3AZHB 1KX4C 3W96C 5DNMA 4WU9B 3AFAA 3AZMC 1TZYC 1P3OC 4R8PA 1U35D 1M1AA 4QLCA 4H9RA 4ZBJC 1P3LD 4J8VA 3REKA 3A6NB 3LZ1B 3MVDC 3LJAD 5G49A 3AV1B 1P3ID 5AVCA 5BNXA 4J8WD 3MNNA 4NE5A 3AV2C 1S32B 3RELB 1P3GB 4YM6B 4CSRB 3X1UC 4H9SA 5AV6B 1BH9B 5GT3B 3O62D 3UT9D 3AZKB 1M18A 3AZJA 1P3AD 3W97A 1P34D 3WA9D 3MGQD 5GSUA 3AZND 3C1BA 1U35C 1P3MD 2FJ7D 3TU4D 1P3LC 3AZMB 3LJAC 3MGSB 1P3IC 1JFIA 1HQ3D 1TZYB 4KGCB 4XUJD 5B2IA 5AV5B 4J8WC 2HIOD 4ZBJB 3MVDB 4XZQB 4X23C 5AVBA 4DRAA 3AFAD 5BNVA 5B24A 3REIA 3AZED 4UUZA 4R8PD 4NFTA 3O62C 3UT9C 1F66B 1P3AC 4H9NB 5B1MD 1P34C 5AVCD 3B0CT 3AZLA 5C3IC 3AZIB 2FJ7C 3TU4C 5AY8A 1KX4A 1HQ3C 4Z66D 4XUJC 2HIOC 5AV8A 4ZUXB 4CAYA 1M18D 1KX3A 3AZJD 3AFAC 3W97D 4G92B 3AZEC 4M6BA 5GSUD 3R45A 4R8PC 3MGRA 4X23B 5AV9A 5B1MC 5B2ID 5KDMA 5AVCC 3X1UA 4WZSB 2BYMB 5B24D 1KU5A 3REID 3REHD 5C3IB 3KWQA 2FJ7B 1BH8B 5B33B 5B1LB 1P3PD 1M18C 1U35A 1HQ3B 5GT0A 3AZJC 3NQUA 2F8NB 3W97C 3WKJA 2HIOB 5GSUC 3LJAA 3AZLD 5DNMB 4J8WA 4WV4B 5DNND 1P3FB 2PYOA 2NZDA 3AFAB 3X1SA 3B6GA 5B2IC 3LZ0A 4QLCB 1M1AB 4H9RB 3VH6A 5AV8D 4J8VB 3REKB 1KX3D 5G49B 4DRBA 5AVCB 5B32B 3MNNB 5B24C 3REIC 3VH6T 1P3AA 3UTAD 3MGRD 1P34A 4J8UA 3WA9A 3MGQA 3AZGD 3AZNA 1P3PC 1P3MA 5AV9D 3B0DB 5CPIA 4H9OA 5CPKD 3AZFD 3AZLC 2NQBD 4LD9A 1M18B 1WWSA 5DNNC 3AZJB 3W97B 3LELD 4HGAC 1P3KD 5GSUB 3C1BB 3KWQD 4WU8D 5E5AB 3AZEA 5B40A 5AV8C 4Z5TD 3KXBA 1KX3C 1JFIB 5GT0D 5B2IB 3WKJD 4EO5C 5B1MA 3UTAC 3MGRC 3VH5A 3AZGC 1ID3A 2PYOD 5AVBB 2AROB 5AV9C 2NZDD 3WTPB 2YFVA 5BNVB 3X1SD 3REIB 4UUZB 1KX5A 3B6GD 5CPKC 3AZFC 3LZ0D 4Z66A 2NQBC 2JSSA 4E45A 4JJNB 5B31D 3LELC 3C1CD 1P3KC 3KWQC 4WU8C 3REJD 4J8UD 5AY8B 4Z5TC 3X1VA 1KX4B 5GT0C 3W96B 4H9PA 5JRGA 5CPID 3WKJC 1EQZA 5CPJA 4CAYB 4LD9D 5B0ZA 1P3OB 1KX3B 5B31G 2PYOC 5BO0A 3UTBD 2NZDC 3X1SC 3B6GC 3R45B 4KUDD 3LZ0C 5B40D 3AYWD 3REHA 4YS3A 3AV2B 3KXBD 2BYKB 1Q9CA 2IO5C 3MGPA 3C1CC 1P3PA 3X1UB 4WU9A 3NQJB 4J8UC 3WA9C 1N1JA 3MGQC 3AZNC 1P3MC 1ID3D 1KX5D 5CPIC 5DNNA 1P3BD 5F99D 3A6NA 3AV1A 3B0CW 4LD9C 3X1TA 1U35B 1R4VA 3UTBC 3NQUB 2YFWA 1P3LB 1P3IB 2HUEC 3LJAB 4KUDC 4YM6A 4J8WB 5B40C 3AYWC 5FUGB 1BFMA 3X1VD 3UTAA 3X1SB 3KXBC 1BH9A 2F8NK 5JRGD 3AZGA 1B67A 3WAAD 3LZ0B 3AZKA 1EQZD 5BT1D 5CPJD 5CPKA 3B0BA 2RVQD 3AZFA 5B0ZD 5B2JA 1M19A 1ID3C 3O62B 3UT9B 2NQBA 1KX5C 1A7WA 1P3AB 1P3BC 1P34B 5F99C 3LELA 3KUYD 4J8UB 4Z66C 3MGQB 1P3KA 3WA9B 3AZNB 5AV5A 1P3MB 4YS3D 4WU8A 5GXQA 3TU4B 3AZHD 3MGPD 5CPIB 4Z5TA 4J8XA 4XZQA 4WU9D 4XUJB 3B6FA 3X1VC 5JA4A 2CV5A 5JRGC 3W99A 3WAAC 3AZEB 5BT1C 5CPJC 5BS7A 3A6ND 1EQZC 3AV1D 4H9NA 2RVQC 5B0ZC 3X1TD 4R8PB 3AZIA 1S32D 4KHAA 5B31A 5B1MB 4YM6D 3C1CA 3KUYC 4G91C 5BNXB 3REHC 1ID3B 4YS3C 5AV6D 4AWLC 1H3OA 2YFVB 3REJA 3AZHC 3MGPC 5GT3D 4ZUXA 3AZKD 4Z66B 4WNNA 4WU9C 3VH6W 5B2JD 1M19D 2F8NH 3UTBA 3A6NC 3MGSD 3AV1C 3V9RA 4KGCD 5AV5D 3X1TC 4KUDA 5GXQD 4H9PB 5JRGB 3AYWA 1S32C 3AN2A 4J8XD 4XZQD 4YM6C 1ZLAA 5B0ZB 5BO0B 5AV6C 3B6FD 1BH8A 2CV5D 3W99D 1F66D 3AZKC 5B24B 3REHB 4NE3A 1P3BA 3VH5T 5F99A 5B2JC 1M19C 3MGPB 5CP6A 1P3PB 4H9QA 3AZID 4NE6A 1P3FA 1N1JB 3VH5W 3MGSC 4KGCC 1TAFA 5AV5C 3AZLB 5GXQC 5DNNB 4ZUXD 4J8XC 4HGAB 4XZQC 3X1TB 5B32A 3WAAA 3B6FC 5AV8B 1AOIA 2YFWB 2CV5C 3W99C 1F66C 5B0YA 4X23D 4Z2MH 4EO5B 5BS7C 3W98A 3UTAB 3MGRB 3KUYA 3AZGB 3AZIC 5AV9B 3AN2D 5B31C 3AZHA 1ZLAD 5CPKB 5KDMB 3AZFB 3WTPE 5B2JB 1M19B 2NQBB 5E5AA 3REJC 5B33D 2LY8A 4ZUXC 5B1LD 3LELB 1P3KB 3KWQB 4WU8B 4G92C 5GXQB 2F8ND 2CWEA 3LZ1A 4Z5TB 5CP6D 1F1EA 5DNMD 4J8XB 5GT0B 1P3FD 2AROA 3WKJB 1S32A 3WTPA 3B6FB 3RELA 1P3GA 4CSRA 5JA4B 2CV5B 1M1AD 4QLCD 3W99B 2PYOB 5AV6A 2NZDB 3AN2C 4JJNA 4J8VD 3REKD 3B6GB 1ZLAC 4E44A 5GT3A 5B32D 2F8NG 3MNND 1AOID 4KHAB 1ULYA 5B31B 5B33C 3KSYA 2IO5B 5B1LC 5B0YD 3C1CB 3W96A 3W98D 1H3OB 3REJB 3AZMA 3MGSA 5CP6C 4KGCA 1TZYA 5DNMC 1P3OA 4WNNB 1P3FC 4H9OB 5B32G 2L5AA 3MVDA 3C1BD 4LD9B 1M1AC 4QLCC 5E5AD 3UTBB 4J8VC 3REKC 3AV2A 2BYKA 2HUEB 3V9RB 4KUDB 5B32C 1F66A 3MNNC 5B40B 3AYWB 3LZ1D
chains in the Genus database with same CATH superfamily
3AN2B 3NQJA 3KXBB 1ZLAB 5B0YC 5AVBD 2AROD 4H9SC 3WTPD 3B0DC 3W98C 3RELD 1WWIA 1P3GD 2Y2QA 2DF4C 4JJND 1KX5B 2Y2HA 1P3BB 1P3LA 5F99B 1P3IA 5CP6B 3C1BC 4H9QB 4Z2MG 5E5AC 5CHLB 4DQYB 5FUGA 5AY8D 1KX4D 1TAFB 3W96D 4X23A 3AZMD 3LZ1C 1TZYD 4UPKA 3X1VB 1P3OD 5AVBC 2AROC 3O62A 3UT9A 3WAAB 3WTPC 3EPJA 1EQZB 5CPJB 3RELC 1P3GC 3MVDD 1AOIB 2F2AC 2BYMA 5B0YB 1B6WA 4JJNC 1AOIC 3AV2D 2FJ7A 3TU4A 3W98B 5B33A 5GT3C 5B1LA 3KUYB 4G91B 3X1UD 1HQ3A 4XUJA 1HTAA 4YS3B 4AWLB 2F8NA 2HIOA 5AY8C 3AZHB 1KX4C 3W96C 5DNMA 4WU9B 3AFAA 3AZMC 1TZYC 2BG1A 1P3OC 4R8PA 1U35D 1M1AA 2UWXA 4QLCA 4H9RA 4ZBJC 1P3LD 4J8VA 3REKA 3A6NB 3LZ1B 3MVDC 3LJAD 5G49A 3AV1B 1P3ID 5AVCA 5BNXA 4J8WD 3MNNA 4NE5A 3AV2C 1S32B 2Y2KA 3RELB 1P3GB 4YM6B 4CSRB 3X1UC 2W8SA 4H9SA 5AV6B 1BH9B 5GT3B 2DQNC 3O62D 3UT9D 3AZKB 1M18A 3AZJA 1P3AD 3W97A 1P34D 3WA9D 3MGQD 5GSUA 3AZND 3C1BA 1U35C 1P3MD 2FJ7D 3TU4D 1P3LC 3FDDA 3AZMB 3LJAC 3MGSB 1P3IC 1JFIA 1HQ3D 1TZYB 4KGCB 4XUJD 5B2IA 2Y2LA 5AV5B 4J8WC 2HIOD 4ZBJB 3MVDB 4XZQB 4X23C 5AVBA 4DRAA 3AFAD 5BNVA 5B24A 3REIA 3AZED 4UUZA 4R8PD 3EG5B 4NFTA 3O62C 3UT9C 1F66B 1P3AC 4H9NB 5B1MD 1P34C 5AVCD 3B0CT 3AZLA 5C3IC 3AZIB 2FJ7C 3TU4C 5AY8A 1KX4A 1HQ3C 4Z66D 4XUJC 2HIOC 5AV8A 4ZUXB 4CAYA 4WJ3C 1M18D 1KX3A 3AZJD 3AFAC 3W97D 4G92B 3AZEC 2FFFB 2RIQA 4M6BA 5GSUD 3R45A 4R8PC 3MGRA 3P5JB 4X23B 5AV9A 5B1MC 5B2ID 5KDMA 5AVCC 3X1UA 4WZSB 2BYMB 3H0RC 2ZM5A 5B24D 1KU5A 3REID 3REHD 5C3IB 3KWQA 2FJ7B 1BH8B 5B33B 5B1LB 1P3PD 1M18C 1U35A 1HQ3B 5GT0A 3AZJC 3NQUA 2F8NB 3W97C 3WKJA 2J8PA 2HIOB 5GSUC 3LJAA 2ZY2A 3AZLD 2ZY4A 5DNMB 4J8WA 4WV4B 5DNND 1P3FB 2PYOA 2NZDA 3AFAB 3X1SA 3B6GA 5B2IC 3LZ0A 4QLCB 1M1AB 4H9RB 3VH6A 2G5HC 5AV8D 4J8VB 3REKB 1KX3D 5G49B 4DRBA 5AVCB 5B32B 3MNNB 5B24C 3REIC 3VH6T 1P3AA 3UTAD 2Y2PA 3MGRD 1P34A 4J8UA 3WA9A 3MGQA 3AZGD 3AZNA 1P3PC 1P3MA 5AV9D 3B0DB 5CPIA 4H9OA 5CPKD 3AZFD 3AZLC 2NQBD 4LD9A 1M18B 1WWSA 2JE5A 5DNNC 3AZJB 3W97B 3LELD 4HGAC 1P3KD 5GSUB 3C1BB 3KWQD 4WU8D 5E5AB 3AZEA 5B40A 5AV8C 4Z5TD 3KXBA 1KX3C 1JFIB 5GT0D 5B2IB 3WKJD 2JCHA 4EO5C 5B1MA 3UTAC 2XD5A 3MGRC 3VH5A 3AZGC 1ID3A 2PYOD 5AVBB 2AROB 5AV9C 2NZDD 3WTPB 2YFVA 5BNVB 3X1SD 3REIB 4UUZB 1KX5A 3B6GD 5CPKC 2Y2OA 3AZFC 3LZ0D 4Z66A 2NQBC 2JSSA 4E45A 4JJNB 5B31D 3LELC 3C1CD 1P3KC 1PZRA 3KWQC 4WU8C 3REJD 4J8UD 5AY8B 4Z5TC 3X1VA 1KX4B 5GT0C 3W96B 4H9PA 5JRGA 5CPID 3WKJC 1EQZA 5CPJA 4CAYB 4LD9D 3IP4C 5B0ZA 1P3OB 1KX3B 5B31G 2PYOC 5BO0A 3UTBD 2NZDC 3EPLA 3X1SC 3B6GC 2VQRA 3R45B 2Y2JA 4KUDD 3LZ0C 3H0LC 5B40D 3AYWD 3REHA 4YS3A 3AV2B 3KXBD 2BYKB 1Q9CA 2IO5C 3MGPA 3C1CC 1P3PA 2G5IC 3X1UB 4WU9A 3NQJB 4J8UC 3WA9C 1N1JA 3MGQC 3AZNC 1P3MC 3F6TA 1ID3D 1KX5D 5CPIC 1W2EA 5DNNA 3EPKA 1P3BD 5F99D 3A6NA 2XD1A 3AV1A 3B0CW 4LD9C 3X1TA 1U35B 1R4VA 3UTBC 3NQUB 2YFWA 1P3LB 1P3IB 2HUEC 3LJAB 4KUDC 4YM6A 4J8WB 5B40C 3AYWC 5FUGB 1BFMA 3X1VD 3UTAA 3X1SB 3KXBC 1BH9A 2F8NK 5JRGD 3AZGA 1B67A 3WAAD 3LZ0B 3AZKA 2ZY3A 1EQZD 5BT1D 5CPJD 5CPKA 2RVQD 3B0BA 3AZFA 2Y2GA 5B0ZD 5B2JA 1M19A 1ID3C 3O62B 3UT9B 2NQBA 1KX5C 1A7WA 2ZY5A 1P3AB 1P3BC 1Z2CB 1P34B 5F99C 3LELA 3KUYD 4J8UB 4Z66C 3MGQB 1P3KA 3WA9B 3AZNB 5AV5A 1P3MB 4YS3D 4WU8A 5GXQA 3TU4B 3AZHD 3MGPD 5CPIB 4Z5TA 4J8XA 4XZQA 4WU9D 4XUJB 3B6FA 3X1VC 5JA4A 2CV5A 5JRGC 3W99A 3WAAC 3AZEB 5BT1C 5CPJC 5BS7A 3A6ND 1EQZC 3AV1D 4H9NA 2RVQC 5B0ZC 3X1TD 4R8PB 3AL0C 3AZIA 1S32D 4KHAA 5B31A 5B1MB 4YM6D 3C1CA 3KUYC 4G91C 5BNXB 3REHC 1ID3B 4YS3C 5AV6D 4AWLC 1H3OA 2YFVB 3REJA 3AZHC 3MGPC 5GT3D 4ZUXA 3AZKD 4Z66B 4WNNA 4WU9C 3VH6W 5B2JD 1M19D 2F8NH 3UTBA 3A6NC 3MGSD 3AV1C 3V9RA 4KGCD 5AV5D 3X1TC 4KUDA 5GXQD 4H9PB 5JRGB 3AYWA 1S32C 3AN2A 4J8XD 4XZQD 3H0MC 4YM6C 1ZLAA 5B0ZB 5BO0B 5AV6C 3B6FD 1BH8A 2CV5D 3W99D 3EPHA 1F66D 3AZKC 5B24B 3REHB 4NE3A 1P3BA 3VH5T 5F99A 5B2JC 1M19C 3MGPB 5CP6A 1P3PB 4H9QA 3AZID 4NE6A 1P3FA 3A1KA 1N1JB 3VH5W 3MGSC 4KGCC 1TAFA 5AV5C 3AZLB 1T3UA 5GXQC 5DNNB 4ZUXD 4J8XC 4HGAB 4XZQC 3X1TB 5B32A 3WAAA 3B6FC 5AV8B 1AOIA 2YFWB 2CV5C 3W99C 1F66C 5B0YA 4X23D 4Z2MH 4EO5B 5BS7C 3KFUG 3W98A 3UTAB 3MGRB 3KUYA 3AZGB 3AZIC 5AV9B 3AN2D 5B31C 3AZHA 1ZLAD 5CPKB 5KDMB 3AZFB 3WTPE 5B2JB 1M19B 2NQBB 5E5AA 3REJC 5B33D 2LY8A 4ZUXC 5B1LD 3LELB 1P3KB 3KWQB 4WU8B 4G92C 5GXQB 2F8ND 2CWEA 3LZ1A 4Z5TB 5CP6D 1F1EA 5DNMD 4J8XB 5GT0B 1P3FD 2AROA 3WKJB 1S32A 3WTPA 3B6FB 3RELA 1P3GA 4CSRA 5JA4B 2CV5B 1M1AD 4QLCD 3W99B 2PYOB 5AV6A 2NZDB 2Y2MA 4JJNA 3AN2C 4J8VD 3REKD 3B6GB 1ZLAC 4E44A 5GT3A 2Y2IA 5B32D 2F8NG 3MNND 1AOID 4KHAB 1ULYA 5B31B 5B33C 3KSYA 2IO5B 5B1LC 5B0YD 3C1CB 3W96A 2Y2NA 3W98D 1H3OB 3REJB 3AZMA 3MGSA 5CP6C 4KGCA 1TZYA 5DNMC 1P3OA 4WNNB 1P3FC 4H9OB 5B32G 2L5AA 3MVDA 3C1BD 4LD9B 1M1AC 4QLCC 5E5AD 3A1IA 3UTBB 4J8VC 3REKC 3AV2A 2BYKA 2HUEB 3V9RB 4KUDB 5B32C 1F66A 3MNNC 5B40B 3AYWB 3LZ1D
chains in the Genus database with same CATH topology
3AN2B 3NQJA 3KXBB 1ZLAB 5B0YC 5AVBD 2AROD 4H9SC 3WTPD 3B0DC 3W98C 3RELD 1WWIA 1P3GD 2Y2QA 2DF4C 4JJND 1KX5B 2Y2HA 1P3BB 1P3LA 5F99B 1P3IA 5CP6B 3C1BC 4H9QB 4Z2MG 5E5AC 5CHLB 4DQYB 5FUGA 5AY8D 1KX4D 1TAFB 3W96D 4X23A 3AZMD 3LZ1C 1TZYD 4UPKA 3X1VB 1P3OD 5AVBC 2AROC 3O62A 3UT9A 3WAAB 3WTPC 3EPJA 1EQZB 5CPJB 3RELC 1P3GC 3MVDD 1AOIB 2F2AC 2BYMA 5B0YB 1B6WA 4JJNC 1AOIC 3AV2D 2FJ7A 3TU4A 3W98B 5B33A 5GT3C 5B1LA 3KUYB 4G91B 3X1UD 1HQ3A 4XUJA 1HTAA 4YS3B 4AWLB 2F8NA 2HIOA 5AY8C 3AZHB 1KX4C 3W96C 5DNMA 4WU9B 3AFAA 3AZMC 1TZYC 2BG1A 1P3OC 4R8PA 1U35D 1M1AA 2UWXA 4QLCA 4H9RA 4ZBJC 1P3LD 4J8VA 3REKA 3A6NB 3LZ1B 3MVDC 3LJAD 5G49A 3AV1B 1P3ID 5AVCA 5BNXA 4J8WD 3MNNA 4NE5A 3AV2C 1S32B 2Y2KA 3RELB 1P3GB 4YM6B 4CSRB 3X1UC 2W8SA 4H9SA 5AV6B 1BH9B 5GT3B 2DQNC 3O62D 3UT9D 3AZKB 1M18A 3AZJA 1P3AD 3W97A 1P34D 3WA9D 3MGQD 5GSUA 3AZND 3C1BA 1U35C 1P3MD 2FJ7D 3TU4D 1P3LC 3FDDA 3AZMB 3LJAC 3MGSB 1P3IC 1JFIA 1HQ3D 1TZYB 4KGCB 4XUJD 5B2IA 2Y2LA 5AV5B 4J8WC 2HIOD 4ZBJB 3MVDB 4XZQB 4X23C 5AVBA 4DRAA 3AFAD 5BNVA 5B24A 3REIA 3AZED 4UUZA 4R8PD 3EG5B 4NFTA 3O62C 3UT9C 1F66B 1P3AC 4H9NB 5B1MD 1P34C 5AVCD 3B0CT 3AZLA 5C3IC 3AZIB 2FJ7C 3TU4C 5AY8A 1KX4A 1HQ3C 4Z66D 4XUJC 2HIOC 5AV8A 4ZUXB 4CAYA 4WJ3C 1M18D 1KX3A 3AZJD 3AFAC 3W97D 4G92B 3AZEC 2FFFB 2RIQA 4M6BA 5GSUD 3R45A 4R8PC 3MGRA 3P5JB 4X23B 5AV9A 5B1MC 5B2ID 5KDMA 5AVCC 3X1UA 4WZSB 2BYMB 3H0RC 2ZM5A 5B24D 1KU5A 3REID 3REHD 5C3IB 3KWQA 2FJ7B 1BH8B 5B33B 5B1LB 1P3PD 1M18C 1U35A 1HQ3B 5GT0A 3AZJC 3NQUA 2F8NB 3W97C 3WKJA 2J8PA 2HIOB 5GSUC 3LJAA 2ZY2A 3AZLD 2ZY4A 5DNMB 4J8WA 4WV4B 5DNND 1P3FB 2PYOA 2NZDA 3AFAB 3X1SA 3B6GA 5B2IC 3LZ0A 4QLCB 1M1AB 4H9RB 3VH6A 2G5HC 5AV8D 4J8VB 3REKB 1KX3D 5G49B 4DRBA 5AVCB 5B32B 3MNNB 5B24C 3REIC 3VH6T 1P3AA 3UTAD 2Y2PA 3MGRD 1P34A 4J8UA 3WA9A 3MGQA 3AZGD 3AZNA 1P3PC 1P3MA 5AV9D 3B0DB 5CPIA 4H9OA 5CPKD 3AZFD 3AZLC 2NQBD 4LD9A 1M18B 1WWSA 2JE5A 5DNNC 3AZJB 3W97B 3LELD 4HGAC 1P3KD 5GSUB 3C1BB 3KWQD 4WU8D 5E5AB 3AZEA 5B40A 5AV8C 4Z5TD 3KXBA 1KX3C 1JFIB 5GT0D 5B2IB 3WKJD 2JCHA 4EO5C 5B1MA 3UTAC 2XD5A 3MGRC 3VH5A 3AZGC 1ID3A 2PYOD 5AVBB 2AROB 5AV9C 2NZDD 3WTPB 2YFVA 5BNVB 3X1SD 3REIB 4UUZB 1KX5A 3B6GD 5CPKC 2Y2OA 3AZFC 3LZ0D 4Z66A 2NQBC 2JSSA 4E45A 4JJNB 5B31D 3LELC 3C1CD 1P3KC 1PZRA 3KWQC 4WU8C 3REJD 4J8UD 5AY8B 4Z5TC 3X1VA 1KX4B 5GT0C 3W96B 4H9PA 5JRGA 5CPID 3WKJC 1EQZA 5CPJA 4CAYB 4LD9D 3IP4C 5B0ZA 1P3OB 1KX3B 5B31G 2PYOC 5BO0A 3UTBD 2NZDC 3EPLA 3X1SC 3B6GC 2VQRA 3R45B 2Y2JA 4KUDD 3LZ0C 3H0LC 5B40D 3AYWD 3REHA 4YS3A 3AV2B 3KXBD 2BYKB 1Q9CA 2IO5C 3MGPA 3C1CC 1P3PA 2G5IC 3X1UB 4WU9A 3NQJB 4J8UC 3WA9C 1N1JA 3MGQC 3AZNC 1P3MC 3F6TA 1ID3D 1KX5D 5CPIC 1W2EA 5DNNA 3EPKA 1P3BD 5F99D 3A6NA 2XD1A 3AV1A 3B0CW 4LD9C 3X1TA 1U35B 1R4VA 3UTBC 3NQUB 2YFWA 1P3LB 1P3IB 2HUEC 3LJAB 4KUDC 4YM6A 4J8WB 5B40C 3AYWC 5FUGB 1BFMA 3X1VD 3UTAA 3X1SB 3KXBC 1BH9A 2F8NK 5JRGD 3AZGA 1B67A 3WAAD 3LZ0B 3AZKA 2ZY3A 1EQZD 5BT1D 5CPJD 5CPKA 2RVQD 3B0BA 3AZFA 2Y2GA 5B0ZD 5B2JA 1M19A 1ID3C 3O62B 3UT9B 2NQBA 1KX5C 1A7WA 2ZY5A 1P3AB 1P3BC 1Z2CB 1P34B 5F99C 3LELA 3KUYD 4J8UB 4Z66C 3MGQB 1P3KA 3WA9B 3AZNB 5AV5A 1P3MB 4YS3D 4WU8A 5GXQA 3TU4B 3AZHD 3MGPD 5CPIB 4Z5TA 4J8XA 4XZQA 4WU9D 4XUJB 3B6FA 3X1VC 5JA4A 2CV5A 5JRGC 3W99A 3WAAC 3AZEB 5BT1C 5CPJC 5BS7A 3A6ND 1EQZC 3AV1D 4H9NA 2RVQC 5B0ZC 3X1TD 4R8PB 3AL0C 3AZIA 1S32D 4KHAA 5B31A 5B1MB 4YM6D 3C1CA 3KUYC 4G91C 5BNXB 3REHC 1ID3B 4YS3C 5AV6D 4AWLC 1H3OA 2YFVB 3REJA 3AZHC 3MGPC 5GT3D 4ZUXA 3AZKD 4Z66B 4WNNA 4WU9C 3VH6W 5B2JD 1M19D 2F8NH 3UTBA 3A6NC 3MGSD 3AV1C 3V9RA 4KGCD 5AV5D 3X1TC 4KUDA 5GXQD 4H9PB 5JRGB 3AYWA 1S32C 3AN2A 4J8XD 4XZQD 3H0MC 4YM6C 1ZLAA 5B0ZB 5BO0B 5AV6C 3B6FD 1BH8A 2CV5D 3W99D 3EPHA 1F66D 3AZKC 5B24B 3REHB 4NE3A 1P3BA 3VH5T 5F99A 5B2JC 1M19C 3MGPB 5CP6A 1P3PB 4H9QA 3AZID 4NE6A 1P3FA 3A1KA 1N1JB 3VH5W 3MGSC 4KGCC 1TAFA 5AV5C 3AZLB 1T3UA 5GXQC 5DNNB 4ZUXD 4J8XC 4HGAB 4XZQC 3X1TB 5B32A 3WAAA 3B6FC 5AV8B 1AOIA 2YFWB 2CV5C 3W99C 1F66C 5B0YA 4X23D 4Z2MH 4EO5B 5BS7C 3KFUG 3W98A 3UTAB 3MGRB 3KUYA 3AZGB 3AZIC 5AV9B 3AN2D 5B31C 3AZHA 1ZLAD 5CPKB 5KDMB 3AZFB 3WTPE 5B2JB 1M19B 2NQBB 5E5AA 3REJC 5B33D 2LY8A 4ZUXC 5B1LD 3LELB 1P3KB 3KWQB 4WU8B 4G92C 5GXQB 2F8ND 2CWEA 3LZ1A 4Z5TB 5CP6D 1F1EA 5DNMD 4J8XB 5GT0B 1P3FD 2AROA 3WKJB 1S32A 3WTPA 3B6FB 3RELA 1P3GA 4CSRA 5JA4B 2CV5B 1M1AD 4QLCD 3W99B 2PYOB 5AV6A 2NZDB 2Y2MA 4JJNA 3AN2C 4J8VD 3REKD 3B6GB 1ZLAC 4E44A 5GT3A 2Y2IA 5B32D 2F8NG 3MNND 1AOID 4KHAB 1ULYA 5B31B 5B33C 3KSYA 2IO5B 5B1LC 5B0YD 3C1CB 3W96A 2Y2NA 3W98D 1H3OB 3REJB 3AZMA 3MGSA 5CP6C 4KGCA 1TZYA 5DNMC 1P3OA 4WNNB 1P3FC 4H9OB 5B32G 2L5AA 3MVDA 3C1BD 4LD9B 1M1AC 4QLCC 5E5AD 3A1IA 3UTBB 4J8VC 3REKC 3AV2A 2BYKA 2HUEB 3V9RB 4KUDB 5B32C 1F66A 3MNNC 5B40B 3AYWB 3LZ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 B;  3NQJ A;  3KXB B;  1ZLA B;  5B0Y C;  5AVB D;  2ARO D;  4H9S C;  3WTP D;  3B0D C;  3W98 C;  3REL D;  1WWI A;  1P3G D;  4JJN D;  1KX5 B;  1P3B B;  1P3L A;  5F99 B;  1P3I A;  5CP6 B;  3C1B C;  4H9Q B;  4Z2M G;  5E5A C;  5CHL B;  5FUG A;  5AY8 D;  1KX4 D;  1TAF B;  3W96 D;  4X23 A;  3AZM D;  3LZ1 C;  1TZY D;  3X1V B;  1P3O D;  5AVB C;  2ARO C;  3O62 A;  3UT9 A;  3WAA B;  3WTP C;  1EQZ B;  5CPJ B;  3REL C;  1P3G C;  3MVD D;  1AOI B;  2BYM A;  5B0Y B;  1B6W A;  4JJN C;  1AOI C;  3AV2 D;  2FJ7 A;  3TU4 A;  3W98 B;  5B33 A;  5GT3 C;  5B1L A;  3KUY B;  4G91 B;  3X1U D;  1HQ3 A;  4XUJ A;  1HTA A;  4YS3 B;  4AWL B;  2F8N A;  2HIO A;  5AY8 C;  3AZH B;  1KX4 C;  3W96 C;  5DNM A;  4WU9 B;  3AFA A;  3AZM C;  1TZY C;  1P3O C;  4R8P A;  1U35 D;  1M1A A;  4QLC A;  4H9R A;  4ZBJ C;  1P3L D;  4J8V A;  3REK A;  3A6N B;  3LZ1 B;  3MVD C;  3LJA D;  5G49 A;  3AV1 B;  1P3I D;  5AVC A;  5BNX A;  4J8W D;  3MNN A;  4NE5 A;  3AV2 C;  1S32 B;  3REL B;  1P3G B;  4YM6 B;  4CSR B;  3X1U C;  4H9S A;  5AV6 B;  1BH9 B;  5GT3 B;  3O62 D;  3UT9 D;  3AZK B;  1M18 A;  3AZJ A;  1P3A D;  3W97 A;  1P34 D;  3WA9 D;  3MGQ D;  5GSU A;  3AZN D;  3C1B A;  1U35 C;  1P3M D;  2FJ7 D;  3TU4 D;  1P3L C;  3AZM B;  3LJA C;  3MGS B;  1P3I C;  1JFI A;  1HQ3 D;  1TZY B;  4KGC B;  4XUJ D;  5B2I A;  5AV5 B;  4J8W C;  2HIO D;  4ZBJ B;  3MVD B;  4XZQ B;  4X23 C;  5AVB A;  4DRA A;  3AFA D;  5BNV A;  5B24 A;  3REI A;  3AZE D;  4UUZ A;  4R8P D;  4NFT A;  3O62 C;  3UT9 C;  1F66 B;  1P3A C;  4H9N B;  5B1M D;  1P34 C;  5AVC D;  3B0C T;  3AZL A;  5C3I C;  3AZI B;  2FJ7 C;  3TU4 C;  5AY8 A;  1KX4 A;  1HQ3 C;  4Z66 D;  4XUJ C;  2HIO C;  5AV8 A;  4ZUX B;  4CAY A;  1M18 D;  1KX3 A;  3AZJ D;  3AFA C;  3W97 D;  4G92 B;  3AZE C;  4M6B A;  5GSU D;  3R45 A;  4R8P C;  3MGR A;  4X23 B;  5AV9 A;  5B1M C;  5B2I D;  5KDM A;  5AVC C;  3X1U A;  4WZS B;  2BYM B;  5B24 D;  1KU5 A;  3REI D;  3REH D;  5C3I B;  3KWQ A;  2FJ7 B;  1BH8 B;  5B33 B;  5B1L B;  1P3P D;  1M18 C;  1U35 A;  1HQ3 B;  5GT0 A;  3AZJ C;  3NQU A;  2F8N B;  3W97 C;  3WKJ A;  2HIO B;  5GSU C;  3LJA A;  3AZL D;  5DNM B;  4J8W A;  4WV4 B;  5DNN D;  1P3F B;  2PYO A;  2NZD A;  3AFA B;  3X1S A;  3B6G A;  5B2I C;  3LZ0 A;  4QLC B;  1M1A B;  4H9R B;  3VH6 A;  5AV8 D;  4J8V B;  3REK B;  1KX3 D;  5G49 B;  4DRB A;  5AVC B;  5B32 B;  3MNN B;  5B24 C;  3REI C;  3VH6 T;  1P3A A;  3UTA D;  3MGR D;  1P34 A;  4J8U A;  3WA9 A;  3MGQ A;  3AZG D;  3AZN A;  1P3P C;  1P3M A;  5AV9 D;  3B0D B;  5CPI A;  4H9O A;  5CPK D;  3AZF D;  3AZL C;  2NQB D;  4LD9 A;  1M18 B;  1WWS A;  5DNN C;  3AZJ B;  3W97 B;  3LEL D;  4HGA C;  1P3K D;  5GSU B;  3C1B B;  3KWQ D;  4WU8 D;  5E5A B;  3AZE A;  5B40 A;  5AV8 C;  4Z5T D;  3KXB A;  1KX3 C;  1JFI B;  5GT0 D;  5B2I B;  3WKJ D;  4EO5 C;  5B1M A;  3UTA C;  3MGR C;  3VH5 A;  3AZG C;  1ID3 A;  2PYO D;  5AVB B;  2ARO B;  5AV9 C;  2NZD D;  3WTP B;  2YFV A;  5BNV B;  3X1S D;  3REI B;  4UUZ B;  1KX5 A;  3B6G D;  5CPK C;  3AZF C;  3LZ0 D;  4Z66 A;  2NQB C;  2JSS A;  4E45 A;  4JJN B;  5B31 D;  3LEL C;  3C1C D;  1P3K C;  3KWQ C;  4WU8 C;  3REJ D;  4J8U D;  5AY8 B;  4Z5T C;  3X1V A;  1KX4 B;  5GT0 C;  3W96 B;  4H9P A;  5JRG A;  5CPI D;  3WKJ C;  1EQZ A;  5CPJ A;  4CAY B;  4LD9 D;  5B0Z A;  1P3O B;  1KX3 B;  5B31 G;  2PYO C;  5BO0 A;  3UTB D;  2NZD C;  3X1S C;  3B6G C;  3R45 B;  4KUD D;  3LZ0 C;  5B40 D;  3AYW D;  3REH A;  4YS3 A;  3AV2 B;  3KXB D;  2BYK B;  1Q9C A;  2IO5 C;  3MGP A;  3C1C C;  1P3P A;  3X1U B;  4WU9 A;  3NQJ B;  4J8U C;  3WA9 C;  1N1J A;  3MGQ C;  3AZN C;  1P3M C;  1ID3 D;  1KX5 D;  5CPI C;  5DNN A;  1P3B D;  5F99 D;  3A6N A;  3AV1 A;  3B0C W;  4LD9 C;  3X1T A;  1U35 B;  1R4V A;  3UTB C;  3NQU B;  2YFW A;  1P3L B;  1P3I B;  2HUE C;  3LJA B;  4KUD C;  4YM6 A;  4J8W B;  5B40 C;  3AYW C;  5FUG B;  1BFM A;  3X1V D;  3UTA A;  3X1S B;  3KXB C;  1BH9 A;  2F8N K;  5JRG D;  3AZG A;  1B67 A;  3WAA D;  3LZ0 B;  3AZK A;  1EQZ D;  5BT1 D;  5CPJ D;  5CPK A;  3B0B A;  2RVQ D;  3AZF A;  5B0Z D;  5B2J A;  1M19 A;  1ID3 C;  3O62 B;  3UT9 B;  2NQB A;  1KX5 C;  1A7W A;  1P3A B;  1P3B C;  1P34 B;  5F99 C;  3LEL A;  3KUY D;  4J8U B;  4Z66 C;  3MGQ B;  1P3K A;  3WA9 B;  3AZN B;  5AV5 A;  1P3M B;  4YS3 D;  4WU8 A;  5GXQ A;  3TU4 B;  3AZH D;  3MGP D;  5CPI B;  4Z5T A;  4J8X A;  4XZQ A;  4WU9 D;  4XUJ B;  3B6F A;  3X1V C;  5JA4 A;  2CV5 A;  5JRG C;  3W99 A;  3WAA C;  3AZE B;  5BT1 C;  5CPJ C;  5BS7 A;  3A6N D;  1EQZ C;  3AV1 D;  4H9N A;  2RVQ C;  5B0Z C;  3X1T D;  4R8P B;  3AZI A;  1S32 D;  4KHA A;  5B31 A;  5B1M B;  4YM6 D;  3C1C A;  3KUY C;  4G91 C;  5BNX B;  3REH C;  1ID3 B;  4YS3 C;  5AV6 D;  4AWL C;  1H3O A;  2YFV B;  3REJ A;  3AZH C;  3MGP C;  5GT3 D;  4ZUX A;  3AZK D;  4Z66 B;  4WNN A;  4WU9 C;  3VH6 W;  5B2J D;  1M19 D;  2F8N H;  3UTB A;  3A6N C;  3MGS D;  3AV1 C;  3V9R A;  4KGC D;  5AV5 D;  3X1T C;  4KUD A;  5GXQ D;  4H9P B;  5JRG B;  3AYW A;  1S32 C;  3AN2 A;  4J8X D;  4XZQ D;  4YM6 C;  1ZLA A;  5B0Z B;  5BO0 B;  5AV6 C;  3B6F D;  1BH8 A;  2CV5 D;  3W99 D;  1F66 D;  3AZK C;  5B24 B;  3REH B;  4NE3 A;  1P3B A;  3VH5 T;  5F99 A;  5B2J C;  1M19 C;  3MGP B;  5CP6 A;  1P3P B;  4H9Q A;  3AZI D;  4NE6 A;  1P3F A;  1N1J B;  3VH5 W;  3MGS C;  4KGC C;  1TAF A;  5AV5 C;  3AZL B;  5GXQ C;  5DNN B;  4ZUX D;  4J8X C;  4HGA B;  4XZQ C;  3X1T B;  5B32 A;  3WAA A;  3B6F C;  5AV8 B;  1AOI A;  2YFW B;  2CV5 C;  3W99 C;  1F66 C;  5B0Y A;  4X23 D;  4Z2M H;  4EO5 B;  5BS7 C;  3W98 A;  3UTA B;  3MGR B;  3KUY A;  3AZG B;  3AZI C;  5AV9 B;  3AN2 D;  5B31 C;  3AZH A;  1ZLA D;  5CPK B;  5KDM B;  3AZF B;  3WTP E;  5B2J B;  1M19 B;  2NQB B;  5E5A A;  3REJ C;  5B33 D;  2LY8 A;  4ZUX C;  5B1L D;  3LEL B;  1P3K B;  3KWQ B;  4WU8 B;  4G92 C;  5GXQ B;  2F8N D;  2CWE A;  3LZ1 A;  4Z5T B;  5CP6 D;  1F1E A;  5DNM D;  4J8X B;  5GT0 B;  1P3F D;  2ARO A;  3WKJ B;  1S32 A;  3WTP A;  3B6F B;  3REL A;  1P3G A;  4CSR A;  5JA4 B;  2CV5 B;  1M1A D;  4QLC D;  3W99 B;  2PYO B;  5AV6 A;  2NZD B;  3AN2 C;  4JJN A;  4J8V D;  3REK D;  3B6G B;  1ZLA C;  4E44 A;  5GT3 A;  5B32 D;  2F8N G;  3MNN D;  1AOI D;  4KHA B;  1ULY A;  5B31 B;  5B33 C;  3KSY A;  2IO5 B;  5B1L C;  5B0Y D;  3C1C B;  3W96 A;  3W98 D;  1H3O B;  3REJ B;  3AZM A;  3MGS A;  5CP6 C;  4KGC A;  1TZY A;  5DNM C;  1P3O A;  4WNN B;  1P3F C;  4H9O B;  5B32 G;  2L5A A;  3MVD A;  3C1B D;  4LD9 B;  1M1A C;  4QLC C;  5E5A D;  3UTB B;  4J8V C;  3REK C;  3AV2 A;  2BYK A;  2HUE B;  3V9R B;  4KUD B;  5B32 C;  1F66 A;  3MNN C;  5B40 B;  3AYW B;  3LZ1 D; 
#chains in the Genus database with same CATH topology
 3AN2 B;  3NQJ A;  3KXB B;  1ZLA B;  5B0Y C;  5AVB D;  2ARO D;  4H9S C;  3WTP D;  3B0D C;  3W98 C;  3REL D;  1WWI A;  1P3G D;  2Y2Q A;  2DF4 C;  4JJN D;  1KX5 B;  2Y2H A;  1P3B B;  1P3L A;  5F99 B;  1P3I A;  5CP6 B;  3C1B C;  4H9Q B;  4Z2M G;  5E5A C;  5CHL B;  4DQY B;  5FUG A;  5AY8 D;  1KX4 D;  1TAF B;  3W96 D;  4X23 A;  3AZM D;  3LZ1 C;  1TZY D;  4UPK A;  3X1V B;  1P3O D;  5AVB C;  2ARO C;  3O62 A;  3UT9 A;  3WAA B;  3WTP C;  3EPJ A;  1EQZ B;  5CPJ B;  3REL C;  1P3G C;  3MVD D;  1AOI B;  2F2A C;  2BYM A;  5B0Y B;  1B6W A;  4JJN C;  1AOI C;  3AV2 D;  2FJ7 A;  3TU4 A;  3W98 B;  5B33 A;  5GT3 C;  5B1L A;  3KUY B;  4G91 B;  3X1U D;  1HQ3 A;  4XUJ A;  1HTA A;  4YS3 B;  4AWL B;  2F8N A;  2HIO A;  5AY8 C;  3AZH B;  1KX4 C;  3W96 C;  5DNM A;  4WU9 B;  3AFA A;  3AZM C;  1TZY C;  2BG1 A;  1P3O C;  4R8P A;  1U35 D;  1M1A A;  2UWX A;  4QLC A;  4H9R A;  4ZBJ C;  1P3L D;  4J8V A;  3REK A;  3A6N B;  3LZ1 B;  3MVD C;  3LJA D;  5G49 A;  3AV1 B;  1P3I D;  5AVC A;  5BNX A;  4J8W D;  3MNN A;  4NE5 A;  3AV2 C;  1S32 B;  2Y2K A;  3REL B;  1P3G B;  4YM6 B;  4CSR B;  3X1U C;  2W8S A;  4H9S A;  5AV6 B;  1BH9 B;  5GT3 B;  2DQN C;  3O62 D;  3UT9 D;  3AZK B;  1M18 A;  3AZJ A;  1P3A D;  3W97 A;  1P34 D;  3WA9 D;  3MGQ D;  5GSU A;  3AZN D;  3C1B A;  1U35 C;  1P3M D;  2FJ7 D;  3TU4 D;  1P3L C;  3FDD A;  3AZM B;  3LJA C;  3MGS B;  1P3I C;  1JFI A;  1HQ3 D;  1TZY B;  4KGC B;  4XUJ D;  5B2I A;  2Y2L A;  5AV5 B;  4J8W C;  2HIO D;  4ZBJ B;  3MVD B;  4XZQ B;  4X23 C;  5AVB A;  4DRA A;  3AFA D;  5BNV A;  5B24 A;  3REI A;  3AZE D;  4UUZ A;  4R8P D;  3EG5 B;  4NFT A;  3O62 C;  3UT9 C;  1F66 B;  1P3A C;  4H9N B;  5B1M D;  1P34 C;  5AVC D;  3B0C T;  3AZL A;  5C3I C;  3AZI B;  2FJ7 C;  3TU4 C;  5AY8 A;  1KX4 A;  1HQ3 C;  4Z66 D;  4XUJ C;  2HIO C;  5AV8 A;  4ZUX B;  4CAY A;  4WJ3 C;  1M18 D;  1KX3 A;  3AZJ D;  3AFA C;  3W97 D;  4G92 B;  3AZE C;  2FFF B;  2RIQ A;  4M6B A;  5GSU D;  3R45 A;  4R8P C;  3MGR A;  3P5J B;  4X23 B;  5AV9 A;  5B1M C;  5B2I D;  5KDM A;  5AVC C;  3X1U A;  4WZS B;  2BYM B;  3H0R C;  2ZM5 A;  5B24 D;  1KU5 A;  3REI D;  3REH D;  5C3I B;  3KWQ A;  2FJ7 B;  1BH8 B;  5B33 B;  5B1L B;  1P3P D;  1M18 C;  1U35 A;  1HQ3 B;  5GT0 A;  3AZJ C;  3NQU A;  2F8N B;  3W97 C;  3WKJ A;  2J8P A;  2HIO B;  5GSU C;  3LJA A;  2ZY2 A;  3AZL D;  2ZY4 A;  5DNM B;  4J8W A;  4WV4 B;  5DNN D;  1P3F B;  2PYO A;  2NZD A;  3AFA B;  3X1S A;  3B6G A;  5B2I C;  3LZ0 A;  4QLC B;  1M1A B;  4H9R B;  3VH6 A;  2G5H C;  5AV8 D;  4J8V B;  3REK B;  1KX3 D;  5G49 B;  4DRB A;  5AVC B;  5B32 B;  3MNN B;  5B24 C;  3REI C;  3VH6 T;  1P3A A;  3UTA D;  2Y2P A;  3MGR D;  1P34 A;  4J8U A;  3WA9 A;  3MGQ A;  3AZG D;  3AZN A;  1P3P C;  1P3M A;  5AV9 D;  3B0D B;  5CPI A;  4H9O A;  5CPK D;  3AZF D;  3AZL C;  2NQB D;  4LD9 A;  1M18 B;  1WWS A;  2JE5 A;  5DNN C;  3AZJ B;  3W97 B;  3LEL D;  4HGA C;  1P3K D;  5GSU B;  3C1B B;  3KWQ D;  4WU8 D;  5E5A B;  3AZE A;  5B40 A;  5AV8 C;  4Z5T D;  3KXB A;  1KX3 C;  1JFI B;  5GT0 D;  5B2I B;  3WKJ D;  2JCH A;  4EO5 C;  5B1M A;  3UTA C;  2XD5 A;  3MGR C;  3VH5 A;  3AZG C;  1ID3 A;  2PYO D;  5AVB B;  2ARO B;  5AV9 C;  2NZD D;  3WTP B;  2YFV A;  5BNV B;  3X1S D;  3REI B;  4UUZ B;  1KX5 A;  3B6G D;  5CPK C;  2Y2O A;  3AZF C;  3LZ0 D;  4Z66 A;  2NQB C;  2JSS A;  4E45 A;  4JJN B;  5B31 D;  3LEL C;  3C1C D;  1P3K C;  1PZR A;  3KWQ C;  4WU8 C;  3REJ D;  4J8U D;  5AY8 B;  4Z5T C;  3X1V A;  1KX4 B;  5GT0 C;  3W96 B;  4H9P A;  5JRG A;  5CPI D;  3WKJ C;  1EQZ A;  5CPJ A;  4CAY B;  4LD9 D;  3IP4 C;  5B0Z A;  1P3O B;  1KX3 B;  5B31 G;  2PYO C;  5BO0 A;  3UTB D;  2NZD C;  3EPL A;  3X1S C;  3B6G C;  2VQR A;  3R45 B;  2Y2J A;  4KUD D;  3LZ0 C;  3H0L C;  5B40 D;  3AYW D;  3REH A;  4YS3 A;  3AV2 B;  3KXB D;  2BYK B;  1Q9C A;  2IO5 C;  3MGP A;  3C1C C;  1P3P A;  2G5I C;  3X1U B;  4WU9 A;  3NQJ B;  4J8U C;  3WA9 C;  1N1J A;  3MGQ C;  3AZN C;  1P3M C;  3F6T A;  1ID3 D;  1KX5 D;  5CPI C;  1W2E A;  5DNN A;  3EPK A;  1P3B D;  5F99 D;  3A6N A;  2XD1 A;  3AV1 A;  3B0C W;  4LD9 C;  3X1T A;  1U35 B;  1R4V A;  3UTB C;  3NQU B;  2YFW A;  1P3L B;  1P3I B;  2HUE C;  3LJA B;  4KUD C;  4YM6 A;  4J8W B;  5B40 C;  3AYW C;  5FUG B;  1BFM A;  3X1V D;  3UTA A;  3X1S B;  3KXB C;  1BH9 A;  2F8N K;  5JRG D;  3AZG A;  1B67 A;  3WAA D;  3LZ0 B;  3AZK A;  2ZY3 A;  1EQZ D;  5BT1 D;  5CPJ D;  5CPK A;  2RVQ D;  3B0B A;  3AZF A;  2Y2G A;  5B0Z D;  5B2J A;  1M19 A;  1ID3 C;  3O62 B;  3UT9 B;  2NQB A;  1KX5 C;  1A7W A;  2ZY5 A;  1P3A B;  1P3B C;  1Z2C B;  1P34 B;  5F99 C;  3LEL A;  3KUY D;  4J8U B;  4Z66 C;  3MGQ B;  1P3K A;  3WA9 B;  3AZN B;  5AV5 A;  1P3M B;  4YS3 D;  4WU8 A;  5GXQ A;  3TU4 B;  3AZH D;  3MGP D;  5CPI B;  4Z5T A;  4J8X A;  4XZQ A;  4WU9 D;  4XUJ B;  3B6F A;  3X1V C;  5JA4 A;  2CV5 A;  5JRG C;  3W99 A;  3WAA C;  3AZE B;  5BT1 C;  5CPJ C;  5BS7 A;  3A6N D;  1EQZ C;  3AV1 D;  4H9N A;  2RVQ C;  5B0Z C;  3X1T D;  4R8P B;  3AL0 C;  3AZI A;  1S32 D;  4KHA A;  5B31 A;  5B1M B;  4YM6 D;  3C1C A;  3KUY C;  4G91 C;  5BNX B;  3REH C;  1ID3 B;  4YS3 C;  5AV6 D;  4AWL C;  1H3O A;  2YFV B;  3REJ A;  3AZH C;  3MGP C;  5GT3 D;  4ZUX A;  3AZK D;  4Z66 B;  4WNN A;  4WU9 C;  3VH6 W;  5B2J D;  1M19 D;  2F8N H;  3UTB A;  3A6N C;  3MGS D;  3AV1 C;  3V9R A;  4KGC D;  5AV5 D;  3X1T C;  4KUD A;  5GXQ D;  4H9P B;  5JRG B;  3AYW A;  1S32 C;  3AN2 A;  4J8X D;  4XZQ D;  3H0M C;  4YM6 C;  1ZLA A;  5B0Z B;  5BO0 B;  5AV6 C;  3B6F D;  1BH8 A;  2CV5 D;  3W99 D;  3EPH A;  1F66 D;  3AZK C;  5B24 B;  3REH B;  4NE3 A;  1P3B A;  3VH5 T;  5F99 A;  5B2J C;  1M19 C;  3MGP B;  5CP6 A;  1P3P B;  4H9Q A;  3AZI D;  4NE6 A;  1P3F A;  3A1K A;  1N1J B;  3VH5 W;  3MGS C;  4KGC C;  1TAF A;  5AV5 C;  3AZL B;  1T3U A;  5GXQ C;  5DNN B;  4ZUX D;  4J8X C;  4HGA B;  4XZQ C;  3X1T B;  5B32 A;  3WAA A;  3B6F C;  5AV8 B;  1AOI A;  2YFW B;  2CV5 C;  3W99 C;  1F66 C;  5B0Y A;  4X23 D;  4Z2M H;  4EO5 B;  5BS7 C;  3KFU G;  3W98 A;  3UTA B;  3MGR B;  3KUY A;  3AZG B;  3AZI C;  5AV9 B;  3AN2 D;  5B31 C;  3AZH A;  1ZLA D;  5CPK B;  5KDM B;  3AZF B;  3WTP E;  5B2J B;  1M19 B;  2NQB B;  5E5A A;  3REJ C;  5B33 D;  2LY8 A;  4ZUX C;  5B1L D;  3LEL B;  1P3K B;  3KWQ B;  4WU8 B;  4G92 C;  5GXQ B;  2F8N D;  2CWE A;  3LZ1 A;  4Z5T B;  5CP6 D;  1F1E A;  5DNM D;  4J8X B;  5GT0 B;  1P3F D;  2ARO A;  3WKJ B;  1S32 A;  3WTP A;  3B6F B;  3REL A;  1P3G A;  4CSR A;  5JA4 B;  2CV5 B;  1M1A D;  4QLC D;  3W99 B;  2PYO B;  5AV6 A;  2NZD B;  2Y2M A;  4JJN A;  3AN2 C;  4J8V D;  3REK D;  3B6G B;  1ZLA C;  4E44 A;  5GT3 A;  2Y2I A;  5B32 D;  2F8N G;  3MNN D;  1AOI D;  4KHA B;  1ULY A;  5B31 B;  5B33 C;  3KSY A;  2IO5 B;  5B1L C;  5B0Y D;  3C1C B;  3W96 A;  2Y2N A;  3W98 D;  1H3O B;  3REJ B;  3AZM A;  3MGS A;  5CP6 C;  4KGC A;  1TZY A;  5DNM C;  1P3O A;  4WNN B;  1P3F C;  4H9O B;  5B32 G;  2L5A A;  3MVD A;  3C1B D;  4LD9 B;  1M1A C;  4QLC C;  5E5A D;  3A1I A;  3UTB B;  4J8V C;  3REK C;  3AV2 A;  2BYK A;  2HUE B;  3V9R B;  4KUD B;  5B32 C;  1F66 A;  3MNN C;  5B40 B;  3AYW B;  3LZ1 D; 
#chains in the Genus database with same CATH homology
 3AN2 B;  3NQJ A;  3KXB B;  1ZLA B;  5B0Y C;  5AVB D;  2ARO D;  4H9S C;  3WTP D;  3B0D C;  3W98 C;  3REL D;  1WWI A;  1P3G D;  2Y2Q A;  2DF4 C;  4JJN D;  1KX5 B;  2Y2H A;  1P3B B;  1P3L A;  5F99 B;  1P3I A;  5CP6 B;  3C1B C;  4H9Q B;  4Z2M G;  5E5A C;  5CHL B;  4DQY B;  5FUG A;  5AY8 D;  1KX4 D;  1TAF B;  3W96 D;  4X23 A;  3AZM D;  3LZ1 C;  1TZY D;  4UPK A;  3X1V B;  1P3O D;  5AVB C;  2ARO C;  3O62 A;  3UT9 A;  3WAA B;  3WTP C;  3EPJ A;  1EQZ B;  5CPJ B;  3REL C;  1P3G C;  3MVD D;  1AOI B;  2F2A C;  2BYM A;  5B0Y B;  1B6W A;  4JJN C;  1AOI C;  3AV2 D;  2FJ7 A;  3TU4 A;  3W98 B;  5B33 A;  5GT3 C;  5B1L A;  3KUY B;  4G91 B;  3X1U D;  1HQ3 A;  4XUJ A;  1HTA A;  4YS3 B;  4AWL B;  2F8N A;  2HIO A;  5AY8 C;  3AZH B;  1KX4 C;  3W96 C;  5DNM A;  4WU9 B;  3AFA A;  3AZM C;  1TZY C;  2BG1 A;  1P3O C;  4R8P A;  1U35 D;  1M1A A;  2UWX A;  4QLC A;  4H9R A;  4ZBJ C;  1P3L D;  4J8V A;  3REK A;  3A6N B;  3LZ1 B;  3MVD C;  3LJA D;  5G49 A;  3AV1 B;  1P3I D;  5AVC A;  5BNX A;  4J8W D;  3MNN A;  4NE5 A;  3AV2 C;  1S32 B;  2Y2K A;  3REL B;  1P3G B;  4YM6 B;  4CSR B;  3X1U C;  2W8S A;  4H9S A;  5AV6 B;  1BH9 B;  5GT3 B;  2DQN C;  3O62 D;  3UT9 D;  3AZK B;  1M18 A;  3AZJ A;  1P3A D;  3W97 A;  1P34 D;  3WA9 D;  3MGQ D;  5GSU A;  3AZN D;  3C1B A;  1U35 C;  1P3M D;  2FJ7 D;  3TU4 D;  1P3L C;  3FDD A;  3AZM B;  3LJA C;  3MGS B;  1P3I C;  1JFI A;  1HQ3 D;  1TZY B;  4KGC B;  4XUJ D;  5B2I A;  2Y2L A;  5AV5 B;  4J8W C;  2HIO D;  4ZBJ B;  3MVD B;  4XZQ B;  4X23 C;  5AVB A;  4DRA A;  3AFA D;  5BNV A;  5B24 A;  3REI A;  3AZE D;  4UUZ A;  4R8P D;  3EG5 B;  4NFT A;  3O62 C;  3UT9 C;  1F66 B;  1P3A C;  4H9N B;  5B1M D;  1P34 C;  5AVC D;  3B0C T;  3AZL A;  5C3I C;  3AZI B;  2FJ7 C;  3TU4 C;  5AY8 A;  1KX4 A;  1HQ3 C;  4Z66 D;  4XUJ C;  2HIO C;  5AV8 A;  4ZUX B;  4CAY A;  4WJ3 C;  1M18 D;  1KX3 A;  3AZJ D;  3AFA C;  3W97 D;  4G92 B;  3AZE C;  2FFF B;  2RIQ A;  4M6B A;  5GSU D;  3R45 A;  4R8P C;  3MGR A;  3P5J B;  4X23 B;  5AV9 A;  5B1M C;  5B2I D;  5KDM A;  5AVC C;  3X1U A;  4WZS B;  2BYM B;  3H0R C;  2ZM5 A;  5B24 D;  1KU5 A;  3REI D;  3REH D;  5C3I B;  3KWQ A;  2FJ7 B;  1BH8 B;  5B33 B;  5B1L B;  1P3P D;  1M18 C;  1U35 A;  1HQ3 B;  5GT0 A;  3AZJ C;  3NQU A;  2F8N B;  3W97 C;  3WKJ A;  2J8P A;  2HIO B;  5GSU C;  3LJA A;  2ZY2 A;  3AZL D;  2ZY4 A;  5DNM B;  4J8W A;  4WV4 B;  5DNN D;  1P3F B;  2PYO A;  2NZD A;  3AFA B;  3X1S A;  3B6G A;  5B2I C;  3LZ0 A;  4QLC B;  1M1A B;  4H9R B;  3VH6 A;  2G5H C;  5AV8 D;  4J8V B;  3REK B;  1KX3 D;  5G49 B;  4DRB A;  5AVC B;  5B32 B;  3MNN B;  5B24 C;  3REI C;  3VH6 T;  1P3A A;  3UTA D;  2Y2P A;  3MGR D;  1P34 A;  4J8U A;  3WA9 A;  3MGQ A;  3AZG D;  3AZN A;  1P3P C;  1P3M A;  5AV9 D;  3B0D B;  5CPI A;  4H9O A;  5CPK D;  3AZF D;  3AZL C;  2NQB D;  4LD9 A;  1M18 B;  1WWS A;  2JE5 A;  5DNN C;  3AZJ B;  3W97 B;  3LEL D;  4HGA C;  1P3K D;  5GSU B;  3C1B B;  3KWQ D;  4WU8 D;  5E5A B;  3AZE A;  5B40 A;  5AV8 C;  4Z5T D;  3KXB A;  1KX3 C;  1JFI B;  5GT0 D;  5B2I B;  3WKJ D;  2JCH A;  4EO5 C;  5B1M A;  3UTA C;  2XD5 A;  3MGR C;  3VH5 A;  3AZG C;  1ID3 A;  2PYO D;  5AVB B;  2ARO B;  5AV9 C;  2NZD D;  3WTP B;  2YFV A;  5BNV B;  3X1S D;  3REI B;  4UUZ B;  1KX5 A;  3B6G D;  5CPK C;  2Y2O A;  3AZF C;  3LZ0 D;  4Z66 A;  2NQB C;  2JSS A;  4E45 A;  4JJN B;  5B31 D;  3LEL C;  3C1C D;  1P3K C;  1PZR A;  3KWQ C;  4WU8 C;  3REJ D;  4J8U D;  5AY8 B;  4Z5T C;  3X1V A;  1KX4 B;  5GT0 C;  3W96 B;  4H9P A;  5JRG A;  5CPI D;  3WKJ C;  1EQZ A;  5CPJ A;  4CAY B;  4LD9 D;  3IP4 C;  5B0Z A;  1P3O B;  1KX3 B;  5B31 G;  2PYO C;  5BO0 A;  3UTB D;  2NZD C;  3EPL A;  3X1S C;  3B6G C;  2VQR A;  3R45 B;  2Y2J A;  4KUD D;  3LZ0 C;  3H0L C;  5B40 D;  3AYW D;  3REH A;  4YS3 A;  3AV2 B;  3KXB D;  2BYK B;  1Q9C A;  2IO5 C;  3MGP A;  3C1C C;  1P3P A;  2G5I C;  3X1U B;  4WU9 A;  3NQJ B;  4J8U C;  3WA9 C;  1N1J A;  3MGQ C;  3AZN C;  1P3M C;  3F6T A;  1ID3 D;  1KX5 D;  5CPI C;  1W2E A;  5DNN A;  3EPK A;  1P3B D;  5F99 D;  3A6N A;  2XD1 A;  3AV1 A;  3B0C W;  4LD9 C;  3X1T A;  1U35 B;  1R4V A;  3UTB C;  3NQU B;  2YFW A;  1P3L B;  1P3I B;  2HUE C;  3LJA B;  4KUD C;  4YM6 A;  4J8W B;  5B40 C;  3AYW C;  5FUG B;  1BFM A;  3X1V D;  3UTA A;  3X1S B;  3KXB C;  1BH9 A;  2F8N K;  5JRG D;  3AZG A;  1B67 A;  3WAA D;  3LZ0 B;  3AZK A;  2ZY3 A;  1EQZ D;  5BT1 D;  5CPJ D;  5CPK A;  2RVQ D;  3B0B A;  3AZF A;  2Y2G A;  5B0Z D;  5B2J A;  1M19 A;  1ID3 C;  3O62 B;  3UT9 B;  2NQB A;  1KX5 C;  1A7W A;  2ZY5 A;  1P3A B;  1P3B C;  1Z2C B;  1P34 B;  5F99 C;  3LEL A;  3KUY D;  4J8U B;  4Z66 C;  3MGQ B;  1P3K A;  3WA9 B;  3AZN B;  5AV5 A;  1P3M B;  4YS3 D;  4WU8 A;  5GXQ A;  3TU4 B;  3AZH D;  3MGP D;  5CPI B;  4Z5T A;  4J8X A;  4XZQ A;  4WU9 D;  4XUJ B;  3B6F A;  3X1V C;  5JA4 A;  2CV5 A;  5JRG C;  3W99 A;  3WAA C;  3AZE B;  5BT1 C;  5CPJ C;  5BS7 A;  3A6N D;  1EQZ C;  3AV1 D;  4H9N A;  2RVQ C;  5B0Z C;  3X1T D;  4R8P B;  3AL0 C;  3AZI A;  1S32 D;  4KHA A;  5B31 A;  5B1M B;  4YM6 D;  3C1C A;  3KUY C;  4G91 C;  5BNX B;  3REH C;  1ID3 B;  4YS3 C;  5AV6 D;  4AWL C;  1H3O A;  2YFV B;  3REJ A;  3AZH C;  3MGP C;  5GT3 D;  4ZUX A;  3AZK D;  4Z66 B;  4WNN A;  4WU9 C;  3VH6 W;  5B2J D;  1M19 D;  2F8N H;  3UTB A;  3A6N C;  3MGS D;  3AV1 C;  3V9R A;  4KGC D;  5AV5 D;  3X1T C;  4KUD A;  5GXQ D;  4H9P B;  5JRG B;  3AYW A;  1S32 C;  3AN2 A;  4J8X D;  4XZQ D;  3H0M C;  4YM6 C;  1ZLA A;  5B0Z B;  5BO0 B;  5AV6 C;  3B6F D;  1BH8 A;  2CV5 D;  3W99 D;  3EPH A;  1F66 D;  3AZK C;  5B24 B;  3REH B;  4NE3 A;  1P3B A;  3VH5 T;  5F99 A;  5B2J C;  1M19 C;  3MGP B;  5CP6 A;  1P3P B;  4H9Q A;  3AZI D;  4NE6 A;  1P3F A;  3A1K A;  1N1J B;  3VH5 W;  3MGS C;  4KGC C;  1TAF A;  5AV5 C;  3AZL B;  1T3U A;  5GXQ C;  5DNN B;  4ZUX D;  4J8X C;  4HGA B;  4XZQ C;  3X1T B;  5B32 A;  3WAA A;  3B6F C;  5AV8 B;  1AOI A;  2YFW B;  2CV5 C;  3W99 C;  1F66 C;  5B0Y A;  4X23 D;  4Z2M H;  4EO5 B;  5BS7 C;  3KFU G;  3W98 A;  3UTA B;  3MGR B;  3KUY A;  3AZG B;  3AZI C;  5AV9 B;  3AN2 D;  5B31 C;  3AZH A;  1ZLA D;  5CPK B;  5KDM B;  3AZF B;  3WTP E;  5B2J B;  1M19 B;  2NQB B;  5E5A A;  3REJ C;  5B33 D;  2LY8 A;  4ZUX C;  5B1L D;  3LEL B;  1P3K B;  3KWQ B;  4WU8 B;  4G92 C;  5GXQ B;  2F8N D;  2CWE A;  3LZ1 A;  4Z5T B;  5CP6 D;  1F1E A;  5DNM D;  4J8X B;  5GT0 B;  1P3F D;  2ARO A;  3WKJ B;  1S32 A;  3WTP A;  3B6F B;  3REL A;  1P3G A;  4CSR A;  5JA4 B;  2CV5 B;  1M1A D;  4QLC D;  3W99 B;  2PYO B;  5AV6 A;  2NZD B;  2Y2M A;  4JJN A;  3AN2 C;  4J8V D;  3REK D;  3B6G B;  1ZLA C;  4E44 A;  5GT3 A;  2Y2I A;  5B32 D;  2F8N G;  3MNN D;  1AOI D;  4KHA B;  1ULY A;  5B31 B;  5B33 C;  3KSY A;  2IO5 B;  5B1L C;  5B0Y D;  3C1C B;  3W96 A;  2Y2N A;  3W98 D;  1H3O B;  3REJ B;  3AZM A;  3MGS A;  5CP6 C;  4KGC A;  1TZY A;  5DNM C;  1P3O A;  4WNN B;  1P3F C;  4H9O B;  5B32 G;  2L5A A;  3MVD A;  3C1B D;  4LD9 B;  1M1A C;  4QLC C;  5E5A D;  3A1I A;  3UTB B;  4J8V C;  3REK C;  3AV2 A;  2BYK A;  2HUE B;  3V9R B;  4KUD B;  5B32 C;  1F66 A;  3MNN C;  5B40 B;  3AYW B;  3LZ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...