3AZHB

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhB00
5AV6C 5B1MA 4EO5B 2JSSA 4WNNA 1M19B 3AZED 1P3BC 1TZYD 3AFAA 1ID3D 5E5AB 5B2JD 3AZMB 5BS7A 5B0ZA 4XZQB 3MNNA 5GXQD 3AYWD 5BT1C 2HIOA 2BYKB 5CPJA 2FJ7A 1M1AB 4KGCB 3C1BD 3REHD 5GT3A 5B2IA 5CPKC 1P3LD 1KX4A 5E5AC 4H9PB 4WU9D 5CP6A 3AZIA 3AN2A 1P3FC 5B31C 3AZEB 3AZHA 4KGCC 5B24D 2YFWB 3X1SA 3RELA 1ID3B 3MGQA 2CV5C 5B2JB 3WAAD 4J8VA 1AOIC 2IO5B 5GXQB 3AYWB 3X1VD 4E45A 3LZ0A 5B40D 3B0DB 1S32C 3REHB 5KDMA 1KU5A 5GSUC 1P3LB 4M6BA 4WU9B 1P3KC 1P3GA 4LD9A 3UT9A 3AV1A 5B24B 1BFMA 5AVBA 2NZDC 3A6NC 3WAAB 1JFIA 4KUDA 5DNND 3AZNA 3KUYC 3X1VB 1Q9CA 4J8XD 5JA4B 5B40B 5AV8A 3UTBD 5GT0C 5C3IB 2F8NH 2F8NG 3AZFD 1TAFA 4J8WA 1EQZC 3W98A 4XUJA 2PYOC 4ZUXB 3O62A 1P34D 5B33A 3LJAC 1P3MA 1BH8A 5DNNB 3VH6A 4J8XB 3LZ1B 5F99C 4Z2MH 3UTBB 1BH9A 1ZLAA 5B0YB 3X1TD 1KX3B 4YM6D 4Z5TA 3LELA 4AWLB 3B6FD 5BO0B 3MGSC 1M18A 3LZ1C 3TU4D 1HQ3A 5B32D 2BYMA 3W99C 1P3AA 1P34B 3C1CD 5B0YC 4JJNA 4UUZB 1KX3C 3MGPD 5AVCC 1P3PC 5DNMD 1P3IC 2NQBC 4QLCD 5CPID 3UTAC 4R8PD 5AY8A 3WA9A 3LJAD 3KWQC 2AROD 5AV5A 1KX5C 5AV6D 4YM6B 3B6FB 3WKJA 3AV2C 4Z66A 1F66A 1N1JA 3REIA 1H3OB 5B32B 3W96A 1P3BD 3MGPB 5AV9A 5DNMB 1ULYA 4QLCB 5BT1D 5CPIB 3VH6T 4H9SC 4R8PB 3REJC 3LJAB 2AROB 3B0CT 3V9RA 3W97A 5AV6B 5CPKD 5E5AD 5B1LC 3AZGC 1P3FD 5B31D 4X23C 3AZJA 1P3OC 3WTPC 4KGCD 1F1EA 2HUEC 1P3BB 5JRGC 3MVDC 4H9RB 3REKA 2CV5D 3MGRA 3AZLC 3AZKA 1AOID 3KXBC 1S32D 3R45A 5CPKB 5GSUD 4H9NB 4WU8A 1P3KD 2F8NK 1P3FB 3X1UA 5B31B 3MNNB 2NZDD 5B1MC 4J8UA 2FJ7B 4G92C 2CV5B 4YS3A 3A6ND 1M19A 1AOIB 1U35A 3KUYD 2F8ND 4E44A 3AFAC 1R4VA 3B6GA 1S32B 4NE5A 5BS7C 5B0ZC 3MNNC 3AZMA 4XZQA 5GSUB 5GT0D 2HIOC 5CPJC 2FJ7C 1P3KB 1M1AA 5GT3C 5B2IC 4J8UC 4WZSB 1KX4C 1EQZD 5G49B 5CP6C 3AZIC 2PYOD 3AN2C 2NZDB 3VH5W 4CAYB 3A6NB 3AZHC 3AZEA 3KUYB 3RELC 3X1SC 2F8NB 1TZYA 2YFWA 3MGQC 1ID3A 5F99D 5FUGB 4J8VC 5B2JA 4ZUXD 5GXQA 5GT0B 3LZ0C 3AYWA 3AV1B 3MGSD 3C1BA 3REHA 4CSRB 3WTPE 3NQJA 3LZ1D 1EQZB 1P3LA 2PYOB 4WV4B 3W99D 2YFVB 4WU9A 1P3GC 3B0BA 4LD9C 3UT9C 5B0YD 3AV1C 1KX3D 5AVCD 1P3PD 4H9OB 5AVBC 5B24A 1P3ID 2NQBD 5F99B 3UTAD 1B67A 4KUDC 4KHAA 3KWQD 3AZNC 3WAAA 1KX5D 1TAFB 3X1VA 4XUJB 5AV8C 5JA4A 5B40A 3AV2D 3MGSB 3W99B 2RVQC 3NQUA 4J8WC 3W98C 4XUJC 5AVCB 1P3PB 1P3IB 2NQBB 3O62C 1WWSA 4ZUXA 3UTAB 3REJD 5B33C 1P3MC 5BNVB 4Z5TB 3KWQB 1KX5B 5DNNA 5BNXB 4J8XA 5B1LD 3AV2B 3AZGD 4H9QB 4X23D 3UTBA 1ZLAC 1P3OD 3WTPD 4Z5TC 3LELC 5JRGD 3MVDD 1M18C 3AZFA 1HQ3C 3AZLD 1P3AC 2L5AA 3REJB 3KXBD 4JJNC 1P34A 5AY8C 4ZBJC 5B1LB 3WA9C 3AZGB 5AV5C 4X23B 3AZFC 1P3OB 3WTPB 3X1TA 2HUEB 3WKJC 4YM6A 1F66C 4Z66C 5B1MD 5JRGB 3MVDB 3B6FA 3REIC 1H3OA 3TU4A 3AZLB 3W96C 5B32A 3V9RB 3AFAD 3KXBB 4DRBA 3C1CA 5B0ZD 3MNND 5AV9C 3MGPA 5DNMA 2HIOD 5CPJD 2FJ7D 4QLCA 5CPIA 4R8PA 5GT3D 5B2ID 3LJAA 3W97C 2AROA 1KX4D 3REKB 5AV6A 2LY8A 5CP6D 3AZID 3MGRB 3AN2D 1WWIA 5B1MB 3AZJC 4WNNB 4G92B 3AZHD 4G91C 3X1SD 3RELD 3AFAB 1P3BA 3MGQD 4H9RA 3REKC 5B32G 5B0ZB 3MGRC 4J8VD 3AZKC 4HGAC 2HIOB 3LZ0D 5CPJB 5GT3B 5B2IB 4J8UB 1KX4B 5CPKA 4YS3B 5CP6B 3AZIB 5E5AA 3AN2B 4WU8C 4H9NA 1U35B 1P3GD 3X1UC 4LD9D 3UT9D 3AV1D 1P3FA 3AZHB 5B31A 2BYKA 3B6GB 2CWEA 5AVBD 3X1SB 3RELB 4KGCA 3MGQB 4EO5C 4YS3C 1A7WA 4J8VB 2CV5A 4H9PA 1M19C 3AZND 4KUDD 1U35C 1AOIA 3LZ0B 3B6GC 5AV8D 3AZMC 1S32A 5KDMB 4XZQC 4NFTA 5GSUA 1B6WA 1M1AC 2RVQD 1P3GB 1P3KA 1TZYB 4LD9B 3UT9B 4J8WD 3W98D 4XUJD 5G49A 5AVBB 3VH5A 2NZDA 3O62D 5B31G 5B33D 1P3MD 1JFIB 4KUDB 4CAYA 3A6NA 3AZEC 3AZNB 3C1BB 1TZYC 3NQJB 3KUYA 2F8NA 1ID3C 5AV8B 5B2JC 4NE6A 5FUGA 2IO5C 5GXQC 1ZLAD 3AYWC 5GT0A 4Z5TD 3LELD 3B0DC 1M18D 3C1BC 3REHC 4CSRA 4J8WB 1P3LC 1HQ3D 3W98B 1EQZA 1P3AD 4WU9C 4KHAB 2PYOA 2YFVA 3O62B 5B33B 1P3MB 4JJND 1BH8B 5B24C 4H9OA 5AY8D 3VH6W 5F99A 3WA9D 3NQUB 3WAAC 5AV5D 1BH9B 1ZLAB 3B0CW 3X1VC 3WKJD 3LELB 1F66D 4Z66D 5B40C 1M18B 3REID 3MGSA 1HQ3B 3LZ1A 2BYMB 1P3AB 3W96D 4NE3A 5C3IC 3W99A 3VH5T 4JJNB 5B0YA 1KX3A 5AV9D 3KSYA 5AVCA 5CHLB 5BO0A 1P3IA 1P3PA 4Z2MG 2NQBA 4ZUXC 5AY8B 4ZBJB 3UTAA 3WA9B 5BNVA 5AV5B 5DNNC 3KWQA 3AZFB 3W97D 1KX5A 4J8XC 5BNXA 3WKJB 1F66B 4UUZA 4Z66B 1N1JB 3REIB 3AV2A 3AZJD 3UTBC 4H9QA 3W96B 4AWLC 3REKD 3MGRD 3AZKD 5AV9B 4DRAA 4H9SA 3X1TB 3REJA 1P34C 3W97B 4WU8D 3TU4B 5B1LA 3X1UD 3AZGA 3AZJB 4X23A 3C1CB 3X1TC 1P3OA 3WTPA 4YM6C 4G91B 3B6FC 4J8UD 5JRGA 3MVDA 4YS3D 1M19D 3TU4C 3AZKB 1U35D 4HGAB 5B32C 3AZLA 3B6GD 3C1CC 3KXBA 3AZMD 3R45B 4XZQD 3MGPC 5DNMC 4QLCC 5CPIC 4WU8B 4R8PC 1M1AD 3X1UB 1HTAA 2AROC
chains in the Genus database with same CATH superfamily
5AV6C 5B1MA 4EO5B 3H0MC 2JSSA 4WNNA 1M19B 3AZED 1P3BC 1TZYD 3AFAA 1ID3D 5E5AB 5B2JD 3AZMB 5BS7A 5B0ZA 4XZQB 3MNNA 5GXQD 3AYWD 2ZY2A 5BT1C 2HIOA 2BYKB 5CPJA 2FJ7A 1M1AB 4KGCB 3C1BD 3REHD 5GT3A 5B2IA 5CPKC 1P3LD 1KX4A 5E5AC 4H9PB 4WU9D 5CP6A 2UWXA 3AZIA 3AN2A 1P3FC 5B31C 3AZEB 3AZHA 4KGCC 5B24D 2YFWB 3X1SA 3RELA 1ID3B 2F2AC 3MGQA 2CV5C 5B2JB 3EPLA 3WAAD 4J8VA 1AOIC 2IO5B 5GXQB 3AYWB 3X1VD 4E45A 3LZ0A 5B40D 3B0DB 1S32C 3REHB 3EPHA 5KDMA 1KU5A 5GSUC 1P3LB 4M6BA 4WU9B 1P3KC 1P3GA 4LD9A 3UT9A 3AV1A 5B24B 1BFMA 5AVBA 2NZDC 3A6NC 3WAAB 1JFIA 4KUDA 5DNND 3AZNA 3KUYC 3X1VB 1Q9CA 4J8XD 5JA4B 5B40B 5AV8A 3UTBD 5GT0C 2Y2JA 5C3IB 2F8NH 2F8NG 3AZFD 1TAFA 3KFUG 4J8WA 1EQZC 3W98A 4XUJA 2PYOC 4ZUXB 3O62A 1P34D 5B33A 3LJAC 1P3MA 1BH8A 5DNNB 3VH6A 4J8XB 3LZ1B 5F99C 4Z2MH 3UTBB 2XD5A 1BH9A 2BG1A 1ZLAA 5B0YB 3X1TD 1KX3B 4YM6D 2Y2PA 4Z5TA 3LELA 4AWLB 3B6FD 5BO0B 3MGSC 1M18A 3LZ1C 3TU4D 1HQ3A 5B32D 2BYMA 3W99C 1P3AA 1Z2CB 1P34B 2VQRA 2Y2GA 5B0YC 3C1CD 4JJNA 4UUZB 1KX3C 3MGPD 5AVCC 1P3PC 5DNMD 1P3IC 2NQBC 4QLCD 5CPID 3UTAC 4R8PD 5AY8A 3H0RC 3WA9A 3LJAD 3KWQC 2AROD 5AV5A 1KX5C 5AV6D 4YM6B 3B6FB 3WKJA 3AV2C 4Z66A 1F66A 1N1JA 3REIA 1H3OB 5B32B 3W96A 1P3BD 3MGPB 5AV9A 5DNMB 1ULYA 4QLCB 5BT1D 5CPIB 3VH6T 4H9SC 4R8PB 3REJC 2Y2KA 3H0LC 3LJAB 2AROB 3B0CT 3V9RA 3W97A 5AV6B 5CPKD 5E5AD 5B1LC 3AZGC 1P3FD 5B31D 4X23C 3AZJA 1P3OC 3WTPC 4KGCD 1F1EA 2HUEC 1P3BB 5JRGC 3EPJA 3MVDC 4H9RB 3REKA 2CV5D 2Y2MA 3MGRA 3AZLC 3AZKA 1AOID 2Y2IA 3IP4C 3KXBC 1S32D 3R45A 5CPKB 5GSUD 4WJ3C 4H9NB 4WU8A 1P3KD 2F8NK 1P3FB 3X1UA 5B31B 3MNNB 2NZDD 2Y2QA 5B1MC 4J8UA 2Y2HA 2FJ7B 4G92C 2CV5B 4YS3A 3A6ND 1M19A 1AOIB 1U35A 2XD1A 3KUYD 2F8ND 2ZY5A 4E44A 3AFAC 1R4VA 3B6GA 1S32B 4NE5A 5BS7C 5B0ZC 3MNNC 3AZMA 4XZQA 5GSUB 5GT0D 2HIOC 5CPJC 2FJ7C 2ZY4A 1P3KB 1M1AA 5GT3C 5B2IC 4J8UC 4WZSB 1KX4C 1EQZD 5G49B 5CP6C 3AZIC 2PYOD 3AN2C 2NZDB 3VH5W 4CAYB 3A6NB 3AZHC 3AZEA 3KUYB 3RELC 3X1SC 2F8NB 1TZYA 2YFWA 3MGQC 1ID3A 5F99D 5FUGB 4J8VC 5B2JA 4ZUXD 5GXQA 5GT0B 3LZ0C 3AYWA 3AV1B 3MGSD 3EG5B 3C1BA 4CSRB 3WTPE 3REHA 3NQJA 3LZ1D 1EQZB 1P3LA 2PYOB 4WV4B 3W99D 2YFVB 4WU9A 1P3GC 3B0BA 4LD9C 3UT9C 5B0YD 3AV1C 1KX3D 5AVCD 1P3PD 4H9OB 5AVBC 5B24A 1P3ID 2NQBD 4DQYB 5F99B 3UTAD 1B67A 2DQNC 4KUDC 4KHAA 3KWQD 3AZNC 3WAAA 1KX5D 1TAFB 3X1VA 2RIQA 4XUJB 5AV8C 5JA4A 5B40A 3AV2D 3MGSB 3W99B 2RVQC 3NQUA 4J8WC 3W98C 4XUJC 5AVCB 1P3PB 1P3IB 2NQBB 3O62C 1WWSA 4ZUXA 3UTAB 3REJD 5B33C 1P3MC 5BNVB 4Z5TB 3KWQB 1KX5B 5DNNA 5BNXB 4J8XA 5B1LD 3AV2B 3AZGD 4H9QB 4X23D 3UTBA 1ZLAC 1P3OD 3WTPD 4Z5TC 3LELC 5JRGD 3MVDD 1M18C 3AZFA 1HQ3C 3AZLD 1P3AC 2Y2OA 2L5AA 3REJB 3KXBD 4JJNC 1P34A 2ZM5A 5AY8C 4ZBJC 5B1LB 3WA9C 3AZGB 5AV5C 4X23B 3AZFC 1P3OB 3WTPB 3X1TA 2HUEB 2Y2NA 4YM6A 3WKJC 1F66C 4Z66C 5B1MD 5JRGB 3MVDB 3B6FA 3REIC 2JE5A 1H3OA 3TU4A 3AZLB 3W96C 5B32A 3V9RB 3AFAD 3KXBB 4DRBA 3C1CA 5B0ZD 3MNND 5AV9C 3MGPA 5DNMA 2HIOD 5CPJD 2G5IC 4QLCA 2FJ7D 5CPIA 2G5HC 4R8PA 5GT3D 5B2ID 3LJAA 3W97C 2AROA 1KX4D 3REKB 5AV6A 2J8PA 2LY8A 5CP6D 3AZID 1T3UA 3MGRB 3AN2D 1WWIA 5B1MB 3AZJC 4WNNB 4G92B 3AZHD 4G91C 3X1SD 3RELD 3AFAB 1P3BA 3MGQD 4H9RA 3REKC 5B32G 5B0ZB 3MGRC 4J8VD 3AZKC 4HGAC 3EPKA 2HIOB 3LZ0D 5CPJB 5GT3B 5B2IB 4J8UB 3A1KA 1KX4B 5CPKA 4YS3B 5CP6B 3AZIB 5E5AA 3AN2B 4WU8C 4H9NA 1U35B 1P3GD 3X1UC 4LD9D 3UT9D 3AV1D 1P3FA 3AZHB 5B31A 2BYKA 3B6GB 2CWEA 5AVBD 3X1SB 3RELB 4KGCA 3MGQB 4EO5C 4YS3C 1A7WA 4J8VB 2CV5A 4H9PA 1M19C 3AZND 4KUDD 1U35C 1AOIA 3LZ0B 3B6GC 5AV8D 3AZMC 1S32A 3P5JB 5KDMB 4XZQC 4NFTA 5GSUA 1B6WA 1M1AC 2RVQD 1P3GB 1P3KA 1TZYB 4LD9B 3UT9B 4J8WD 2ZY3A 3W98D 4XUJD 5G49A 5AVBB 3VH5A 3FDDA 2NZDA 3O62D 5B31G 5B33D 1P3MD 1JFIB 4KUDB 4CAYA 3A6NA 3AZEC 3AZNB 3C1BB 1TZYC 3NQJB 3KUYA 2F8NA 1ID3C 5AV8B 5B2JC 4NE6A 5FUGA 2IO5C 5GXQC 1ZLAD 3AYWC 5GT0A 4Z5TD 3LELD 3B0DC 1M18D 3C1BC 3F6TA 3REHC 4CSRA 4J8WB 1P3LC 1HQ3D 3W98B 1EQZA 1P3AD 4WU9C 4KHAB 2PYOA 2YFVA 3O62B 2Y2LA 5B33B 1P3MB 4JJND 1BH8B 5B24C 4H9OA 5AY8D 3VH6W 5F99A 3WA9D 3NQUB 3WAAC 5AV5D 1BH9B 1ZLAB 3B0CW 3X1VC 3WKJD 3LELB 1F66D 4Z66D 5B40C 1M18B 3REID 3MGSA 1HQ3B 3LZ1A 2BYMB 1P3AB 3W96D 4NE3A 5C3IC 3W99A 3VH5T 4JJNB 5B0YA 1KX3A 5AV9D 3KSYA 5AVCA 5CHLB 5BO0A 1P3IA 1P3PA 4Z2MG 2NQBA 4ZUXC 5AY8B 4ZBJB 3UTAA 3WA9B 5BNVA 5AV5B 5DNNC 3KWQA 3AZFB 3W97D 1KX5A 4J8XC 5BNXA 3WKJB 1F66B 4UUZA 4Z66B 1N1JB 3REIB 3AV2A 3AZJD 3UTBC 4H9QA 3AL0C 3W96B 2W8SA 4AWLC 2JCHA 3REKD 3MGRD 3AZKD 5AV9B 4DRAA 4H9SA 3X1TB 3REJA 1P34C 3W97B 4WU8D 4UPKA 3TU4B 5B1LA 3X1UD 3AZGA 3AZJB 1PZRA 4X23A 3C1CB 3X1TC 2FFFB 3WTPA 1P3OA 4YM6C 4G91B 3B6FC 3A1IA 4J8UD 5JRGA 3MVDA 4YS3D 1M19D 3TU4C 3AZKB 1U35D 1W2EA 4HGAB 5B32C 3AZLA 3B6GD 3C1CC 3KXBA 3AZMD 3R45B 4XZQD 3MGPC 5DNMC 4QLCC 5CPIC 4WU8B 4R8PC 1M1AD 2DF4C 3X1UB 1HTAA 2AROC
chains in the Genus database with same CATH topology
5AV6C 5B1MA 4EO5B 3H0MC 2JSSA 4WNNA 1M19B 3AZED 1P3BC 1TZYD 3AFAA 1ID3D 5E5AB 5B2JD 3AZMB 5BS7A 5B0ZA 4XZQB 3MNNA 5GXQD 3AYWD 2ZY2A 5BT1C 2HIOA 2BYKB 5CPJA 2FJ7A 1M1AB 4KGCB 3C1BD 3REHD 5GT3A 5B2IA 5CPKC 1P3LD 1KX4A 5E5AC 4H9PB 4WU9D 5CP6A 2UWXA 3AZIA 3AN2A 1P3FC 5B31C 3AZEB 3AZHA 4KGCC 5B24D 2YFWB 3X1SA 3RELA 1ID3B 2F2AC 3MGQA 2CV5C 5B2JB 3EPLA 3WAAD 4J8VA 1AOIC 2IO5B 5GXQB 3AYWB 3X1VD 4E45A 3LZ0A 5B40D 3B0DB 1S32C 3REHB 3EPHA 5KDMA 1KU5A 5GSUC 1P3LB 4M6BA 4WU9B 1P3KC 1P3GA 4LD9A 3UT9A 3AV1A 5B24B 1BFMA 5AVBA 2NZDC 3A6NC 3WAAB 1JFIA 4KUDA 5DNND 3AZNA 3KUYC 3X1VB 1Q9CA 4J8XD 5JA4B 5B40B 5AV8A 3UTBD 5GT0C 2Y2JA 5C3IB 2F8NH 2F8NG 3AZFD 1TAFA 3KFUG 4J8WA 1EQZC 3W98A 4XUJA 2PYOC 4ZUXB 3O62A 1P34D 5B33A 3LJAC 1P3MA 1BH8A 5DNNB 3VH6A 4J8XB 3LZ1B 5F99C 4Z2MH 3UTBB 2XD5A 1BH9A 2BG1A 1ZLAA 5B0YB 3X1TD 1KX3B 4YM6D 2Y2PA 4Z5TA 3LELA 4AWLB 3B6FD 5BO0B 3MGSC 1M18A 3LZ1C 3TU4D 1HQ3A 5B32D 2BYMA 3W99C 1P3AA 1Z2CB 1P34B 2VQRA 2Y2GA 5B0YC 3C1CD 4JJNA 4UUZB 1KX3C 3MGPD 5AVCC 1P3PC 5DNMD 1P3IC 2NQBC 4QLCD 5CPID 3UTAC 4R8PD 5AY8A 3H0RC 3WA9A 3LJAD 3KWQC 2AROD 5AV5A 1KX5C 5AV6D 4YM6B 3B6FB 3WKJA 3AV2C 4Z66A 1F66A 1N1JA 3REIA 1H3OB 5B32B 3W96A 1P3BD 3MGPB 5AV9A 5DNMB 1ULYA 4QLCB 5BT1D 5CPIB 3VH6T 4H9SC 4R8PB 3REJC 2Y2KA 3H0LC 3LJAB 2AROB 3B0CT 3V9RA 3W97A 5AV6B 5CPKD 5E5AD 5B1LC 3AZGC 1P3FD 5B31D 4X23C 3AZJA 1P3OC 3WTPC 4KGCD 1F1EA 2HUEC 1P3BB 5JRGC 3EPJA 3MVDC 4H9RB 3REKA 2CV5D 2Y2MA 3MGRA 3AZLC 3AZKA 1AOID 2Y2IA 3IP4C 3KXBC 1S32D 3R45A 5CPKB 5GSUD 4WJ3C 4H9NB 4WU8A 1P3KD 2F8NK 1P3FB 3X1UA 5B31B 3MNNB 2NZDD 2Y2QA 5B1MC 4J8UA 2Y2HA 2FJ7B 4G92C 2CV5B 4YS3A 3A6ND 1M19A 1AOIB 1U35A 2XD1A 3KUYD 2F8ND 2ZY5A 4E44A 3AFAC 1R4VA 3B6GA 1S32B 4NE5A 5BS7C 5B0ZC 3MNNC 3AZMA 4XZQA 5GSUB 5GT0D 2HIOC 5CPJC 2FJ7C 2ZY4A 1P3KB 1M1AA 5GT3C 5B2IC 4J8UC 4WZSB 1KX4C 1EQZD 5G49B 5CP6C 3AZIC 2PYOD 3AN2C 2NZDB 3VH5W 4CAYB 3A6NB 3AZHC 3AZEA 3KUYB 3RELC 3X1SC 2F8NB 1TZYA 2YFWA 3MGQC 1ID3A 5F99D 5FUGB 4J8VC 5B2JA 4ZUXD 5GXQA 5GT0B 3LZ0C 3AYWA 3AV1B 3MGSD 3EG5B 3C1BA 4CSRB 3WTPE 3REHA 3NQJA 3LZ1D 1EQZB 1P3LA 2PYOB 4WV4B 3W99D 2YFVB 4WU9A 1P3GC 3B0BA 4LD9C 3UT9C 5B0YD 3AV1C 1KX3D 5AVCD 1P3PD 4H9OB 5AVBC 5B24A 1P3ID 2NQBD 4DQYB 5F99B 3UTAD 1B67A 2DQNC 4KUDC 4KHAA 3KWQD 3AZNC 3WAAA 1KX5D 1TAFB 3X1VA 2RIQA 4XUJB 5AV8C 5JA4A 5B40A 3AV2D 3MGSB 3W99B 2RVQC 3NQUA 4J8WC 3W98C 4XUJC 5AVCB 1P3PB 1P3IB 2NQBB 3O62C 1WWSA 4ZUXA 3UTAB 3REJD 5B33C 1P3MC 5BNVB 4Z5TB 3KWQB 1KX5B 5DNNA 5BNXB 4J8XA 5B1LD 3AV2B 3AZGD 4H9QB 4X23D 3UTBA 1ZLAC 1P3OD 3WTPD 4Z5TC 3LELC 5JRGD 3MVDD 1M18C 3AZFA 1HQ3C 3AZLD 1P3AC 2Y2OA 2L5AA 3REJB 3KXBD 4JJNC 1P34A 2ZM5A 5AY8C 4ZBJC 5B1LB 3WA9C 3AZGB 5AV5C 4X23B 3AZFC 1P3OB 3WTPB 3X1TA 2HUEB 2Y2NA 4YM6A 3WKJC 1F66C 4Z66C 5B1MD 5JRGB 3MVDB 3B6FA 3REIC 2JE5A 1H3OA 3TU4A 3AZLB 3W96C 5B32A 3V9RB 3AFAD 3KXBB 4DRBA 3C1CA 5B0ZD 3MNND 5AV9C 3MGPA 5DNMA 2HIOD 5CPJD 2G5IC 4QLCA 2FJ7D 5CPIA 2G5HC 4R8PA 5GT3D 5B2ID 3LJAA 3W97C 2AROA 1KX4D 3REKB 5AV6A 2J8PA 2LY8A 5CP6D 3AZID 1T3UA 3MGRB 3AN2D 1WWIA 5B1MB 3AZJC 4WNNB 4G92B 3AZHD 4G91C 3X1SD 3RELD 3AFAB 1P3BA 3MGQD 4H9RA 3REKC 5B32G 5B0ZB 3MGRC 4J8VD 3AZKC 4HGAC 3EPKA 2HIOB 3LZ0D 5CPJB 5GT3B 5B2IB 4J8UB 3A1KA 1KX4B 5CPKA 4YS3B 5CP6B 3AZIB 5E5AA 3AN2B 4WU8C 4H9NA 1U35B 1P3GD 3X1UC 4LD9D 3UT9D 3AV1D 1P3FA 3AZHB 5B31A 2BYKA 3B6GB 2CWEA 5AVBD 3X1SB 3RELB 4KGCA 3MGQB 4EO5C 4YS3C 1A7WA 4J8VB 2CV5A 4H9PA 1M19C 3AZND 4KUDD 1U35C 1AOIA 3LZ0B 3B6GC 5AV8D 3AZMC 1S32A 3P5JB 5KDMB 4XZQC 4NFTA 5GSUA 1B6WA 1M1AC 2RVQD 1P3GB 1P3KA 1TZYB 4LD9B 3UT9B 4J8WD 2ZY3A 3W98D 4XUJD 5G49A 5AVBB 3VH5A 3FDDA 2NZDA 3O62D 5B31G 5B33D 1P3MD 1JFIB 4KUDB 4CAYA 3A6NA 3AZEC 3AZNB 3C1BB 1TZYC 3NQJB 3KUYA 2F8NA 1ID3C 5AV8B 5B2JC 4NE6A 5FUGA 2IO5C 5GXQC 1ZLAD 3AYWC 5GT0A 4Z5TD 3LELD 3B0DC 1M18D 3C1BC 3F6TA 3REHC 4CSRA 4J8WB 1P3LC 1HQ3D 3W98B 1EQZA 1P3AD 4WU9C 4KHAB 2PYOA 2YFVA 3O62B 2Y2LA 5B33B 1P3MB 4JJND 1BH8B 5B24C 4H9OA 5AY8D 3VH6W 5F99A 3WA9D 3NQUB 3WAAC 5AV5D 1BH9B 1ZLAB 3B0CW 3X1VC 3WKJD 3LELB 1F66D 4Z66D 5B40C 1M18B 3REID 3MGSA 1HQ3B 3LZ1A 2BYMB 1P3AB 3W96D 4NE3A 5C3IC 3W99A 3VH5T 4JJNB 5B0YA 1KX3A 5AV9D 3KSYA 5AVCA 5CHLB 5BO0A 1P3IA 1P3PA 4Z2MG 2NQBA 4ZUXC 5AY8B 4ZBJB 3UTAA 3WA9B 5BNVA 5AV5B 5DNNC 3KWQA 3AZFB 3W97D 1KX5A 4J8XC 5BNXA 3WKJB 1F66B 4UUZA 4Z66B 1N1JB 3REIB 3AV2A 3AZJD 3UTBC 4H9QA 3AL0C 3W96B 2W8SA 4AWLC 2JCHA 3REKD 3MGRD 3AZKD 5AV9B 4DRAA 4H9SA 3X1TB 3REJA 1P34C 3W97B 4WU8D 4UPKA 3TU4B 5B1LA 3X1UD 3AZGA 3AZJB 1PZRA 4X23A 3C1CB 3X1TC 2FFFB 3WTPA 1P3OA 4YM6C 4G91B 3B6FC 3A1IA 4J8UD 5JRGA 3MVDA 4YS3D 1M19D 3TU4C 3AZKB 1U35D 1W2EA 4HGAB 5B32C 3AZLA 3B6GD 3C1CC 3KXBA 3AZMD 3R45B 4XZQD 3MGPC 5DNMC 4QLCC 5CPIC 4WU8B 4R8PC 1M1AD 2DF4C 3X1UB 1HTAA 2AROC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 C;  5B1M A;  4EO5 B;  2JSS A;  4WNN A;  1M19 B;  3AZE D;  1P3B C;  1TZY D;  3AFA A;  1ID3 D;  5E5A B;  5B2J D;  3AZM B;  5BS7 A;  5B0Z A;  4XZQ B;  3MNN A;  5GXQ D;  3AYW D;  5BT1 C;  2HIO A;  2BYK B;  5CPJ A;  2FJ7 A;  1M1A B;  4KGC B;  3C1B D;  3REH D;  5GT3 A;  5B2I A;  5CPK C;  1P3L D;  1KX4 A;  5E5A C;  4H9P B;  4WU9 D;  5CP6 A;  3AZI A;  3AN2 A;  1P3F C;  5B31 C;  3AZE B;  3AZH A;  4KGC C;  5B24 D;  2YFW B;  3X1S A;  3REL A;  1ID3 B;  3MGQ A;  2CV5 C;  5B2J B;  3WAA D;  4J8V A;  1AOI C;  2IO5 B;  5GXQ B;  3AYW B;  3X1V D;  4E45 A;  3LZ0 A;  5B40 D;  3B0D B;  1S32 C;  3REH B;  5KDM A;  1KU5 A;  5GSU C;  1P3L B;  4M6B A;  4WU9 B;  1P3K C;  1P3G A;  4LD9 A;  3UT9 A;  3AV1 A;  5B24 B;  1BFM A;  5AVB A;  2NZD C;  3A6N C;  3WAA B;  1JFI A;  4KUD A;  5DNN D;  3AZN A;  3KUY C;  3X1V B;  1Q9C A;  4J8X D;  5JA4 B;  5B40 B;  5AV8 A;  3UTB D;  5GT0 C;  5C3I B;  2F8N H;  2F8N G;  3AZF D;  1TAF A;  4J8W A;  1EQZ C;  3W98 A;  4XUJ A;  2PYO C;  4ZUX B;  3O62 A;  1P34 D;  5B33 A;  3LJA C;  1P3M A;  1BH8 A;  5DNN B;  3VH6 A;  4J8X B;  3LZ1 B;  5F99 C;  4Z2M H;  3UTB B;  1BH9 A;  1ZLA A;  5B0Y B;  3X1T D;  1KX3 B;  4YM6 D;  4Z5T A;  3LEL A;  4AWL B;  3B6F D;  5BO0 B;  3MGS C;  1M18 A;  3LZ1 C;  3TU4 D;  1HQ3 A;  5B32 D;  2BYM A;  3W99 C;  1P3A A;  1P34 B;  3C1C D;  5B0Y C;  4JJN A;  4UUZ B;  1KX3 C;  3MGP D;  5AVC C;  1P3P C;  5DNM D;  1P3I C;  2NQB C;  4QLC D;  5CPI D;  3UTA C;  4R8P D;  5AY8 A;  3WA9 A;  3LJA D;  3KWQ C;  2ARO D;  5AV5 A;  1KX5 C;  5AV6 D;  4YM6 B;  3B6F B;  3WKJ A;  3AV2 C;  4Z66 A;  1F66 A;  1N1J A;  3REI A;  1H3O B;  5B32 B;  3W96 A;  1P3B D;  3MGP B;  5AV9 A;  5DNM B;  1ULY A;  4QLC B;  5BT1 D;  5CPI B;  3VH6 T;  4H9S C;  4R8P B;  3REJ C;  3LJA B;  2ARO B;  3B0C T;  3V9R A;  3W97 A;  5AV6 B;  5CPK D;  5E5A D;  5B1L C;  3AZG C;  1P3F D;  5B31 D;  4X23 C;  3AZJ A;  1P3O C;  3WTP C;  4KGC D;  1F1E A;  2HUE C;  1P3B B;  5JRG C;  3MVD C;  4H9R B;  3REK A;  2CV5 D;  3MGR A;  3AZL C;  3AZK A;  1AOI D;  3KXB C;  1S32 D;  3R45 A;  5CPK B;  5GSU D;  4H9N B;  4WU8 A;  1P3K D;  2F8N K;  1P3F B;  3X1U A;  5B31 B;  3MNN B;  2NZD D;  5B1M C;  4J8U A;  2FJ7 B;  4G92 C;  2CV5 B;  4YS3 A;  3A6N D;  1M19 A;  1AOI B;  1U35 A;  3KUY D;  2F8N D;  4E44 A;  3AFA C;  1R4V A;  3B6G A;  1S32 B;  4NE5 A;  5BS7 C;  5B0Z C;  3MNN C;  3AZM A;  4XZQ A;  5GSU B;  5GT0 D;  2HIO C;  5CPJ C;  2FJ7 C;  1P3K B;  1M1A A;  5GT3 C;  5B2I C;  4J8U C;  4WZS B;  1KX4 C;  1EQZ D;  5G49 B;  5CP6 C;  3AZI C;  2PYO D;  3AN2 C;  2NZD B;  3VH5 W;  4CAY B;  3A6N B;  3AZH C;  3AZE A;  3KUY B;  3REL C;  3X1S C;  2F8N B;  1TZY A;  2YFW A;  3MGQ C;  1ID3 A;  5F99 D;  5FUG B;  4J8V C;  5B2J A;  4ZUX D;  5GXQ A;  5GT0 B;  3LZ0 C;  3AYW A;  3AV1 B;  3MGS D;  3C1B A;  3REH A;  4CSR B;  3WTP E;  3NQJ A;  3LZ1 D;  1EQZ B;  1P3L A;  2PYO B;  4WV4 B;  3W99 D;  2YFV B;  4WU9 A;  1P3G C;  3B0B A;  4LD9 C;  3UT9 C;  5B0Y D;  3AV1 C;  1KX3 D;  5AVC D;  1P3P D;  4H9O B;  5AVB C;  5B24 A;  1P3I D;  2NQB D;  5F99 B;  3UTA D;  1B67 A;  4KUD C;  4KHA A;  3KWQ D;  3AZN C;  3WAA A;  1KX5 D;  1TAF B;  3X1V A;  4XUJ B;  5AV8 C;  5JA4 A;  5B40 A;  3AV2 D;  3MGS B;  3W99 B;  2RVQ C;  3NQU A;  4J8W C;  3W98 C;  4XUJ C;  5AVC B;  1P3P B;  1P3I B;  2NQB B;  3O62 C;  1WWS A;  4ZUX A;  3UTA B;  3REJ D;  5B33 C;  1P3M C;  5BNV B;  4Z5T B;  3KWQ B;  1KX5 B;  5DNN A;  5BNX B;  4J8X A;  5B1L D;  3AV2 B;  3AZG D;  4H9Q B;  4X23 D;  3UTB A;  1ZLA C;  1P3O D;  3WTP D;  4Z5T C;  3LEL C;  5JRG D;  3MVD D;  1M18 C;  3AZF A;  1HQ3 C;  3AZL D;  1P3A C;  2L5A A;  3REJ B;  3KXB D;  4JJN C;  1P34 A;  5AY8 C;  4ZBJ C;  5B1L B;  3WA9 C;  3AZG B;  5AV5 C;  4X23 B;  3AZF C;  1P3O B;  3WTP B;  3X1T A;  2HUE B;  3WKJ C;  4YM6 A;  1F66 C;  4Z66 C;  5B1M D;  5JRG B;  3MVD B;  3B6F A;  3REI C;  1H3O A;  3TU4 A;  3AZL B;  3W96 C;  5B32 A;  3V9R B;  3AFA D;  3KXB B;  4DRB A;  3C1C A;  5B0Z D;  3MNN D;  5AV9 C;  3MGP A;  5DNM A;  2HIO D;  5CPJ D;  2FJ7 D;  4QLC A;  5CPI A;  4R8P A;  5GT3 D;  5B2I D;  3LJA A;  3W97 C;  2ARO A;  1KX4 D;  3REK B;  5AV6 A;  2LY8 A;  5CP6 D;  3AZI D;  3MGR B;  3AN2 D;  1WWI A;  5B1M B;  3AZJ C;  4WNN B;  4G92 B;  3AZH D;  4G91 C;  3X1S D;  3REL D;  3AFA B;  1P3B A;  3MGQ D;  4H9R A;  3REK C;  5B32 G;  5B0Z B;  3MGR C;  4J8V D;  3AZK C;  4HGA C;  2HIO B;  3LZ0 D;  5CPJ B;  5GT3 B;  5B2I B;  4J8U B;  1KX4 B;  5CPK A;  4YS3 B;  5CP6 B;  3AZI B;  5E5A A;  3AN2 B;  4WU8 C;  4H9N A;  1U35 B;  1P3G D;  3X1U C;  4LD9 D;  3UT9 D;  3AV1 D;  1P3F A;  3AZH B;  5B31 A;  2BYK A;  3B6G B;  2CWE A;  5AVB D;  3X1S B;  3REL B;  4KGC A;  3MGQ B;  4EO5 C;  4YS3 C;  1A7W A;  4J8V B;  2CV5 A;  4H9P A;  1M19 C;  3AZN D;  4KUD D;  1U35 C;  1AOI A;  3LZ0 B;  3B6G C;  5AV8 D;  3AZM C;  1S32 A;  5KDM B;  4XZQ C;  4NFT A;  5GSU A;  1B6W A;  1M1A C;  2RVQ D;  1P3G B;  1P3K A;  1TZY B;  4LD9 B;  3UT9 B;  4J8W D;  3W98 D;  4XUJ D;  5G49 A;  5AVB B;  3VH5 A;  2NZD A;  3O62 D;  5B31 G;  5B33 D;  1P3M D;  1JFI B;  4KUD B;  4CAY A;  3A6N A;  3AZE C;  3AZN B;  3C1B B;  1TZY C;  3NQJ B;  3KUY A;  2F8N A;  1ID3 C;  5AV8 B;  5B2J C;  4NE6 A;  5FUG A;  2IO5 C;  5GXQ C;  1ZLA D;  3AYW C;  5GT0 A;  4Z5T D;  3LEL D;  3B0D C;  1M18 D;  3C1B C;  3REH C;  4CSR A;  4J8W B;  1P3L C;  1HQ3 D;  3W98 B;  1EQZ A;  1P3A D;  4WU9 C;  4KHA B;  2PYO A;  2YFV A;  3O62 B;  5B33 B;  1P3M B;  4JJN D;  1BH8 B;  5B24 C;  4H9O A;  5AY8 D;  3VH6 W;  5F99 A;  3WA9 D;  3NQU B;  3WAA C;  5AV5 D;  1BH9 B;  1ZLA B;  3B0C W;  3X1V C;  3WKJ D;  3LEL B;  1F66 D;  4Z66 D;  5B40 C;  1M18 B;  3REI D;  3MGS A;  1HQ3 B;  3LZ1 A;  2BYM B;  1P3A B;  3W96 D;  4NE3 A;  5C3I C;  3W99 A;  3VH5 T;  4JJN B;  5B0Y A;  1KX3 A;  5AV9 D;  3KSY A;  5AVC A;  5CHL B;  5BO0 A;  1P3I A;  1P3P A;  4Z2M G;  2NQB A;  4ZUX C;  5AY8 B;  4ZBJ B;  3UTA A;  3WA9 B;  5BNV A;  5AV5 B;  5DNN C;  3KWQ A;  3AZF B;  3W97 D;  1KX5 A;  4J8X C;  5BNX A;  3WKJ B;  1F66 B;  4UUZ A;  4Z66 B;  1N1J B;  3REI B;  3AV2 A;  3AZJ D;  3UTB C;  4H9Q A;  3W96 B;  4AWL C;  3REK D;  3MGR D;  3AZK D;  5AV9 B;  4DRA A;  4H9S A;  3X1T B;  3REJ A;  1P34 C;  3W97 B;  4WU8 D;  3TU4 B;  5B1L A;  3X1U D;  3AZG A;  3AZJ B;  4X23 A;  3C1C B;  3X1T C;  1P3O A;  3WTP A;  4YM6 C;  4G91 B;  3B6F C;  4J8U D;  5JRG A;  3MVD A;  4YS3 D;  1M19 D;  3TU4 C;  3AZK B;  1U35 D;  4HGA B;  5B32 C;  3AZL A;  3B6G D;  3C1C C;  3KXB A;  3AZM D;  3R45 B;  4XZQ D;  3MGP C;  5DNM C;  4QLC C;  5CPI C;  4WU8 B;  4R8P C;  1M1A D;  3X1U B;  1HTA A;  2ARO C; 
#chains in the Genus database with same CATH topology
 5AV6 C;  5B1M A;  4EO5 B;  3H0M C;  2JSS A;  4WNN A;  1M19 B;  3AZE D;  1P3B C;  1TZY D;  3AFA A;  1ID3 D;  5E5A B;  5B2J D;  3AZM B;  5BS7 A;  5B0Z A;  4XZQ B;  3MNN A;  5GXQ D;  3AYW D;  2ZY2 A;  5BT1 C;  2HIO A;  2BYK B;  5CPJ A;  2FJ7 A;  1M1A B;  4KGC B;  3C1B D;  3REH D;  5GT3 A;  5B2I A;  5CPK C;  1P3L D;  1KX4 A;  5E5A C;  4H9P B;  4WU9 D;  5CP6 A;  2UWX A;  3AZI A;  3AN2 A;  1P3F C;  5B31 C;  3AZE B;  3AZH A;  4KGC C;  5B24 D;  2YFW B;  3X1S A;  3REL A;  1ID3 B;  2F2A C;  3MGQ A;  2CV5 C;  5B2J B;  3EPL A;  3WAA D;  4J8V A;  1AOI C;  2IO5 B;  5GXQ B;  3AYW B;  3X1V D;  4E45 A;  3LZ0 A;  5B40 D;  3B0D B;  1S32 C;  3REH B;  3EPH A;  5KDM A;  1KU5 A;  5GSU C;  1P3L B;  4M6B A;  4WU9 B;  1P3K C;  1P3G A;  4LD9 A;  3UT9 A;  3AV1 A;  5B24 B;  1BFM A;  5AVB A;  2NZD C;  3A6N C;  3WAA B;  1JFI A;  4KUD A;  5DNN D;  3AZN A;  3KUY C;  3X1V B;  1Q9C A;  4J8X D;  5JA4 B;  5B40 B;  5AV8 A;  3UTB D;  5GT0 C;  2Y2J A;  5C3I B;  2F8N H;  2F8N G;  3AZF D;  1TAF A;  3KFU G;  4J8W A;  1EQZ C;  3W98 A;  4XUJ A;  2PYO C;  4ZUX B;  3O62 A;  1P34 D;  5B33 A;  3LJA C;  1P3M A;  1BH8 A;  5DNN B;  3VH6 A;  4J8X B;  3LZ1 B;  5F99 C;  4Z2M H;  3UTB B;  2XD5 A;  1BH9 A;  2BG1 A;  1ZLA A;  5B0Y B;  3X1T D;  1KX3 B;  4YM6 D;  2Y2P A;  4Z5T A;  3LEL A;  4AWL B;  3B6F D;  5BO0 B;  3MGS C;  1M18 A;  3LZ1 C;  3TU4 D;  1HQ3 A;  5B32 D;  2BYM A;  3W99 C;  1P3A A;  1Z2C B;  1P34 B;  2VQR A;  2Y2G A;  5B0Y C;  3C1C D;  4JJN A;  4UUZ B;  1KX3 C;  3MGP D;  5AVC C;  1P3P C;  5DNM D;  1P3I C;  2NQB C;  4QLC D;  5CPI D;  3UTA C;  4R8P D;  5AY8 A;  3H0R C;  3WA9 A;  3LJA D;  3KWQ C;  2ARO D;  5AV5 A;  1KX5 C;  5AV6 D;  4YM6 B;  3B6F B;  3WKJ A;  3AV2 C;  4Z66 A;  1F66 A;  1N1J A;  3REI A;  1H3O B;  5B32 B;  3W96 A;  1P3B D;  3MGP B;  5AV9 A;  5DNM B;  1ULY A;  4QLC B;  5BT1 D;  5CPI B;  3VH6 T;  4H9S C;  4R8P B;  3REJ C;  2Y2K A;  3H0L C;  3LJA B;  2ARO B;  3B0C T;  3V9R A;  3W97 A;  5AV6 B;  5CPK D;  5E5A D;  5B1L C;  3AZG C;  1P3F D;  5B31 D;  4X23 C;  3AZJ A;  1P3O C;  3WTP C;  4KGC D;  1F1E A;  2HUE C;  1P3B B;  5JRG C;  3EPJ A;  3MVD C;  4H9R B;  3REK A;  2CV5 D;  2Y2M A;  3MGR A;  3AZL C;  3AZK A;  1AOI D;  2Y2I A;  3IP4 C;  3KXB C;  1S32 D;  3R45 A;  5CPK B;  5GSU D;  4WJ3 C;  4H9N B;  4WU8 A;  1P3K D;  2F8N K;  1P3F B;  3X1U A;  5B31 B;  3MNN B;  2NZD D;  2Y2Q A;  5B1M C;  4J8U A;  2Y2H A;  2FJ7 B;  4G92 C;  2CV5 B;  4YS3 A;  3A6N D;  1M19 A;  1AOI B;  1U35 A;  2XD1 A;  3KUY D;  2F8N D;  2ZY5 A;  4E44 A;  3AFA C;  1R4V A;  3B6G A;  1S32 B;  4NE5 A;  5BS7 C;  5B0Z C;  3MNN C;  3AZM A;  4XZQ A;  5GSU B;  5GT0 D;  2HIO C;  5CPJ C;  2FJ7 C;  2ZY4 A;  1P3K B;  1M1A A;  5GT3 C;  5B2I C;  4J8U C;  4WZS B;  1KX4 C;  1EQZ D;  5G49 B;  5CP6 C;  3AZI C;  2PYO D;  3AN2 C;  2NZD B;  3VH5 W;  4CAY B;  3A6N B;  3AZH C;  3AZE A;  3KUY B;  3REL C;  3X1S C;  2F8N B;  1TZY A;  2YFW A;  3MGQ C;  1ID3 A;  5F99 D;  5FUG B;  4J8V C;  5B2J A;  4ZUX D;  5GXQ A;  5GT0 B;  3LZ0 C;  3AYW A;  3AV1 B;  3MGS D;  3EG5 B;  3C1B A;  4CSR B;  3WTP E;  3REH A;  3NQJ A;  3LZ1 D;  1EQZ B;  1P3L A;  2PYO B;  4WV4 B;  3W99 D;  2YFV B;  4WU9 A;  1P3G C;  3B0B A;  4LD9 C;  3UT9 C;  5B0Y D;  3AV1 C;  1KX3 D;  5AVC D;  1P3P D;  4H9O B;  5AVB C;  5B24 A;  1P3I D;  2NQB D;  4DQY B;  5F99 B;  3UTA D;  1B67 A;  2DQN C;  4KUD C;  4KHA A;  3KWQ D;  3AZN C;  3WAA A;  1KX5 D;  1TAF B;  3X1V A;  2RIQ A;  4XUJ B;  5AV8 C;  5JA4 A;  5B40 A;  3AV2 D;  3MGS B;  3W99 B;  2RVQ C;  3NQU A;  4J8W C;  3W98 C;  4XUJ C;  5AVC B;  1P3P B;  1P3I B;  2NQB B;  3O62 C;  1WWS A;  4ZUX A;  3UTA B;  3REJ D;  5B33 C;  1P3M C;  5BNV B;  4Z5T B;  3KWQ B;  1KX5 B;  5DNN A;  5BNX B;  4J8X A;  5B1L D;  3AV2 B;  3AZG D;  4H9Q B;  4X23 D;  3UTB A;  1ZLA C;  1P3O D;  3WTP D;  4Z5T C;  3LEL C;  5JRG D;  3MVD D;  1M18 C;  3AZF A;  1HQ3 C;  3AZL D;  1P3A C;  2Y2O A;  2L5A A;  3REJ B;  3KXB D;  4JJN C;  1P34 A;  2ZM5 A;  5AY8 C;  4ZBJ C;  5B1L B;  3WA9 C;  3AZG B;  5AV5 C;  4X23 B;  3AZF C;  1P3O B;  3WTP B;  3X1T A;  2HUE B;  2Y2N A;  4YM6 A;  3WKJ C;  1F66 C;  4Z66 C;  5B1M D;  5JRG B;  3MVD B;  3B6F A;  3REI C;  2JE5 A;  1H3O A;  3TU4 A;  3AZL B;  3W96 C;  5B32 A;  3V9R B;  3AFA D;  3KXB B;  4DRB A;  3C1C A;  5B0Z D;  3MNN D;  5AV9 C;  3MGP A;  5DNM A;  2HIO D;  5CPJ D;  2G5I C;  4QLC A;  2FJ7 D;  5CPI A;  2G5H C;  4R8P A;  5GT3 D;  5B2I D;  3LJA A;  3W97 C;  2ARO A;  1KX4 D;  3REK B;  5AV6 A;  2J8P A;  2LY8 A;  5CP6 D;  3AZI D;  1T3U A;  3MGR B;  3AN2 D;  1WWI A;  5B1M B;  3AZJ C;  4WNN B;  4G92 B;  3AZH D;  4G91 C;  3X1S D;  3REL D;  3AFA B;  1P3B A;  3MGQ D;  4H9R A;  3REK C;  5B32 G;  5B0Z B;  3MGR C;  4J8V D;  3AZK C;  4HGA C;  3EPK A;  2HIO B;  3LZ0 D;  5CPJ B;  5GT3 B;  5B2I B;  4J8U B;  3A1K A;  1KX4 B;  5CPK A;  4YS3 B;  5CP6 B;  3AZI B;  5E5A A;  3AN2 B;  4WU8 C;  4H9N A;  1U35 B;  1P3G D;  3X1U C;  4LD9 D;  3UT9 D;  3AV1 D;  1P3F A;  3AZH B;  5B31 A;  2BYK A;  3B6G B;  2CWE A;  5AVB D;  3X1S B;  3REL B;  4KGC A;  3MGQ B;  4EO5 C;  4YS3 C;  1A7W A;  4J8V B;  2CV5 A;  4H9P A;  1M19 C;  3AZN D;  4KUD D;  1U35 C;  1AOI A;  3LZ0 B;  3B6G C;  5AV8 D;  3AZM C;  1S32 A;  3P5J B;  5KDM B;  4XZQ C;  4NFT A;  5GSU A;  1B6W A;  1M1A C;  2RVQ D;  1P3G B;  1P3K A;  1TZY B;  4LD9 B;  3UT9 B;  4J8W D;  2ZY3 A;  3W98 D;  4XUJ D;  5G49 A;  5AVB B;  3VH5 A;  3FDD A;  2NZD A;  3O62 D;  5B31 G;  5B33 D;  1P3M D;  1JFI B;  4KUD B;  4CAY A;  3A6N A;  3AZE C;  3AZN B;  3C1B B;  1TZY C;  3NQJ B;  3KUY A;  2F8N A;  1ID3 C;  5AV8 B;  5B2J C;  4NE6 A;  5FUG A;  2IO5 C;  5GXQ C;  1ZLA D;  3AYW C;  5GT0 A;  4Z5T D;  3LEL D;  3B0D C;  1M18 D;  3C1B C;  3F6T A;  3REH C;  4CSR A;  4J8W B;  1P3L C;  1HQ3 D;  3W98 B;  1EQZ A;  1P3A D;  4WU9 C;  4KHA B;  2PYO A;  2YFV A;  3O62 B;  2Y2L A;  5B33 B;  1P3M B;  4JJN D;  1BH8 B;  5B24 C;  4H9O A;  5AY8 D;  3VH6 W;  5F99 A;  3WA9 D;  3NQU B;  3WAA C;  5AV5 D;  1BH9 B;  1ZLA B;  3B0C W;  3X1V C;  3WKJ D;  3LEL B;  1F66 D;  4Z66 D;  5B40 C;  1M18 B;  3REI D;  3MGS A;  1HQ3 B;  3LZ1 A;  2BYM B;  1P3A B;  3W96 D;  4NE3 A;  5C3I C;  3W99 A;  3VH5 T;  4JJN B;  5B0Y A;  1KX3 A;  5AV9 D;  3KSY A;  5AVC A;  5CHL B;  5BO0 A;  1P3I A;  1P3P A;  4Z2M G;  2NQB A;  4ZUX C;  5AY8 B;  4ZBJ B;  3UTA A;  3WA9 B;  5BNV A;  5AV5 B;  5DNN C;  3KWQ A;  3AZF B;  3W97 D;  1KX5 A;  4J8X C;  5BNX A;  3WKJ B;  1F66 B;  4UUZ A;  4Z66 B;  1N1J B;  3REI B;  3AV2 A;  3AZJ D;  3UTB C;  4H9Q A;  3AL0 C;  3W96 B;  2W8S A;  4AWL C;  2JCH A;  3REK D;  3MGR D;  3AZK D;  5AV9 B;  4DRA A;  4H9S A;  3X1T B;  3REJ A;  1P34 C;  3W97 B;  4WU8 D;  4UPK A;  3TU4 B;  5B1L A;  3X1U D;  3AZG A;  3AZJ B;  1PZR A;  4X23 A;  3C1C B;  3X1T C;  2FFF B;  3WTP A;  1P3O A;  4YM6 C;  4G91 B;  3B6F C;  3A1I A;  4J8U D;  5JRG A;  3MVD A;  4YS3 D;  1M19 D;  3TU4 C;  3AZK B;  1U35 D;  1W2E A;  4HGA B;  5B32 C;  3AZL A;  3B6G D;  3C1C C;  3KXB A;  3AZM D;  3R45 B;  4XZQ D;  3MGP C;  5DNM C;  4QLC C;  5CPI C;  4WU8 B;  4R8P C;  1M1A D;  2DF4 C;  3X1U B;  1HTA A;  2ARO C; 
#chains in the Genus database with same CATH homology
 5AV6 C;  5B1M A;  4EO5 B;  3H0M C;  2JSS A;  4WNN A;  1M19 B;  3AZE D;  1P3B C;  1TZY D;  3AFA A;  1ID3 D;  5E5A B;  5B2J D;  3AZM B;  5BS7 A;  5B0Z A;  4XZQ B;  3MNN A;  5GXQ D;  3AYW D;  2ZY2 A;  5BT1 C;  2HIO A;  2BYK B;  5CPJ A;  2FJ7 A;  1M1A B;  4KGC B;  3C1B D;  3REH D;  5GT3 A;  5B2I A;  5CPK C;  1P3L D;  1KX4 A;  5E5A C;  4H9P B;  4WU9 D;  5CP6 A;  2UWX A;  3AZI A;  3AN2 A;  1P3F C;  5B31 C;  3AZE B;  3AZH A;  4KGC C;  5B24 D;  2YFW B;  3X1S A;  3REL A;  1ID3 B;  2F2A C;  3MGQ A;  2CV5 C;  5B2J B;  3EPL A;  3WAA D;  4J8V A;  1AOI C;  2IO5 B;  5GXQ B;  3AYW B;  3X1V D;  4E45 A;  3LZ0 A;  5B40 D;  3B0D B;  1S32 C;  3REH B;  3EPH A;  5KDM A;  1KU5 A;  5GSU C;  1P3L B;  4M6B A;  4WU9 B;  1P3K C;  1P3G A;  4LD9 A;  3UT9 A;  3AV1 A;  5B24 B;  1BFM A;  5AVB A;  2NZD C;  3A6N C;  3WAA B;  1JFI A;  4KUD A;  5DNN D;  3AZN A;  3KUY C;  3X1V B;  1Q9C A;  4J8X D;  5JA4 B;  5B40 B;  5AV8 A;  3UTB D;  5GT0 C;  2Y2J A;  5C3I B;  2F8N H;  2F8N G;  3AZF D;  1TAF A;  3KFU G;  4J8W A;  1EQZ C;  3W98 A;  4XUJ A;  2PYO C;  4ZUX B;  3O62 A;  1P34 D;  5B33 A;  3LJA C;  1P3M A;  1BH8 A;  5DNN B;  3VH6 A;  4J8X B;  3LZ1 B;  5F99 C;  4Z2M H;  3UTB B;  2XD5 A;  1BH9 A;  2BG1 A;  1ZLA A;  5B0Y B;  3X1T D;  1KX3 B;  4YM6 D;  2Y2P A;  4Z5T A;  3LEL A;  4AWL B;  3B6F D;  5BO0 B;  3MGS C;  1M18 A;  3LZ1 C;  3TU4 D;  1HQ3 A;  5B32 D;  2BYM A;  3W99 C;  1P3A A;  1Z2C B;  1P34 B;  2VQR A;  2Y2G A;  5B0Y C;  3C1C D;  4JJN A;  4UUZ B;  1KX3 C;  3MGP D;  5AVC C;  1P3P C;  5DNM D;  1P3I C;  2NQB C;  4QLC D;  5CPI D;  3UTA C;  4R8P D;  5AY8 A;  3H0R C;  3WA9 A;  3LJA D;  3KWQ C;  2ARO D;  5AV5 A;  1KX5 C;  5AV6 D;  4YM6 B;  3B6F B;  3WKJ A;  3AV2 C;  4Z66 A;  1F66 A;  1N1J A;  3REI A;  1H3O B;  5B32 B;  3W96 A;  1P3B D;  3MGP B;  5AV9 A;  5DNM B;  1ULY A;  4QLC B;  5BT1 D;  5CPI B;  3VH6 T;  4H9S C;  4R8P B;  3REJ C;  2Y2K A;  3H0L C;  3LJA B;  2ARO B;  3B0C T;  3V9R A;  3W97 A;  5AV6 B;  5CPK D;  5E5A D;  5B1L C;  3AZG C;  1P3F D;  5B31 D;  4X23 C;  3AZJ A;  1P3O C;  3WTP C;  4KGC D;  1F1E A;  2HUE C;  1P3B B;  5JRG C;  3EPJ A;  3MVD C;  4H9R B;  3REK A;  2CV5 D;  2Y2M A;  3MGR A;  3AZL C;  3AZK A;  1AOI D;  2Y2I A;  3IP4 C;  3KXB C;  1S32 D;  3R45 A;  5CPK B;  5GSU D;  4WJ3 C;  4H9N B;  4WU8 A;  1P3K D;  2F8N K;  1P3F B;  3X1U A;  5B31 B;  3MNN B;  2NZD D;  2Y2Q A;  5B1M C;  4J8U A;  2Y2H A;  2FJ7 B;  4G92 C;  2CV5 B;  4YS3 A;  3A6N D;  1M19 A;  1AOI B;  1U35 A;  2XD1 A;  3KUY D;  2F8N D;  2ZY5 A;  4E44 A;  3AFA C;  1R4V A;  3B6G A;  1S32 B;  4NE5 A;  5BS7 C;  5B0Z C;  3MNN C;  3AZM A;  4XZQ A;  5GSU B;  5GT0 D;  2HIO C;  5CPJ C;  2FJ7 C;  2ZY4 A;  1P3K B;  1M1A A;  5GT3 C;  5B2I C;  4J8U C;  4WZS B;  1KX4 C;  1EQZ D;  5G49 B;  5CP6 C;  3AZI C;  2PYO D;  3AN2 C;  2NZD B;  3VH5 W;  4CAY B;  3A6N B;  3AZH C;  3AZE A;  3KUY B;  3REL C;  3X1S C;  2F8N B;  1TZY A;  2YFW A;  3MGQ C;  1ID3 A;  5F99 D;  5FUG B;  4J8V C;  5B2J A;  4ZUX D;  5GXQ A;  5GT0 B;  3LZ0 C;  3AYW A;  3AV1 B;  3MGS D;  3EG5 B;  3C1B A;  4CSR B;  3WTP E;  3REH A;  3NQJ A;  3LZ1 D;  1EQZ B;  1P3L A;  2PYO B;  4WV4 B;  3W99 D;  2YFV B;  4WU9 A;  1P3G C;  3B0B A;  4LD9 C;  3UT9 C;  5B0Y D;  3AV1 C;  1KX3 D;  5AVC D;  1P3P D;  4H9O B;  5AVB C;  5B24 A;  1P3I D;  2NQB D;  4DQY B;  5F99 B;  3UTA D;  1B67 A;  2DQN C;  4KUD C;  4KHA A;  3KWQ D;  3AZN C;  3WAA A;  1KX5 D;  1TAF B;  3X1V A;  2RIQ A;  4XUJ B;  5AV8 C;  5JA4 A;  5B40 A;  3AV2 D;  3MGS B;  3W99 B;  2RVQ C;  3NQU A;  4J8W C;  3W98 C;  4XUJ C;  5AVC B;  1P3P B;  1P3I B;  2NQB B;  3O62 C;  1WWS A;  4ZUX A;  3UTA B;  3REJ D;  5B33 C;  1P3M C;  5BNV B;  4Z5T B;  3KWQ B;  1KX5 B;  5DNN A;  5BNX B;  4J8X A;  5B1L D;  3AV2 B;  3AZG D;  4H9Q B;  4X23 D;  3UTB A;  1ZLA C;  1P3O D;  3WTP D;  4Z5T C;  3LEL C;  5JRG D;  3MVD D;  1M18 C;  3AZF A;  1HQ3 C;  3AZL D;  1P3A C;  2Y2O A;  2L5A A;  3REJ B;  3KXB D;  4JJN C;  1P34 A;  2ZM5 A;  5AY8 C;  4ZBJ C;  5B1L B;  3WA9 C;  3AZG B;  5AV5 C;  4X23 B;  3AZF C;  1P3O B;  3WTP B;  3X1T A;  2HUE B;  2Y2N A;  4YM6 A;  3WKJ C;  1F66 C;  4Z66 C;  5B1M D;  5JRG B;  3MVD B;  3B6F A;  3REI C;  2JE5 A;  1H3O A;  3TU4 A;  3AZL B;  3W96 C;  5B32 A;  3V9R B;  3AFA D;  3KXB B;  4DRB A;  3C1C A;  5B0Z D;  3MNN D;  5AV9 C;  3MGP A;  5DNM A;  2HIO D;  5CPJ D;  2G5I C;  4QLC A;  2FJ7 D;  5CPI A;  2G5H C;  4R8P A;  5GT3 D;  5B2I D;  3LJA A;  3W97 C;  2ARO A;  1KX4 D;  3REK B;  5AV6 A;  2J8P A;  2LY8 A;  5CP6 D;  3AZI D;  1T3U A;  3MGR B;  3AN2 D;  1WWI A;  5B1M B;  3AZJ C;  4WNN B;  4G92 B;  3AZH D;  4G91 C;  3X1S D;  3REL D;  3AFA B;  1P3B A;  3MGQ D;  4H9R A;  3REK C;  5B32 G;  5B0Z B;  3MGR C;  4J8V D;  3AZK C;  4HGA C;  3EPK A;  2HIO B;  3LZ0 D;  5CPJ B;  5GT3 B;  5B2I B;  4J8U B;  3A1K A;  1KX4 B;  5CPK A;  4YS3 B;  5CP6 B;  3AZI B;  5E5A A;  3AN2 B;  4WU8 C;  4H9N A;  1U35 B;  1P3G D;  3X1U C;  4LD9 D;  3UT9 D;  3AV1 D;  1P3F A;  3AZH B;  5B31 A;  2BYK A;  3B6G B;  2CWE A;  5AVB D;  3X1S B;  3REL B;  4KGC A;  3MGQ B;  4EO5 C;  4YS3 C;  1A7W A;  4J8V B;  2CV5 A;  4H9P A;  1M19 C;  3AZN D;  4KUD D;  1U35 C;  1AOI A;  3LZ0 B;  3B6G C;  5AV8 D;  3AZM C;  1S32 A;  3P5J B;  5KDM B;  4XZQ C;  4NFT A;  5GSU A;  1B6W A;  1M1A C;  2RVQ D;  1P3G B;  1P3K A;  1TZY B;  4LD9 B;  3UT9 B;  4J8W D;  2ZY3 A;  3W98 D;  4XUJ D;  5G49 A;  5AVB B;  3VH5 A;  3FDD A;  2NZD A;  3O62 D;  5B31 G;  5B33 D;  1P3M D;  1JFI B;  4KUD B;  4CAY A;  3A6N A;  3AZE C;  3AZN B;  3C1B B;  1TZY C;  3NQJ B;  3KUY A;  2F8N A;  1ID3 C;  5AV8 B;  5B2J C;  4NE6 A;  5FUG A;  2IO5 C;  5GXQ C;  1ZLA D;  3AYW C;  5GT0 A;  4Z5T D;  3LEL D;  3B0D C;  1M18 D;  3C1B C;  3F6T A;  3REH C;  4CSR A;  4J8W B;  1P3L C;  1HQ3 D;  3W98 B;  1EQZ A;  1P3A D;  4WU9 C;  4KHA B;  2PYO A;  2YFV A;  3O62 B;  2Y2L A;  5B33 B;  1P3M B;  4JJN D;  1BH8 B;  5B24 C;  4H9O A;  5AY8 D;  3VH6 W;  5F99 A;  3WA9 D;  3NQU B;  3WAA C;  5AV5 D;  1BH9 B;  1ZLA B;  3B0C W;  3X1V C;  3WKJ D;  3LEL B;  1F66 D;  4Z66 D;  5B40 C;  1M18 B;  3REI D;  3MGS A;  1HQ3 B;  3LZ1 A;  2BYM B;  1P3A B;  3W96 D;  4NE3 A;  5C3I C;  3W99 A;  3VH5 T;  4JJN B;  5B0Y A;  1KX3 A;  5AV9 D;  3KSY A;  5AVC A;  5CHL B;  5BO0 A;  1P3I A;  1P3P A;  4Z2M G;  2NQB A;  4ZUX C;  5AY8 B;  4ZBJ B;  3UTA A;  3WA9 B;  5BNV A;  5AV5 B;  5DNN C;  3KWQ A;  3AZF B;  3W97 D;  1KX5 A;  4J8X C;  5BNX A;  3WKJ B;  1F66 B;  4UUZ A;  4Z66 B;  1N1J B;  3REI B;  3AV2 A;  3AZJ D;  3UTB C;  4H9Q A;  3AL0 C;  3W96 B;  2W8S A;  4AWL C;  2JCH A;  3REK D;  3MGR D;  3AZK D;  5AV9 B;  4DRA A;  4H9S A;  3X1T B;  3REJ A;  1P34 C;  3W97 B;  4WU8 D;  4UPK A;  3TU4 B;  5B1L A;  3X1U D;  3AZG A;  3AZJ B;  1PZR A;  4X23 A;  3C1C B;  3X1T C;  2FFF B;  3WTP A;  1P3O A;  4YM6 C;  4G91 B;  3B6F C;  3A1I A;  4J8U D;  5JRG A;  3MVD A;  4YS3 D;  1M19 D;  3TU4 C;  3AZK B;  1U35 D;  1W2E A;  4HGA B;  5B32 C;  3AZL A;  3B6G D;  3C1C C;  3KXB A;  3AZM D;  3R45 B;  4XZQ D;  3MGP C;  5DNM C;  4QLC C;  5CPI C;  4WU8 B;  4R8P C;  1M1A D;  2DF4 C;  3X1U B;  1HTA A;  2ARO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...