5B33B

The crystal structure of the h2az nucleosome with h3.3.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b33B00
3MGQA 4R8PB 1P3OB 1P3IB 4DRBA 1P3LD 4LD9B 4WV4B 4WU8A 3AN2C 3UTAD 5E5AA 1TZYA 1P3BC 4YS3C 4J8UB 3MGRC 5E5AD 3AZLB 3AZIB 1ID3C 4Z5TC 2CV5A 5B33A 2YFWA 3B0DB 1ZLAC 2F8NA 3KXBC 4H9SA 4NE6A 3W98D 5GXQA 2CV5D 5B33D 4KHAA 4JJNA 3AZKA 3VH5W 4QLCB 1P34B 4HGAB 4J8WB 4J8WD 2RVQC 3X1VC 5F99D 3C1BC 4M6BA 3REIA 3TU4C 1P3AA 2NZDB 2BYKA 5BNXA 3AZGB 3AZGD 1F66B 1F66D 5B2IA 3X1TC 1P3AD 4H9OB 3AZEB 2HIOB 3MVDC 3VH6A 1P3GC 3AZFA 1P3BB 3LZ1C 4YS3B 4YS3D 4CAYA 5CPIA 3MNNC 3REHA 5GT0A 3LJAC 3MGRB 3AFAA 5DNNA 1ID3B 2FJ7B 5CPID 1M18D 4Z5TB 2FJ7D 4Z5TD 5AVCD 3NQJB 3REHD 5GT0D 1JFIA 3KXBB 3WA9C 3AFAD 5DNND 4J8XC 1BH8A 4G91C 4J8VA 1KX4A 5DNMA 1U35C 5AY8D 4J8VD 1KX4D 5JRGC 3X1VB 5B31C 5B31G 4X23C 3C1BB 2IO5C 3REKA 1EQZC 3VH5T 1P3MC 3X1UA 3AZMC 3KUYD 3MVDB 3REJA 3AYWA 5B24C 5B32C 4NFTA 5B32G 3LZ1B 1KX5D 5AV8B 5AV8D 3AYWD 1HQ3A 1P3FD 4YM6A 4EO5C 3LJAB 5FUGB 1KX3B 3C1CA 1KX3D 5B1MA 1TAFB 5AVBA 3X1SC 3MGPD 1HQ3D 2BYMA 3AZJD 5B2JA 4YM6D 2F8NH 3WA9B 1AOIA 5B1MD 4J8XB 3R45B 3B6GA 4G91B 3UTBC 3WTPC 1P3KA 2CWEA 3UT9A 1AOID 5B0YC 3WKJC 2NQBA 5B1LC 2AROA 3W97C 1U35B 1M1AA 1A7WA 1P3KD 5JRGB 3LZ0A 5B31B 4WNNB 3UT9D 1P3PC 2NQBD 4X23B 5G49B 4G92C 4WU8C 2IO5B 4XUJA 1BFMA 1TZYC 1N1JA 3MGSA 1EQZB 3A6NA 1P3MB 5B40C 4R8PA 1P3OA 1ULYA 4XUJD 1P3IA 1P3LA 3AZMB 4LD9A 3LELD 3UTAA 5AV6B 3A6ND 5AV6D 2YFVB 4KUDC 2F8NG 3AV1C 5B24B 5B32B 4H9SC 4R8PD 1P3OD 1P3ID 4J8UA 3AZHC 4LD9D 5CHLB 5GXQC 3AZLA 4ZUXC 5BT1C 4JJNC 3AZKC 4J8UD 4EO5B 3WAAC 4H9PB 4H9NB 3AZLD 3W98A 5CP6C 3AZID 3X1SB 3AV2B 3AV2D 5GT3C 3REIC 4QLCA 4CSRB 4J8WA 3WTPB 3UTBB 5B0YB 3KWQC 3WKJB 3W96C 5B1LB 5B1LD 5F99A 5B2IC 4KGCC 3W97B 4QLCD 1P34D 1M19C 1Q9CA 1P3PB 1P3PD 2NZDA 4WU8B 4G92B 3AZGA 3AZFC 1F66A 1TZYB 4H9OA 3AZEA 1WWIA 2NZDD 5AV5C 5B40B 5B40D 1HTAA 3AZED 2HUEB 2HIOD 4KUDB 1P3BA 2F8NB 4YS3A 3AV1B 4KUDD 3AV1D 3O62C 3AZHB 3AZHD 4Z66C 3AN2B 5GXQB 3AN2D 5CPJC 3MGRA 4ZUXB 4ZUXD 1R4VA 1P3BD 1ID3A 1M18A 2FJ7A 4Z5TA 5DNMC 5AVCA 3NQJA 3B6FC 3WAAB 2F8NK 4DRAA 3KXBA 5B0ZC 2JSSA 4Z2MH 3MGRD 1B6WA 5CP6B 3W99C 1ID3D 4XZQC 1ZLAB 1ZLAD 4WU9C 5GT3B 3KXBD 4H9RB 3REIB 3RELC 3REKC 4ZBJC 1S32C 2L5AA 5AY8A 3KWQB 5B2IB 3X1UC 3X1VA 3W96B 4KGCB 1H3OB 1M19B 3REJC 2RVQD 5KDMB 3X1VD 4WZSB 3C1BD 3NQUB 1B67A 3TU4B 3KUYA 3TU4D 3MVDA 5AV5B 5AV9C 4AWLC 4H9QA 3C1CC 3X1TB 3X1TD 5CPKC 5BO0B 5B2JC 3MVDD 3LZ1A 1KX5A 5AV8A 5BNVB 3O62B 3O62D 4UUZB 5GSUC 1P3FA 4Z66B 1P3GB 5CPJB 1P3GD 5CPJD 1KX3A 3B6GC 1TAFA 3LZ1D 3AZNC 3MGPA 5DNMB 3KSYA 3AZJA 5BS7C 3MNNB 3MNND 3B6FB 3LJAD 5B0ZB 3WA9A 5B0ZD 3B0CW 3R45A 3W99B 4XZQB 3LZ0C 4E44A 4WU9B 3WA9D 3RELB 2PYOC 4J8XD 1S32B 1U35A 3X1UB 5JRGA 5B31A 4WNNA 1P3LC 5G49A 3UTAC 1U35D 3MGQC 3REJB 5JRGD 5B31D 4X23D 1P3MA 5E5AC 3LELA 3AZMA 1EQZD 5AV6A 5AV9B 5C3IC 4AWLB 1P3MD 5B24A 5B32A 5CPKB 3V9RB 3W98C 3AZMD 2LY8A 2CV5C 5B2JB 5B33C 3VH5A 5B24D 5B32D 5GSUB 1BH9B 5GSUD 3B6GB 4H9NA 4J8WC 3AZIA 3AV2A 3X1SA 3AZNB 3AZND 5F99C 3X1SD 5JA4B 3LZ0B 4CSRA 3UTBA 3AZGC 4NE5A 3WKJA 5B1LA 2PYOB 4E45A 1P3AC 1P34A 3UTBD 3WTPD 1P3LB 5B0YD 3B0CT 1P3PA 3WKJD 3UTAB 3W97D 3MGQB 3MGQD 5B40A 4WU8D 5E5AB 1TZYD 5CPIC 1M18C 2FJ7C 5AVCC 2HIOA 5C3IB 3REHC 4KUDA 5GT0C 3AV1A 3AFAC 5DNNC 3W98B 3AZHA 3AN2A 2CV5B 5B33B 2YFWB 4ZUXA 2F8ND 3WAAA 5GXQD 5AY8C 5BT1D 5CP6A 4KHAB 4JJNB 4J8VC 4JJND 1KX4C 3AZKB 5F99B 3AZKD 1ZLAA 3WAAD 5GT3A 4H9RA 5CP6D 5GT3D 3KWQA 3W96A 3REID 3KUYC 1P3AB 4KGCA 2BYKB 1H3OA 5BNXB 1M19A 3KWQD 5KDMA 5B2ID 3W96D 3AZEC 4KGCD 3C1BA 3NQUA 1KX5C 5AV8C 3TU4A 1M19D 3AYWC 1P3FC 5AV5A 1KX3C 3AZFB 3AZFD 3X1TA 1F1EA 4CAYB 5CPIB 1M18B 5AVCB 1HQ3C 3MGPC 3AZJC 1KU5A 5BO0A 4YM6C 3REHB 5GT0B 5AV5D 5BNVA 3O62A 5DNNB 5B1MC 4UUZA 4Z2MG 5AVBC 3AFAB 4Z66A 1P3GA 5CPJA 1JFIB 1AOIC 3MNNA 3B6FA 3LJAA 4Z66D 5FUGA 5B0ZA 1BH8B 5AY8B 3VH6W 4J8VB 1KX4B 1P3KC 3UT9C 3W99A 4XZQA 5DNMD 2NQBC 3B6FD 4WU9A 2AROC 4J8XA 3RELA 1M1AC 3W99D 1S32A 4XZQD 4WU9D 4XUJC 3MGSC 3LELC 3REKB 3KUYB 3REKD 3RELD 4ZBJB 3A6NC 1S32D 5AV6C 4H9QB 4R8PC 1P3OC 3X1UD 1P3IC 4LD9C 4X23A 1KX5B 3REJD 3AYWB 1EQZA 1P3FB 3B0BA 4J8UC 5AV9A 3AZLC 3V9RA 5CPKA 3AZIC 3AV2C 3MGPB 1HQ3B 3AZJB 4YM6B 2YFVA 3B0DC 5AV9D 3C1CB 3C1CD 5B1MB 5GSUA 1BH9A 5AVBB 5AVBD 5CPKD 2BYMB 4NE3A 5B2JD 3AZNA 1AOIB 5BS7A 3B6GD 4H9PA 4QLCC 1P34C 4HGAC 3WTPE 1P3KB 3UT9B 5JA4A 2NQBB 2AROB 2AROD 2PYOA 1M1AB 1M1AD 3LZ0D 2NZDC 3WTPA 4XUJB 5B0YA 3MGSB 1N1JB 3LELB 3MGSD 1F66C 2PYOD 1WWSA 3VH6T 3A6NB 3W97A 2HIOC 2HUEC
chains in the Genus database with same CATH superfamily
3MGQA 4R8PB 1P3OB 1P3IB 4DRBA 1P3LD 4LD9B 4WV4B 4WU8A 3AN2C 3UTAD 5E5AA 1TZYA 1P3BC 4YS3C 4J8UB 3MGRC 5E5AD 3AZLB 3AZIB 1ID3C 4Z5TC 2CV5A 5B33A 2YFWA 3B0DB 1ZLAC 2F8NA 3KXBC 4H9SA 3F6TA 4NE6A 3W98D 5GXQA 2CV5D 5B33D 4KHAA 4JJNA 3AZKA 3VH5W 4QLCB 1P34B 4DQYB 4HGAB 4J8WB 4J8WD 2RVQC 3X1VC 5F99D 3C1BC 3P5JB 4M6BA 3REIA 3TU4C 1P3AA 2NZDB 2BYKA 5BNXA 3AZGB 3AZGD 3FDDA 1F66B 1F66D 5B2IA 3X1TC 1P3AD 3A1KA 4H9OB 3AZEB 2HIOB 3MVDC 2ZM5A 3VH6A 1P3GC 2F2AC 3AZFA 2Y2IA 2DQNC 1P3BB 3LZ1C 4YS3B 4YS3D 4CAYA 5CPIA 3MNNC 3REHA 5GT0A 3LJAC 3MGRB 3AFAA 5DNNA 1ID3B 2FJ7B 5CPID 1M18D 4Z5TB 2FJ7D 4Z5TD 5AVCD 3NQJB 3REHD 5GT0D 1JFIA 3KXBB 3WA9C 3AFAD 5DNND 4J8XC 1BH8A 4G91C 4J8VA 1KX4A 5DNMA 1U35C 5AY8D 4J8VD 1KX4D 5JRGC 3X1VB 5B31C 5B31G 4X23C 3C1BB 2IO5C 3REKA 1EQZC 3VH5T 1P3MC 3X1UA 3AZMC 3KUYD 3MVDB 3REJA 3AYWA 5B24C 5B32C 4NFTA 5B32G 2Y2KA 3LZ1B 1KX5D 5AV8B 5AV8D 3AYWD 1HQ3A 1P3FD 4YM6A 4EO5C 3LJAB 5FUGB 1KX3B 3C1CA 1KX3D 5B1MA 1TAFB 5AVBA 3X1SC 3MGPD 1HQ3D 2BYMA 3AZJD 5B2JA 4YM6D 2F8NH 3WA9B 1AOIA 3EPHA 5B1MD 3EPLA 4J8XB 3R45B 3B6GA 4G91B 3UTBC 3WTPC 1P3KA 2CWEA 3UT9A 1AOID 5B0YC 3WKJC 2NQBA 5B1LC 2J8PA 2BG1A 2AROA 3W97C 1U35B 1M1AA 1A7WA 1P3KD 5JRGB 3LZ0A 5B31B 4WNNB 3UT9D 1P3PC 2NQBD 4X23B 5G49B 4G92C 4WU8C 2IO5B 4XUJA 1BFMA 1TZYC 1N1JA 3MGSA 1EQZB 3A6NA 1P3MB 5B40C 4R8PA 1P3OA 1ULYA 4XUJD 1P3IA 1P3LA 2ZY5A 3AZMB 4LD9A 3LELD 3UTAA 5AV6B 3A6ND 5AV6D 2YFVB 4KUDC 2F8NG 3AV1C 5B24B 5B32B 4H9SC 4R8PD 1P3OD 1P3ID 4J8UA 3AZHC 4LD9D 5CHLB 5GXQC 3AZLA 4ZUXC 5BT1C 4JJNC 3H0LC 3AZKC 4J8UD 4UPKA 4EO5B 3WAAC 4H9PB 4H9NB 3AZLD 3W98A 5CP6C 3AZID 3X1SB 3AV2B 3AV2D 5GT3C 3REIC 4QLCA 4CSRB 4J8WA 3WTPB 3UTBB 5B0YB 3KWQC 3WKJB 3W96C 5B1LB 5B1LD 5F99A 5B2IC 4KGCC 3W97B 4QLCD 1P34D 1M19C 1Q9CA 2Y2PA 1P3PB 1P3PD 2NZDA 4WU8B 4G92B 3AZGA 3AZFC 1F66A 1TZYB 2ZY3A 4H9OA 3AZEA 1WWIA 2NZDD 5AV5C 5B40B 5B40D 2JE5A 1HTAA 3A1IA 3AZED 2HUEB 2HIOD 4KUDB 1P3BA 2F8NB 4YS3A 3AV1B 4KUDD 3AV1D 3O62C 2FFFB 3AZHB 3AZHD 2Y2MA 4Z66C 3AN2B 5GXQB 3AN2D 5CPJC 3MGRA 1T3UA 4ZUXB 4ZUXD 1R4VA 1P3BD 1ID3A 1M18A 2FJ7A 4Z5TA 5DNMC 5AVCA 3NQJA 3B6FC 2XD5A 2F8NK 4DRAA 3WAAB 2RIQA 5B0ZC 3KXBA 2JSSA 4Z2MH 3MGRD 1B6WA 5CP6B 3W99C 1ID3D 4XZQC 1ZLAB 1ZLAD 4WU9C 5GT3B 3KXBD 4H9RB 3REIB 3RELC 3REKC 4ZBJC 1S32C 2L5AA 5AY8A 3KWQB 5B2IB 3X1UC 3X1VA 3W96B 2Y2GA 4KGCB 1H3OB 1M19B 3REJC 2RVQD 2W8SA 5KDMB 3X1VD 4WZSB 3C1BD 3H0RC 1B67A 3NQUB 3TU4B 3KUYA 3TU4D 3MVDA 5AV5B 5AV9C 4AWLC 4H9QA 3C1CC 3X1TB 3X1TD 5CPKC 2G5IC 5BO0B 2ZY4A 5B2JC 3LZ1A 3MVDD 5AV8A 1KX5A 5BNVB 3O62B 3O62D 4UUZB 2UWXA 5GSUC 1P3FA 4Z66B 1P3GB 5CPJB 1P3GD 5CPJD 1KX3A 3B6GC 1TAFA 3LZ1D 3AZNC 3MGPA 5DNMB 3KSYA 3AZJA 5BS7C 3MNNB 3MNND 3B6FB 3LJAD 5B0ZB 3WA9A 5B0ZD 3B0CW 3R45A 3W99B 4XZQB 3LZ0C 4E44A 4WU9B 2DF4C 3WA9D 3RELB 2PYOC 4J8XD 1S32B 1U35A 3X1UB 2Y2LA 5B31A 4WNNA 5JRGA 1P3LC 5G49A 3UTAC 3EPJA 1U35D 3MGQC 3REJB 5JRGD 5B31D 2Y2JA 4X23D 1P3MA 2JCHA 5E5AC 3LELA 3AZMA 1EQZD 5AV6A 5AV9B 5C3IC 4AWLB 1P3MD 1Z2CB 5B24A 5B32A 5CPKB 3V9RB 3W98C 3AZMD 2LY8A 2CV5C 5B2JB 5B33C 2Y2HA 3VH5A 5B24D 5B32D 5GSUB 1BH9B 5GSUD 3B6GB 4H9NA 4J8WC 3AZIA 3AV2A 3X1SA 3AZNB 3AZND 5F99C 3X1SD 5JA4B 3LZ0B 4CSRA 3UTBA 3AZGC 4NE5A 3WKJA 5B1LA 2PYOB 4E45A 1P3AC 1W2EA 1P34A 3UTBD 3WTPD 1P3LB 5B0YD 3B0CT 1P3PA 3WKJD 3UTAB 3W97D 3MGQB 3MGQD 2ZY2A 5B40A 4WU8D 5E5AB 1TZYD 5CPIC 1M18C 2FJ7C 5AVCC 2HIOA 5C3IB 3REHC 4KUDA 5GT0C 3AV1A 3AFAC 5DNNC 3W98B 3AZHA 2Y2OA 3AN2A 2CV5B 5B33B 2YFWB 4ZUXA 2F8ND 3KFUG 2XD1A 3WAAA 5GXQD 5AY8C 5BT1D 5CP6A 2G5HC 4KHAB 4JJNB 4J8VC 4JJND 1KX4C 3AZKB 5F99B 3EG5B 3AZKD 1ZLAA 3WAAD 3AL0C 5GT3A 3IP4C 4H9RA 5CP6D 5GT3D 3KWQA 3W96A 3REID 3KUYC 1P3AB 4KGCA 2BYKB 1H3OA 5BNXB 1M19A 3KWQD 5KDMA 5B2ID 3W96D 3AZEC 4KGCD 3C1BA 3NQUA 1KX5C 5AV8C 3TU4A 1M19D 3AYWC 3EPKA 1P3FC 2Y2QA 5AV5A 1KX3C 3AZFB 3AZFD 3X1TA 1F1EA 4CAYB 5CPIB 1M18B 5AVCB 1HQ3C 3MGPC 3AZJC 1KU5A 5BO0A 4YM6C 3REHB 5GT0B 5AV5D 5BNVA 3O62A 5DNNB 5B1MC 4UUZA 4Z2MG 5AVBC 3AFAB 4Z66A 1P3GA 5CPJA 1PZRA 1JFIB 1AOIC 3MNNA 3B6FA 3LJAA 4Z66D 5FUGA 5B0ZA 4WJ3C 1BH8B 5AY8B 3VH6W 4J8VB 1KX4B 1P3KC 3UT9C 3W99A 4XZQA 5DNMD 2NQBC 3B6FD 4WU9A 2AROC 2VQRA 4J8XA 3RELA 1M1AC 3W99D 1S32A 4XZQD 4WU9D 4XUJC 3MGSC 3H0MC 3LELC 3REKB 3KUYB 3REKD 3RELD 4ZBJB 3A6NC 1S32D 5AV6C 4H9QB 4R8PC 1P3OC 3X1UD 1P3IC 4LD9C 4X23A 1KX5B 3REJD 3AYWB 1EQZA 1P3FB 3B0BA 4J8UC 5AV9A 3AZLC 3V9RA 5CPKA 3AZIC 3AV2C 3MGPB 1HQ3B 3AZJB 4YM6B 2YFVA 3B0DC 5AV9D 3C1CB 3C1CD 5B1MB 5GSUA 1BH9A 5AVBB 5AVBD 5CPKD 2BYMB 4NE3A 5B2JD 3AZNA 1AOIB 5BS7A 3B6GD 4H9PA 4QLCC 1P34C 4HGAC 3WTPE 1P3KB 3UT9B 5JA4A 2NQBB 2Y2NA 2AROB 2AROD 2PYOA 1M1AB 1M1AD 3LZ0D 2NZDC 3WTPA 4XUJB 5B0YA 3MGSB 1N1JB 3LELB 3MGSD 1F66C 2PYOD 1WWSA 3VH6T 3A6NB 3W97A 2HIOC 2HUEC
chains in the Genus database with same CATH topology
3MGQA 4R8PB 1P3OB 1P3IB 4DRBA 1P3LD 4LD9B 4WV4B 4WU8A 3AN2C 3UTAD 5E5AA 1TZYA 1P3BC 4YS3C 4J8UB 3MGRC 5E5AD 3AZLB 3AZIB 1ID3C 4Z5TC 2CV5A 5B33A 2YFWA 3B0DB 1ZLAC 2F8NA 3KXBC 4H9SA 3F6TA 4NE6A 3W98D 5GXQA 2CV5D 5B33D 4KHAA 4JJNA 3AZKA 3VH5W 4QLCB 1P34B 4DQYB 4HGAB 4J8WB 4J8WD 2RVQC 3X1VC 5F99D 3C1BC 3P5JB 4M6BA 3REIA 3TU4C 1P3AA 2NZDB 2BYKA 5BNXA 3AZGB 3AZGD 3FDDA 1F66B 1F66D 5B2IA 3X1TC 1P3AD 3A1KA 4H9OB 3AZEB 2HIOB 3MVDC 2ZM5A 3VH6A 1P3GC 2F2AC 3AZFA 2Y2IA 2DQNC 1P3BB 3LZ1C 4YS3B 4YS3D 4CAYA 5CPIA 3MNNC 3REHA 5GT0A 3LJAC 3MGRB 3AFAA 5DNNA 1ID3B 2FJ7B 5CPID 1M18D 4Z5TB 2FJ7D 4Z5TD 5AVCD 3NQJB 3REHD 5GT0D 1JFIA 3KXBB 3WA9C 3AFAD 5DNND 4J8XC 1BH8A 4G91C 4J8VA 1KX4A 5DNMA 1U35C 5AY8D 4J8VD 1KX4D 5JRGC 3X1VB 5B31C 5B31G 4X23C 3C1BB 2IO5C 3REKA 1EQZC 3VH5T 1P3MC 3X1UA 3AZMC 3KUYD 3MVDB 3REJA 3AYWA 5B24C 5B32C 4NFTA 5B32G 2Y2KA 3LZ1B 1KX5D 5AV8B 5AV8D 3AYWD 1HQ3A 1P3FD 4YM6A 4EO5C 3LJAB 5FUGB 1KX3B 3C1CA 1KX3D 5B1MA 1TAFB 5AVBA 3X1SC 3MGPD 1HQ3D 2BYMA 3AZJD 5B2JA 4YM6D 2F8NH 3WA9B 1AOIA 3EPHA 5B1MD 3EPLA 4J8XB 3R45B 3B6GA 4G91B 3UTBC 3WTPC 1P3KA 2CWEA 3UT9A 1AOID 5B0YC 3WKJC 2NQBA 5B1LC 2J8PA 2BG1A 2AROA 3W97C 1U35B 1M1AA 1A7WA 1P3KD 5JRGB 3LZ0A 5B31B 4WNNB 3UT9D 1P3PC 2NQBD 4X23B 5G49B 4G92C 4WU8C 2IO5B 4XUJA 1BFMA 1TZYC 1N1JA 3MGSA 1EQZB 3A6NA 1P3MB 5B40C 4R8PA 1P3OA 1ULYA 4XUJD 1P3IA 1P3LA 2ZY5A 3AZMB 4LD9A 3LELD 3UTAA 5AV6B 3A6ND 5AV6D 2YFVB 4KUDC 2F8NG 3AV1C 5B24B 5B32B 4H9SC 4R8PD 1P3OD 1P3ID 4J8UA 3AZHC 4LD9D 5CHLB 5GXQC 3AZLA 4ZUXC 5BT1C 4JJNC 3H0LC 3AZKC 4J8UD 4UPKA 4EO5B 3WAAC 4H9PB 4H9NB 3AZLD 3W98A 5CP6C 3AZID 3X1SB 3AV2B 3AV2D 5GT3C 3REIC 4QLCA 4CSRB 4J8WA 3WTPB 3UTBB 5B0YB 3KWQC 3WKJB 3W96C 5B1LB 5B1LD 5F99A 5B2IC 4KGCC 3W97B 4QLCD 1P34D 1M19C 1Q9CA 2Y2PA 1P3PB 1P3PD 2NZDA 4WU8B 4G92B 3AZGA 3AZFC 1F66A 1TZYB 2ZY3A 4H9OA 3AZEA 1WWIA 2NZDD 5AV5C 5B40B 5B40D 2JE5A 1HTAA 3A1IA 3AZED 2HUEB 2HIOD 4KUDB 1P3BA 2F8NB 4YS3A 3AV1B 4KUDD 3AV1D 3O62C 2FFFB 3AZHB 3AZHD 2Y2MA 4Z66C 3AN2B 5GXQB 3AN2D 5CPJC 3MGRA 1T3UA 4ZUXB 4ZUXD 1R4VA 1P3BD 1ID3A 1M18A 2FJ7A 4Z5TA 5DNMC 5AVCA 3NQJA 3B6FC 2XD5A 2F8NK 4DRAA 3WAAB 2RIQA 5B0ZC 3KXBA 2JSSA 4Z2MH 3MGRD 1B6WA 5CP6B 3W99C 1ID3D 4XZQC 1ZLAB 1ZLAD 4WU9C 5GT3B 3KXBD 4H9RB 3REIB 3RELC 3REKC 4ZBJC 1S32C 2L5AA 5AY8A 3KWQB 5B2IB 3X1UC 3X1VA 3W96B 2Y2GA 4KGCB 1H3OB 1M19B 3REJC 2RVQD 2W8SA 5KDMB 3X1VD 4WZSB 3C1BD 3H0RC 1B67A 3NQUB 3TU4B 3KUYA 3TU4D 3MVDA 5AV5B 5AV9C 4AWLC 4H9QA 3C1CC 3X1TB 3X1TD 5CPKC 2G5IC 5BO0B 2ZY4A 5B2JC 3LZ1A 3MVDD 5AV8A 1KX5A 5BNVB 3O62B 3O62D 4UUZB 2UWXA 5GSUC 1P3FA 4Z66B 1P3GB 5CPJB 1P3GD 5CPJD 1KX3A 3B6GC 1TAFA 3LZ1D 3AZNC 3MGPA 5DNMB 3KSYA 3AZJA 5BS7C 3MNNB 3MNND 3B6FB 3LJAD 5B0ZB 3WA9A 5B0ZD 3B0CW 3R45A 3W99B 4XZQB 3LZ0C 4E44A 4WU9B 2DF4C 3WA9D 3RELB 2PYOC 4J8XD 1S32B 1U35A 3X1UB 2Y2LA 5B31A 4WNNA 5JRGA 1P3LC 5G49A 3UTAC 3EPJA 1U35D 3MGQC 3REJB 5JRGD 5B31D 2Y2JA 4X23D 1P3MA 2JCHA 5E5AC 3LELA 3AZMA 1EQZD 5AV6A 5AV9B 5C3IC 4AWLB 1P3MD 1Z2CB 5B24A 5B32A 5CPKB 3V9RB 3W98C 3AZMD 2LY8A 2CV5C 5B2JB 5B33C 2Y2HA 3VH5A 5B24D 5B32D 5GSUB 1BH9B 5GSUD 3B6GB 4H9NA 4J8WC 3AZIA 3AV2A 3X1SA 3AZNB 3AZND 5F99C 3X1SD 5JA4B 3LZ0B 4CSRA 3UTBA 3AZGC 4NE5A 3WKJA 5B1LA 2PYOB 4E45A 1P3AC 1W2EA 1P34A 3UTBD 3WTPD 1P3LB 5B0YD 3B0CT 1P3PA 3WKJD 3UTAB 3W97D 3MGQB 3MGQD 2ZY2A 5B40A 4WU8D 5E5AB 1TZYD 5CPIC 1M18C 2FJ7C 5AVCC 2HIOA 5C3IB 3REHC 4KUDA 5GT0C 3AV1A 3AFAC 5DNNC 3W98B 3AZHA 2Y2OA 3AN2A 2CV5B 5B33B 2YFWB 4ZUXA 2F8ND 3KFUG 2XD1A 3WAAA 5GXQD 5AY8C 5BT1D 5CP6A 2G5HC 4KHAB 4JJNB 4J8VC 4JJND 1KX4C 3AZKB 5F99B 3EG5B 3AZKD 1ZLAA 3WAAD 3AL0C 5GT3A 3IP4C 4H9RA 5CP6D 5GT3D 3KWQA 3W96A 3REID 3KUYC 1P3AB 4KGCA 2BYKB 1H3OA 5BNXB 1M19A 3KWQD 5KDMA 5B2ID 3W96D 3AZEC 4KGCD 3C1BA 3NQUA 1KX5C 5AV8C 3TU4A 1M19D 3AYWC 3EPKA 1P3FC 2Y2QA 5AV5A 1KX3C 3AZFB 3AZFD 3X1TA 1F1EA 4CAYB 5CPIB 1M18B 5AVCB 1HQ3C 3MGPC 3AZJC 1KU5A 5BO0A 4YM6C 3REHB 5GT0B 5AV5D 5BNVA 3O62A 5DNNB 5B1MC 4UUZA 4Z2MG 5AVBC 3AFAB 4Z66A 1P3GA 5CPJA 1PZRA 1JFIB 1AOIC 3MNNA 3B6FA 3LJAA 4Z66D 5FUGA 5B0ZA 4WJ3C 1BH8B 5AY8B 3VH6W 4J8VB 1KX4B 1P3KC 3UT9C 3W99A 4XZQA 5DNMD 2NQBC 3B6FD 4WU9A 2AROC 2VQRA 4J8XA 3RELA 1M1AC 3W99D 1S32A 4XZQD 4WU9D 4XUJC 3MGSC 3H0MC 3LELC 3REKB 3KUYB 3REKD 3RELD 4ZBJB 3A6NC 1S32D 5AV6C 4H9QB 4R8PC 1P3OC 3X1UD 1P3IC 4LD9C 4X23A 1KX5B 3REJD 3AYWB 1EQZA 1P3FB 3B0BA 4J8UC 5AV9A 3AZLC 3V9RA 5CPKA 3AZIC 3AV2C 3MGPB 1HQ3B 3AZJB 4YM6B 2YFVA 3B0DC 5AV9D 3C1CB 3C1CD 5B1MB 5GSUA 1BH9A 5AVBB 5AVBD 5CPKD 2BYMB 4NE3A 5B2JD 3AZNA 1AOIB 5BS7A 3B6GD 4H9PA 4QLCC 1P34C 4HGAC 3WTPE 1P3KB 3UT9B 5JA4A 2NQBB 2Y2NA 2AROB 2AROD 2PYOA 1M1AB 1M1AD 3LZ0D 2NZDC 3WTPA 4XUJB 5B0YA 3MGSB 1N1JB 3LELB 3MGSD 1F66C 2PYOD 1WWSA 3VH6T 3A6NB 3W97A 2HIOC 2HUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ A;  4R8P B;  1P3O B;  1P3I B;  4DRB A;  1P3L D;  4LD9 B;  4WV4 B;  4WU8 A;  3AN2 C;  3UTA D;  5E5A A;  1TZY A;  1P3B C;  4YS3 C;  4J8U B;  3MGR C;  5E5A D;  3AZL B;  3AZI B;  1ID3 C;  4Z5T C;  2CV5 A;  5B33 A;  2YFW A;  3B0D B;  1ZLA C;  2F8N A;  3KXB C;  4H9S A;  4NE6 A;  3W98 D;  5GXQ A;  2CV5 D;  5B33 D;  4KHA A;  4JJN A;  3AZK A;  3VH5 W;  4QLC B;  1P34 B;  4HGA B;  4J8W B;  4J8W D;  2RVQ C;  3X1V C;  5F99 D;  3C1B C;  4M6B A;  3REI A;  3TU4 C;  1P3A A;  2NZD B;  2BYK A;  5BNX A;  3AZG B;  3AZG D;  1F66 B;  1F66 D;  5B2I A;  3X1T C;  1P3A D;  4H9O B;  3AZE B;  2HIO B;  3MVD C;  3VH6 A;  1P3G C;  3AZF A;  1P3B B;  3LZ1 C;  4YS3 B;  4YS3 D;  4CAY A;  5CPI A;  3MNN C;  3REH A;  5GT0 A;  3LJA C;  3MGR B;  3AFA A;  5DNN A;  1ID3 B;  2FJ7 B;  5CPI D;  1M18 D;  4Z5T B;  2FJ7 D;  4Z5T D;  5AVC D;  3NQJ B;  3REH D;  5GT0 D;  1JFI A;  3KXB B;  3WA9 C;  3AFA D;  5DNN D;  4J8X C;  1BH8 A;  4G91 C;  4J8V A;  1KX4 A;  5DNM A;  1U35 C;  5AY8 D;  4J8V D;  1KX4 D;  5JRG C;  3X1V B;  5B31 C;  5B31 G;  4X23 C;  3C1B B;  2IO5 C;  3REK A;  1EQZ C;  3VH5 T;  1P3M C;  3X1U A;  3AZM C;  3KUY D;  3MVD B;  3REJ A;  3AYW A;  5B24 C;  5B32 C;  4NFT A;  5B32 G;  3LZ1 B;  1KX5 D;  5AV8 B;  5AV8 D;  3AYW D;  1HQ3 A;  1P3F D;  4YM6 A;  4EO5 C;  3LJA B;  5FUG B;  1KX3 B;  3C1C A;  1KX3 D;  5B1M A;  1TAF B;  5AVB A;  3X1S C;  3MGP D;  1HQ3 D;  2BYM A;  3AZJ D;  5B2J A;  4YM6 D;  2F8N H;  3WA9 B;  1AOI A;  5B1M D;  4J8X B;  3R45 B;  3B6G A;  4G91 B;  3UTB C;  3WTP C;  1P3K A;  2CWE A;  3UT9 A;  1AOI D;  5B0Y C;  3WKJ C;  2NQB A;  5B1L C;  2ARO A;  3W97 C;  1U35 B;  1M1A A;  1A7W A;  1P3K D;  5JRG B;  3LZ0 A;  5B31 B;  4WNN B;  3UT9 D;  1P3P C;  2NQB D;  4X23 B;  5G49 B;  4G92 C;  4WU8 C;  2IO5 B;  4XUJ A;  1BFM A;  1TZY C;  1N1J A;  3MGS A;  1EQZ B;  3A6N A;  1P3M B;  5B40 C;  4R8P A;  1P3O A;  1ULY A;  4XUJ D;  1P3I A;  1P3L A;  3AZM B;  4LD9 A;  3LEL D;  3UTA A;  5AV6 B;  3A6N D;  5AV6 D;  2YFV B;  4KUD C;  2F8N G;  3AV1 C;  5B24 B;  5B32 B;  4H9S C;  4R8P D;  1P3O D;  1P3I D;  4J8U A;  3AZH C;  4LD9 D;  5CHL B;  5GXQ C;  3AZL A;  4ZUX C;  5BT1 C;  4JJN C;  3AZK C;  4J8U D;  4EO5 B;  3WAA C;  4H9P B;  4H9N B;  3AZL D;  3W98 A;  5CP6 C;  3AZI D;  3X1S B;  3AV2 B;  3AV2 D;  5GT3 C;  3REI C;  4QLC A;  4CSR B;  4J8W A;  3WTP B;  3UTB B;  5B0Y B;  3KWQ C;  3WKJ B;  3W96 C;  5B1L B;  5B1L D;  5F99 A;  5B2I C;  4KGC C;  3W97 B;  4QLC D;  1P34 D;  1M19 C;  1Q9C A;  1P3P B;  1P3P D;  2NZD A;  4WU8 B;  4G92 B;  3AZG A;  3AZF C;  1F66 A;  1TZY B;  4H9O A;  3AZE A;  1WWI A;  2NZD D;  5AV5 C;  5B40 B;  5B40 D;  1HTA A;  3AZE D;  2HUE B;  2HIO D;  4KUD B;  1P3B A;  2F8N B;  4YS3 A;  3AV1 B;  4KUD D;  3AV1 D;  3O62 C;  3AZH B;  3AZH D;  4Z66 C;  3AN2 B;  5GXQ B;  3AN2 D;  5CPJ C;  3MGR A;  4ZUX B;  4ZUX D;  1R4V A;  1P3B D;  1ID3 A;  1M18 A;  2FJ7 A;  4Z5T A;  5DNM C;  5AVC A;  3NQJ A;  3B6F C;  3WAA B;  2F8N K;  4DRA A;  3KXB A;  5B0Z C;  2JSS A;  4Z2M H;  3MGR D;  1B6W A;  5CP6 B;  3W99 C;  1ID3 D;  4XZQ C;  1ZLA B;  1ZLA D;  4WU9 C;  5GT3 B;  3KXB D;  4H9R B;  3REI B;  3REL C;  3REK C;  4ZBJ C;  1S32 C;  2L5A A;  5AY8 A;  3KWQ B;  5B2I B;  3X1U C;  3X1V A;  3W96 B;  4KGC B;  1H3O B;  1M19 B;  3REJ C;  2RVQ D;  5KDM B;  3X1V D;  4WZS B;  3C1B D;  3NQU B;  1B67 A;  3TU4 B;  3KUY A;  3TU4 D;  3MVD A;  5AV5 B;  5AV9 C;  4AWL C;  4H9Q A;  3C1C C;  3X1T B;  3X1T D;  5CPK C;  5BO0 B;  5B2J C;  3MVD D;  3LZ1 A;  1KX5 A;  5AV8 A;  5BNV B;  3O62 B;  3O62 D;  4UUZ B;  5GSU C;  1P3F A;  4Z66 B;  1P3G B;  5CPJ B;  1P3G D;  5CPJ D;  1KX3 A;  3B6G C;  1TAF A;  3LZ1 D;  3AZN C;  3MGP A;  5DNM B;  3KSY A;  3AZJ A;  5BS7 C;  3MNN B;  3MNN D;  3B6F B;  3LJA D;  5B0Z B;  3WA9 A;  5B0Z D;  3B0C W;  3R45 A;  3W99 B;  4XZQ B;  3LZ0 C;  4E44 A;  4WU9 B;  3WA9 D;  3REL B;  2PYO C;  4J8X D;  1S32 B;  1U35 A;  3X1U B;  5JRG A;  5B31 A;  4WNN A;  1P3L C;  5G49 A;  3UTA C;  1U35 D;  3MGQ C;  3REJ B;  5JRG D;  5B31 D;  4X23 D;  1P3M A;  5E5A C;  3LEL A;  3AZM A;  1EQZ D;  5AV6 A;  5AV9 B;  5C3I C;  4AWL B;  1P3M D;  5B24 A;  5B32 A;  5CPK B;  3V9R B;  3W98 C;  3AZM D;  2LY8 A;  2CV5 C;  5B2J B;  5B33 C;  3VH5 A;  5B24 D;  5B32 D;  5GSU B;  1BH9 B;  5GSU D;  3B6G B;  4H9N A;  4J8W C;  3AZI A;  3AV2 A;  3X1S A;  3AZN B;  3AZN D;  5F99 C;  3X1S D;  5JA4 B;  3LZ0 B;  4CSR A;  3UTB A;  3AZG C;  4NE5 A;  3WKJ A;  5B1L A;  2PYO B;  4E45 A;  1P3A C;  1P34 A;  3UTB D;  3WTP D;  1P3L B;  5B0Y D;  3B0C T;  1P3P A;  3WKJ D;  3UTA B;  3W97 D;  3MGQ B;  3MGQ D;  5B40 A;  4WU8 D;  5E5A B;  1TZY D;  5CPI C;  1M18 C;  2FJ7 C;  5AVC C;  2HIO A;  5C3I B;  3REH C;  4KUD A;  5GT0 C;  3AV1 A;  3AFA C;  5DNN C;  3W98 B;  3AZH A;  3AN2 A;  2CV5 B;  5B33 B;  2YFW B;  4ZUX A;  2F8N D;  3WAA A;  5GXQ D;  5AY8 C;  5BT1 D;  5CP6 A;  4KHA B;  4JJN B;  4J8V C;  4JJN D;  1KX4 C;  3AZK B;  5F99 B;  3AZK D;  1ZLA A;  3WAA D;  5GT3 A;  4H9R A;  5CP6 D;  5GT3 D;  3KWQ A;  3W96 A;  3REI D;  3KUY C;  1P3A B;  4KGC A;  2BYK B;  1H3O A;  5BNX B;  1M19 A;  3KWQ D;  5KDM A;  5B2I D;  3W96 D;  3AZE C;  4KGC D;  3C1B A;  3NQU A;  1KX5 C;  5AV8 C;  3TU4 A;  1M19 D;  3AYW C;  1P3F C;  5AV5 A;  1KX3 C;  3AZF B;  3AZF D;  3X1T A;  1F1E A;  4CAY B;  5CPI B;  1M18 B;  5AVC B;  1HQ3 C;  3MGP C;  3AZJ C;  1KU5 A;  5BO0 A;  4YM6 C;  3REH B;  5GT0 B;  5AV5 D;  5BNV A;  3O62 A;  5DNN B;  5B1M C;  4UUZ A;  4Z2M G;  5AVB C;  3AFA B;  4Z66 A;  1P3G A;  5CPJ A;  1JFI B;  1AOI C;  3MNN A;  3B6F A;  3LJA A;  4Z66 D;  5FUG A;  5B0Z A;  1BH8 B;  5AY8 B;  3VH6 W;  4J8V B;  1KX4 B;  1P3K C;  3UT9 C;  3W99 A;  4XZQ A;  5DNM D;  2NQB C;  3B6F D;  4WU9 A;  2ARO C;  4J8X A;  3REL A;  1M1A C;  3W99 D;  1S32 A;  4XZQ D;  4WU9 D;  4XUJ C;  3MGS C;  3LEL C;  3REK B;  3KUY B;  3REK D;  3REL D;  4ZBJ B;  3A6N C;  1S32 D;  5AV6 C;  4H9Q B;  4R8P C;  1P3O C;  3X1U D;  1P3I C;  4LD9 C;  4X23 A;  1KX5 B;  3REJ D;  3AYW B;  1EQZ A;  1P3F B;  3B0B A;  4J8U C;  5AV9 A;  3AZL C;  3V9R A;  5CPK A;  3AZI C;  3AV2 C;  3MGP B;  1HQ3 B;  3AZJ B;  4YM6 B;  2YFV A;  3B0D C;  5AV9 D;  3C1C B;  3C1C D;  5B1M B;  5GSU A;  1BH9 A;  5AVB B;  5AVB D;  5CPK D;  2BYM B;  4NE3 A;  5B2J D;  3AZN A;  1AOI B;  5BS7 A;  3B6G D;  4H9P A;  4QLC C;  1P34 C;  4HGA C;  3WTP E;  1P3K B;  3UT9 B;  5JA4 A;  2NQB B;  2ARO B;  2ARO D;  2PYO A;  1M1A B;  1M1A D;  3LZ0 D;  2NZD C;  3WTP A;  4XUJ B;  5B0Y A;  3MGS B;  1N1J B;  3LEL B;  3MGS D;  1F66 C;  2PYO D;  1WWS A;  3VH6 T;  3A6N B;  3W97 A;  2HIO C;  2HUE C; 
#chains in the Genus database with same CATH topology
 3MGQ A;  4R8P B;  1P3O B;  1P3I B;  4DRB A;  1P3L D;  4LD9 B;  4WV4 B;  4WU8 A;  3AN2 C;  3UTA D;  5E5A A;  1TZY A;  1P3B C;  4YS3 C;  4J8U B;  3MGR C;  5E5A D;  3AZL B;  3AZI B;  1ID3 C;  4Z5T C;  2CV5 A;  5B33 A;  2YFW A;  3B0D B;  1ZLA C;  2F8N A;  3KXB C;  4H9S A;  3F6T A;  4NE6 A;  3W98 D;  5GXQ A;  2CV5 D;  5B33 D;  4KHA A;  4JJN A;  3AZK A;  3VH5 W;  4QLC B;  1P34 B;  4DQY B;  4HGA B;  4J8W B;  4J8W D;  2RVQ C;  3X1V C;  5F99 D;  3C1B C;  3P5J B;  4M6B A;  3REI A;  3TU4 C;  1P3A A;  2NZD B;  2BYK A;  5BNX A;  3AZG B;  3AZG D;  3FDD A;  1F66 B;  1F66 D;  5B2I A;  3X1T C;  1P3A D;  3A1K A;  4H9O B;  3AZE B;  2HIO B;  3MVD C;  2ZM5 A;  3VH6 A;  1P3G C;  2F2A C;  3AZF A;  2Y2I A;  2DQN C;  1P3B B;  3LZ1 C;  4YS3 B;  4YS3 D;  4CAY A;  5CPI A;  3MNN C;  3REH A;  5GT0 A;  3LJA C;  3MGR B;  3AFA A;  5DNN A;  1ID3 B;  2FJ7 B;  5CPI D;  1M18 D;  4Z5T B;  2FJ7 D;  4Z5T D;  5AVC D;  3NQJ B;  3REH D;  5GT0 D;  1JFI A;  3KXB B;  3WA9 C;  3AFA D;  5DNN D;  4J8X C;  1BH8 A;  4G91 C;  4J8V A;  1KX4 A;  5DNM A;  1U35 C;  5AY8 D;  4J8V D;  1KX4 D;  5JRG C;  3X1V B;  5B31 C;  5B31 G;  4X23 C;  3C1B B;  2IO5 C;  3REK A;  1EQZ C;  3VH5 T;  1P3M C;  3X1U A;  3AZM C;  3KUY D;  3MVD B;  3REJ A;  3AYW A;  5B24 C;  5B32 C;  4NFT A;  5B32 G;  2Y2K A;  3LZ1 B;  1KX5 D;  5AV8 B;  5AV8 D;  3AYW D;  1HQ3 A;  1P3F D;  4YM6 A;  4EO5 C;  3LJA B;  5FUG B;  1KX3 B;  3C1C A;  1KX3 D;  5B1M A;  1TAF B;  5AVB A;  3X1S C;  3MGP D;  1HQ3 D;  2BYM A;  3AZJ D;  5B2J A;  4YM6 D;  2F8N H;  3WA9 B;  1AOI A;  3EPH A;  5B1M D;  3EPL A;  4J8X B;  3R45 B;  3B6G A;  4G91 B;  3UTB C;  3WTP C;  1P3K A;  2CWE A;  3UT9 A;  1AOI D;  5B0Y C;  3WKJ C;  2NQB A;  5B1L C;  2J8P A;  2BG1 A;  2ARO A;  3W97 C;  1U35 B;  1M1A A;  1A7W A;  1P3K D;  5JRG B;  3LZ0 A;  5B31 B;  4WNN B;  3UT9 D;  1P3P C;  2NQB D;  4X23 B;  5G49 B;  4G92 C;  4WU8 C;  2IO5 B;  4XUJ A;  1BFM A;  1TZY C;  1N1J A;  3MGS A;  1EQZ B;  3A6N A;  1P3M B;  5B40 C;  4R8P A;  1P3O A;  1ULY A;  4XUJ D;  1P3I A;  1P3L A;  2ZY5 A;  3AZM B;  4LD9 A;  3LEL D;  3UTA A;  5AV6 B;  3A6N D;  5AV6 D;  2YFV B;  4KUD C;  2F8N G;  3AV1 C;  5B24 B;  5B32 B;  4H9S C;  4R8P D;  1P3O D;  1P3I D;  4J8U A;  3AZH C;  4LD9 D;  5CHL B;  5GXQ C;  3AZL A;  4ZUX C;  5BT1 C;  4JJN C;  3H0L C;  3AZK C;  4J8U D;  4UPK A;  4EO5 B;  3WAA C;  4H9P B;  4H9N B;  3AZL D;  3W98 A;  5CP6 C;  3AZI D;  3X1S B;  3AV2 B;  3AV2 D;  5GT3 C;  3REI C;  4QLC A;  4CSR B;  4J8W A;  3WTP B;  3UTB B;  5B0Y B;  3KWQ C;  3WKJ B;  3W96 C;  5B1L B;  5B1L D;  5F99 A;  5B2I C;  4KGC C;  3W97 B;  4QLC D;  1P34 D;  1M19 C;  1Q9C A;  2Y2P A;  1P3P B;  1P3P D;  2NZD A;  4WU8 B;  4G92 B;  3AZG A;  3AZF C;  1F66 A;  1TZY B;  2ZY3 A;  4H9O A;  3AZE A;  1WWI A;  2NZD D;  5AV5 C;  5B40 B;  5B40 D;  2JE5 A;  1HTA A;  3A1I A;  3AZE D;  2HUE B;  2HIO D;  4KUD B;  1P3B A;  2F8N B;  4YS3 A;  3AV1 B;  4KUD D;  3AV1 D;  3O62 C;  2FFF B;  3AZH B;  3AZH D;  2Y2M A;  4Z66 C;  3AN2 B;  5GXQ B;  3AN2 D;  5CPJ C;  3MGR A;  1T3U A;  4ZUX B;  4ZUX D;  1R4V A;  1P3B D;  1ID3 A;  1M18 A;  2FJ7 A;  4Z5T A;  5DNM C;  5AVC A;  3NQJ A;  3B6F C;  2XD5 A;  2F8N K;  4DRA A;  3WAA B;  2RIQ A;  5B0Z C;  3KXB A;  2JSS A;  4Z2M H;  3MGR D;  1B6W A;  5CP6 B;  3W99 C;  1ID3 D;  4XZQ C;  1ZLA B;  1ZLA D;  4WU9 C;  5GT3 B;  3KXB D;  4H9R B;  3REI B;  3REL C;  3REK C;  4ZBJ C;  1S32 C;  2L5A A;  5AY8 A;  3KWQ B;  5B2I B;  3X1U C;  3X1V A;  3W96 B;  2Y2G A;  4KGC B;  1H3O B;  1M19 B;  3REJ C;  2RVQ D;  2W8S A;  5KDM B;  3X1V D;  4WZS B;  3C1B D;  3H0R C;  1B67 A;  3NQU B;  3TU4 B;  3KUY A;  3TU4 D;  3MVD A;  5AV5 B;  5AV9 C;  4AWL C;  4H9Q A;  3C1C C;  3X1T B;  3X1T D;  5CPK C;  2G5I C;  5BO0 B;  2ZY4 A;  5B2J C;  3LZ1 A;  3MVD D;  5AV8 A;  1KX5 A;  5BNV B;  3O62 B;  3O62 D;  4UUZ B;  2UWX A;  5GSU C;  1P3F A;  4Z66 B;  1P3G B;  5CPJ B;  1P3G D;  5CPJ D;  1KX3 A;  3B6G C;  1TAF A;  3LZ1 D;  3AZN C;  3MGP A;  5DNM B;  3KSY A;  3AZJ A;  5BS7 C;  3MNN B;  3MNN D;  3B6F B;  3LJA D;  5B0Z B;  3WA9 A;  5B0Z D;  3B0C W;  3R45 A;  3W99 B;  4XZQ B;  3LZ0 C;  4E44 A;  4WU9 B;  2DF4 C;  3WA9 D;  3REL B;  2PYO C;  4J8X D;  1S32 B;  1U35 A;  3X1U B;  2Y2L A;  5B31 A;  4WNN A;  5JRG A;  1P3L C;  5G49 A;  3UTA C;  3EPJ A;  1U35 D;  3MGQ C;  3REJ B;  5JRG D;  5B31 D;  2Y2J A;  4X23 D;  1P3M A;  2JCH A;  5E5A C;  3LEL A;  3AZM A;  1EQZ D;  5AV6 A;  5AV9 B;  5C3I C;  4AWL B;  1P3M D;  1Z2C B;  5B24 A;  5B32 A;  5CPK B;  3V9R B;  3W98 C;  3AZM D;  2LY8 A;  2CV5 C;  5B2J B;  5B33 C;  2Y2H A;  3VH5 A;  5B24 D;  5B32 D;  5GSU B;  1BH9 B;  5GSU D;  3B6G B;  4H9N A;  4J8W C;  3AZI A;  3AV2 A;  3X1S A;  3AZN B;  3AZN D;  5F99 C;  3X1S D;  5JA4 B;  3LZ0 B;  4CSR A;  3UTB A;  3AZG C;  4NE5 A;  3WKJ A;  5B1L A;  2PYO B;  4E45 A;  1P3A C;  1W2E A;  1P34 A;  3UTB D;  3WTP D;  1P3L B;  5B0Y D;  3B0C T;  1P3P A;  3WKJ D;  3UTA B;  3W97 D;  3MGQ B;  3MGQ D;  2ZY2 A;  5B40 A;  4WU8 D;  5E5A B;  1TZY D;  5CPI C;  1M18 C;  2FJ7 C;  5AVC C;  2HIO A;  5C3I B;  3REH C;  4KUD A;  5GT0 C;  3AV1 A;  3AFA C;  5DNN C;  3W98 B;  3AZH A;  2Y2O A;  3AN2 A;  2CV5 B;  5B33 B;  2YFW B;  4ZUX A;  2F8N D;  3KFU G;  2XD1 A;  3WAA A;  5GXQ D;  5AY8 C;  5BT1 D;  5CP6 A;  2G5H C;  4KHA B;  4JJN B;  4J8V C;  4JJN D;  1KX4 C;  3AZK B;  5F99 B;  3EG5 B;  3AZK D;  1ZLA A;  3WAA D;  3AL0 C;  5GT3 A;  3IP4 C;  4H9R A;  5CP6 D;  5GT3 D;  3KWQ A;  3W96 A;  3REI D;  3KUY C;  1P3A B;  4KGC A;  2BYK B;  1H3O A;  5BNX B;  1M19 A;  3KWQ D;  5KDM A;  5B2I D;  3W96 D;  3AZE C;  4KGC D;  3C1B A;  3NQU A;  1KX5 C;  5AV8 C;  3TU4 A;  1M19 D;  3AYW C;  3EPK A;  1P3F C;  2Y2Q A;  5AV5 A;  1KX3 C;  3AZF B;  3AZF D;  3X1T A;  1F1E A;  4CAY B;  5CPI B;  1M18 B;  5AVC B;  1HQ3 C;  3MGP C;  3AZJ C;  1KU5 A;  5BO0 A;  4YM6 C;  3REH B;  5GT0 B;  5AV5 D;  5BNV A;  3O62 A;  5DNN B;  5B1M C;  4UUZ A;  4Z2M G;  5AVB C;  3AFA B;  4Z66 A;  1P3G A;  5CPJ A;  1PZR A;  1JFI B;  1AOI C;  3MNN A;  3B6F A;  3LJA A;  4Z66 D;  5FUG A;  5B0Z A;  4WJ3 C;  1BH8 B;  5AY8 B;  3VH6 W;  4J8V B;  1KX4 B;  1P3K C;  3UT9 C;  3W99 A;  4XZQ A;  5DNM D;  2NQB C;  3B6F D;  4WU9 A;  2ARO C;  2VQR A;  4J8X A;  3REL A;  1M1A C;  3W99 D;  1S32 A;  4XZQ D;  4WU9 D;  4XUJ C;  3MGS C;  3H0M C;  3LEL C;  3REK B;  3KUY B;  3REK D;  3REL D;  4ZBJ B;  3A6N C;  1S32 D;  5AV6 C;  4H9Q B;  4R8P C;  1P3O C;  3X1U D;  1P3I C;  4LD9 C;  4X23 A;  1KX5 B;  3REJ D;  3AYW B;  1EQZ A;  1P3F B;  3B0B A;  4J8U C;  5AV9 A;  3AZL C;  3V9R A;  5CPK A;  3AZI C;  3AV2 C;  3MGP B;  1HQ3 B;  3AZJ B;  4YM6 B;  2YFV A;  3B0D C;  5AV9 D;  3C1C B;  3C1C D;  5B1M B;  5GSU A;  1BH9 A;  5AVB B;  5AVB D;  5CPK D;  2BYM B;  4NE3 A;  5B2J D;  3AZN A;  1AOI B;  5BS7 A;  3B6G D;  4H9P A;  4QLC C;  1P34 C;  4HGA C;  3WTP E;  1P3K B;  3UT9 B;  5JA4 A;  2NQB B;  2Y2N A;  2ARO B;  2ARO D;  2PYO A;  1M1A B;  1M1A D;  3LZ0 D;  2NZD C;  3WTP A;  4XUJ B;  5B0Y A;  3MGS B;  1N1J B;  3LEL B;  3MGS D;  1F66 C;  2PYO D;  1WWS A;  3VH6 T;  3A6N B;  3W97 A;  2HIO C;  2HUE C; 
#chains in the Genus database with same CATH homology
 3MGQ A;  4R8P B;  1P3O B;  1P3I B;  4DRB A;  1P3L D;  4LD9 B;  4WV4 B;  4WU8 A;  3AN2 C;  3UTA D;  5E5A A;  1TZY A;  1P3B C;  4YS3 C;  4J8U B;  3MGR C;  5E5A D;  3AZL B;  3AZI B;  1ID3 C;  4Z5T C;  2CV5 A;  5B33 A;  2YFW A;  3B0D B;  1ZLA C;  2F8N A;  3KXB C;  4H9S A;  3F6T A;  4NE6 A;  3W98 D;  5GXQ A;  2CV5 D;  5B33 D;  4KHA A;  4JJN A;  3AZK A;  3VH5 W;  4QLC B;  1P34 B;  4DQY B;  4HGA B;  4J8W B;  4J8W D;  2RVQ C;  3X1V C;  5F99 D;  3C1B C;  3P5J B;  4M6B A;  3REI A;  3TU4 C;  1P3A A;  2NZD B;  2BYK A;  5BNX A;  3AZG B;  3AZG D;  3FDD A;  1F66 B;  1F66 D;  5B2I A;  3X1T C;  1P3A D;  3A1K A;  4H9O B;  3AZE B;  2HIO B;  3MVD C;  2ZM5 A;  3VH6 A;  1P3G C;  2F2A C;  3AZF A;  2Y2I A;  2DQN C;  1P3B B;  3LZ1 C;  4YS3 B;  4YS3 D;  4CAY A;  5CPI A;  3MNN C;  3REH A;  5GT0 A;  3LJA C;  3MGR B;  3AFA A;  5DNN A;  1ID3 B;  2FJ7 B;  5CPI D;  1M18 D;  4Z5T B;  2FJ7 D;  4Z5T D;  5AVC D;  3NQJ B;  3REH D;  5GT0 D;  1JFI A;  3KXB B;  3WA9 C;  3AFA D;  5DNN D;  4J8X C;  1BH8 A;  4G91 C;  4J8V A;  1KX4 A;  5DNM A;  1U35 C;  5AY8 D;  4J8V D;  1KX4 D;  5JRG C;  3X1V B;  5B31 C;  5B31 G;  4X23 C;  3C1B B;  2IO5 C;  3REK A;  1EQZ C;  3VH5 T;  1P3M C;  3X1U A;  3AZM C;  3KUY D;  3MVD B;  3REJ A;  3AYW A;  5B24 C;  5B32 C;  4NFT A;  5B32 G;  2Y2K A;  3LZ1 B;  1KX5 D;  5AV8 B;  5AV8 D;  3AYW D;  1HQ3 A;  1P3F D;  4YM6 A;  4EO5 C;  3LJA B;  5FUG B;  1KX3 B;  3C1C A;  1KX3 D;  5B1M A;  1TAF B;  5AVB A;  3X1S C;  3MGP D;  1HQ3 D;  2BYM A;  3AZJ D;  5B2J A;  4YM6 D;  2F8N H;  3WA9 B;  1AOI A;  3EPH A;  5B1M D;  3EPL A;  4J8X B;  3R45 B;  3B6G A;  4G91 B;  3UTB C;  3WTP C;  1P3K A;  2CWE A;  3UT9 A;  1AOI D;  5B0Y C;  3WKJ C;  2NQB A;  5B1L C;  2J8P A;  2BG1 A;  2ARO A;  3W97 C;  1U35 B;  1M1A A;  1A7W A;  1P3K D;  5JRG B;  3LZ0 A;  5B31 B;  4WNN B;  3UT9 D;  1P3P C;  2NQB D;  4X23 B;  5G49 B;  4G92 C;  4WU8 C;  2IO5 B;  4XUJ A;  1BFM A;  1TZY C;  1N1J A;  3MGS A;  1EQZ B;  3A6N A;  1P3M B;  5B40 C;  4R8P A;  1P3O A;  1ULY A;  4XUJ D;  1P3I A;  1P3L A;  2ZY5 A;  3AZM B;  4LD9 A;  3LEL D;  3UTA A;  5AV6 B;  3A6N D;  5AV6 D;  2YFV B;  4KUD C;  2F8N G;  3AV1 C;  5B24 B;  5B32 B;  4H9S C;  4R8P D;  1P3O D;  1P3I D;  4J8U A;  3AZH C;  4LD9 D;  5CHL B;  5GXQ C;  3AZL A;  4ZUX C;  5BT1 C;  4JJN C;  3H0L C;  3AZK C;  4J8U D;  4UPK A;  4EO5 B;  3WAA C;  4H9P B;  4H9N B;  3AZL D;  3W98 A;  5CP6 C;  3AZI D;  3X1S B;  3AV2 B;  3AV2 D;  5GT3 C;  3REI C;  4QLC A;  4CSR B;  4J8W A;  3WTP B;  3UTB B;  5B0Y B;  3KWQ C;  3WKJ B;  3W96 C;  5B1L B;  5B1L D;  5F99 A;  5B2I C;  4KGC C;  3W97 B;  4QLC D;  1P34 D;  1M19 C;  1Q9C A;  2Y2P A;  1P3P B;  1P3P D;  2NZD A;  4WU8 B;  4G92 B;  3AZG A;  3AZF C;  1F66 A;  1TZY B;  2ZY3 A;  4H9O A;  3AZE A;  1WWI A;  2NZD D;  5AV5 C;  5B40 B;  5B40 D;  2JE5 A;  1HTA A;  3A1I A;  3AZE D;  2HUE B;  2HIO D;  4KUD B;  1P3B A;  2F8N B;  4YS3 A;  3AV1 B;  4KUD D;  3AV1 D;  3O62 C;  2FFF B;  3AZH B;  3AZH D;  2Y2M A;  4Z66 C;  3AN2 B;  5GXQ B;  3AN2 D;  5CPJ C;  3MGR A;  1T3U A;  4ZUX B;  4ZUX D;  1R4V A;  1P3B D;  1ID3 A;  1M18 A;  2FJ7 A;  4Z5T A;  5DNM C;  5AVC A;  3NQJ A;  3B6F C;  2XD5 A;  2F8N K;  4DRA A;  3WAA B;  2RIQ A;  5B0Z C;  3KXB A;  2JSS A;  4Z2M H;  3MGR D;  1B6W A;  5CP6 B;  3W99 C;  1ID3 D;  4XZQ C;  1ZLA B;  1ZLA D;  4WU9 C;  5GT3 B;  3KXB D;  4H9R B;  3REI B;  3REL C;  3REK C;  4ZBJ C;  1S32 C;  2L5A A;  5AY8 A;  3KWQ B;  5B2I B;  3X1U C;  3X1V A;  3W96 B;  2Y2G A;  4KGC B;  1H3O B;  1M19 B;  3REJ C;  2RVQ D;  2W8S A;  5KDM B;  3X1V D;  4WZS B;  3C1B D;  3H0R C;  1B67 A;  3NQU B;  3TU4 B;  3KUY A;  3TU4 D;  3MVD A;  5AV5 B;  5AV9 C;  4AWL C;  4H9Q A;  3C1C C;  3X1T B;  3X1T D;  5CPK C;  2G5I C;  5BO0 B;  2ZY4 A;  5B2J C;  3LZ1 A;  3MVD D;  5AV8 A;  1KX5 A;  5BNV B;  3O62 B;  3O62 D;  4UUZ B;  2UWX A;  5GSU C;  1P3F A;  4Z66 B;  1P3G B;  5CPJ B;  1P3G D;  5CPJ D;  1KX3 A;  3B6G C;  1TAF A;  3LZ1 D;  3AZN C;  3MGP A;  5DNM B;  3KSY A;  3AZJ A;  5BS7 C;  3MNN B;  3MNN D;  3B6F B;  3LJA D;  5B0Z B;  3WA9 A;  5B0Z D;  3B0C W;  3R45 A;  3W99 B;  4XZQ B;  3LZ0 C;  4E44 A;  4WU9 B;  2DF4 C;  3WA9 D;  3REL B;  2PYO C;  4J8X D;  1S32 B;  1U35 A;  3X1U B;  2Y2L A;  5B31 A;  4WNN A;  5JRG A;  1P3L C;  5G49 A;  3UTA C;  3EPJ A;  1U35 D;  3MGQ C;  3REJ B;  5JRG D;  5B31 D;  2Y2J A;  4X23 D;  1P3M A;  2JCH A;  5E5A C;  3LEL A;  3AZM A;  1EQZ D;  5AV6 A;  5AV9 B;  5C3I C;  4AWL B;  1P3M D;  1Z2C B;  5B24 A;  5B32 A;  5CPK B;  3V9R B;  3W98 C;  3AZM D;  2LY8 A;  2CV5 C;  5B2J B;  5B33 C;  2Y2H A;  3VH5 A;  5B24 D;  5B32 D;  5GSU B;  1BH9 B;  5GSU D;  3B6G B;  4H9N A;  4J8W C;  3AZI A;  3AV2 A;  3X1S A;  3AZN B;  3AZN D;  5F99 C;  3X1S D;  5JA4 B;  3LZ0 B;  4CSR A;  3UTB A;  3AZG C;  4NE5 A;  3WKJ A;  5B1L A;  2PYO B;  4E45 A;  1P3A C;  1W2E A;  1P34 A;  3UTB D;  3WTP D;  1P3L B;  5B0Y D;  3B0C T;  1P3P A;  3WKJ D;  3UTA B;  3W97 D;  3MGQ B;  3MGQ D;  2ZY2 A;  5B40 A;  4WU8 D;  5E5A B;  1TZY D;  5CPI C;  1M18 C;  2FJ7 C;  5AVC C;  2HIO A;  5C3I B;  3REH C;  4KUD A;  5GT0 C;  3AV1 A;  3AFA C;  5DNN C;  3W98 B;  3AZH A;  2Y2O A;  3AN2 A;  2CV5 B;  5B33 B;  2YFW B;  4ZUX A;  2F8N D;  3KFU G;  2XD1 A;  3WAA A;  5GXQ D;  5AY8 C;  5BT1 D;  5CP6 A;  2G5H C;  4KHA B;  4JJN B;  4J8V C;  4JJN D;  1KX4 C;  3AZK B;  5F99 B;  3EG5 B;  3AZK D;  1ZLA A;  3WAA D;  3AL0 C;  5GT3 A;  3IP4 C;  4H9R A;  5CP6 D;  5GT3 D;  3KWQ A;  3W96 A;  3REI D;  3KUY C;  1P3A B;  4KGC A;  2BYK B;  1H3O A;  5BNX B;  1M19 A;  3KWQ D;  5KDM A;  5B2I D;  3W96 D;  3AZE C;  4KGC D;  3C1B A;  3NQU A;  1KX5 C;  5AV8 C;  3TU4 A;  1M19 D;  3AYW C;  3EPK A;  1P3F C;  2Y2Q A;  5AV5 A;  1KX3 C;  3AZF B;  3AZF D;  3X1T A;  1F1E A;  4CAY B;  5CPI B;  1M18 B;  5AVC B;  1HQ3 C;  3MGP C;  3AZJ C;  1KU5 A;  5BO0 A;  4YM6 C;  3REH B;  5GT0 B;  5AV5 D;  5BNV A;  3O62 A;  5DNN B;  5B1M C;  4UUZ A;  4Z2M G;  5AVB C;  3AFA B;  4Z66 A;  1P3G A;  5CPJ A;  1PZR A;  1JFI B;  1AOI C;  3MNN A;  3B6F A;  3LJA A;  4Z66 D;  5FUG A;  5B0Z A;  4WJ3 C;  1BH8 B;  5AY8 B;  3VH6 W;  4J8V B;  1KX4 B;  1P3K C;  3UT9 C;  3W99 A;  4XZQ A;  5DNM D;  2NQB C;  3B6F D;  4WU9 A;  2ARO C;  2VQR A;  4J8X A;  3REL A;  1M1A C;  3W99 D;  1S32 A;  4XZQ D;  4WU9 D;  4XUJ C;  3MGS C;  3H0M C;  3LEL C;  3REK B;  3KUY B;  3REK D;  3REL D;  4ZBJ B;  3A6N C;  1S32 D;  5AV6 C;  4H9Q B;  4R8P C;  1P3O C;  3X1U D;  1P3I C;  4LD9 C;  4X23 A;  1KX5 B;  3REJ D;  3AYW B;  1EQZ A;  1P3F B;  3B0B A;  4J8U C;  5AV9 A;  3AZL C;  3V9R A;  5CPK A;  3AZI C;  3AV2 C;  3MGP B;  1HQ3 B;  3AZJ B;  4YM6 B;  2YFV A;  3B0D C;  5AV9 D;  3C1C B;  3C1C D;  5B1M B;  5GSU A;  1BH9 A;  5AVB B;  5AVB D;  5CPK D;  2BYM B;  4NE3 A;  5B2J D;  3AZN A;  1AOI B;  5BS7 A;  3B6G D;  4H9P A;  4QLC C;  1P34 C;  4HGA C;  3WTP E;  1P3K B;  3UT9 B;  5JA4 A;  2NQB B;  2Y2N A;  2ARO B;  2ARO D;  2PYO A;  1M1A B;  1M1A D;  3LZ0 D;  2NZD C;  3WTP A;  4XUJ B;  5B0Y A;  3MGS B;  1N1J B;  3LEL B;  3MGS D;  1F66 C;  2PYO D;  1WWS A;  3VH6 T;  3A6N B;  3W97 A;  2HIO C;  2HUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...