1TAFB

Drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
b'MLYGSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMSLKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TFIID TBP ASSOCIATED FACTOR 42
publication title Structural similarity between TAFs and the heterotetrameric core of the histone octamer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Complex (two transcription factors)
total genus 26
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1996-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02969 TAF TATA box binding protein associated factor (TAF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tafB00
3AV1A 3RELB 3B6GA 4H9RB 2NQBD 3AZKC 3VH5T 4WU8A 3UTAD 1M18D 5AV8A 3B0CT 1KX5A 4Z2MH 5B33B 3AZHD 3MGRB 3LZ1C 3B0BA 1AOIC 1BH9B 5CHLB 3AZGC 5B24C 5AV6C 3W98B 3MNNB 1P3LB 4WU9B 4XUJD 5DNNA 5BO0A 3A6ND 4J8XC 3W99C 4XZQA 2AROD 1M19B 3UTBA 3LZ0C 3MVDA 3X1VB 3W96B 3WAAD 2IO5C 3AZMD 3AZLB 4LD9C 3KUYC 3VH5W 3REIB 3WTPB 1U35B 1P3PB 3B0CW 4M6BA 5B32G 1S32A 1P3IC 3REHD 1HQ3C 3C1CB 5JA4B 3TU4C 2BYKB 3KXBD 4YM6A 3AZKB 4JJNC 3X1SD 1KX3A 5G49A 4NE3A 5B2ID 3LZ1B 5BT1C 3R45B 1AOIB 3AV2B 4WZSB 3AZGB 5B24B 1ZLAC 2HIOD 5AV6B 3X1TA 1P3GA 1B6WA 5AV5D 5JRGD 4CSRA 1P3AD 4J8XB 3LELA 3W99B 3LZ0B 3MGQD 5CPJA 2IO5B 4LD9B 3MGPA 3KUYB 3C1BD 1P3KD 5B0YA 1B67A 1P3BD 1P3IB 4CAYA 1HQ3B 3W97A 2NQBA 3TU4B 3MGSA 2CV5D 4JJNB 1P34D 4J8WA 5B2JC 3V9RB 4Z5TC 3AV1D 3B6GD 1EQZD 4WU8D 1TZYC 1ZLAB 5AV8D 1N1JA 1KX5D 4UUZB 2NZDC 3B6FC 3A6NA 5CPIC 3RELA 2CWEA 3AFAC 3AZEC 4H9RA 3VH6T 2RVQC 5DNND 5GSUC 5F99C 4XZQD 3MGRA 3UTBD 3MVDD 2YFWB 1BH9A 3REHA 5B1MA 2L5AA 1KX4D 3MNNA 1P3LA 4ZUXC 3KXBA 1M1AC 3B0DC 1S32D 5B32D 3AYWC 2F8NH 5B2JB 1M19A 5B2IA 4Z5TB 3X1VA 5B0ZC 3AZLA 2HIOA 3UTAC 3REIA 1TZYB 2YFVB 3WTPA 5CPKC 1M18C 2PYOD 3KWQD 5JRGA 2F8NB 5B40C 2NZDB 3B6FB 1TAFB 5CPIB 4NFTA 4H9OA 3X1TD 1P3GD 3AFAB 3AZEB 4XUJC 4H9NB 5FUGB 5AV9C 4X23C 3O62C 5GSUB 5F99B 4J8VC 3LELD 3C1BA 5KDMA 1P3KA 3LZ1A 3R45A 3AZJC 1AOIA 4ZBJC 3AV2A 3AZGA 5AV6A 4QLCC 3AZMC 3AZNC 3MGPD 3AZID 4ZUXB 4KUDC 5DNMC 1M1AB 3B0DB 3NQUB 5B0YD 1P34A 4J8XA 3W97D 3AYWB 5BS7C 1EQZA 5GXQC 5B0ZB 2LY8A 3REJC 3MGSD 4WNNB 4YS3C 4LD9A 3UTAB 3KUYA 4J8WD 5CPKB 1M18B 5B40B 2F8NK 1HQ3A 4R8PA 5GT0C 5B1LD 2FJ7C 5AY8D 5CP6C 4JJNA 4X23B 5AV9B 4H9SA 4EO5C 3V9RA 3RELD 3O62B 4J8VB 5B31C 3AZJB 1P3MB 4ZBJB 1KX4A 4Z66C 4QLCB 3AZNB 3AZMB 3MGRD 4KUDB 1Q9CA 5DNMB 5B32A 1HTAA 5B1MD 3MNND 1P3LD 4WU9D 5GXQB 4HGAC 5AVCC 3AZFA 3REJB 4YS3B 2PYOA 3KWQA 1M19D 3W96D 3X1VD 1BH8B 2YFWA 3LJAC 3AZLD 3REID 3WKJC 5GT0B 3WTPD 1P3PD 4H9QA 4NE5A 5E5AA 1KX5C 1ID3C 2FJ7B 5CP6B 3C1CD 4EO5B 3WA9C 5BNVB 3AZKD 5DNNC 5B31B 1F66A 3AZIA 4Z66B 3LZ1D 3B6FA 1TAFA 1AOID 1P3OC 3AV2D 1P3FC 3AZGD 5AV6D 3AFAA 1KU5A 1H3OB 4H9NA 5FUGA 4HGAB 5AVCB 5GSUA 4J8XD 3W99D 3AN2C 3UT9C 3LZ0D 3NQJA 3LJAB 4YM6C 4J8UC 4LD9D 1F1EA 3KUYD 3WKJB 5B1LA 4ZUXA 1KX3C 1M1AA 5GT3C 5AY8A 3X1UA 1KX5B 1ID3B 4KGCC 1P3ID 1HQ3D 3REKC 3AYWA 4R8PD 3WA9B 3TU4D 5B0ZA 4WNNA 4JJND 5DNNB 5BO0B 5B33A 5AVBC 4E44A 5B40A 5BT1D 4H9PB 5CPJC 1P3OB 1P3FB 3W98A 4WU9A 4WV4B 4Z2MG 4J8VA 3W96A 3W97C 3AN2B 3UT9B 2NQBC 3AZJA 1P3MA 3AZFD 4G91C 4YM6B 3MGSC 4J8UB 3AZNA 1U35A 1P3PA 1KX3B 3AZHC 5GT3B 4KGCB 3C1CA 5JA4A 3REKB 2BYKA 5BS7A 1A7WA 5E5AD 5GXQA 3AZKA 1JFIB 3A6NC 4YS3A 5BNXB 4CSRB 4Z5TD 5AVBB 2AROC 1BH8A 4DRBA 3WAAC 5B24A 5CPJB 1F66D 1TZYD 3VH5A 2FJ7A 2NZDD 3B6FD 1BFMA 3REHC 5CPID 3W99A 5B1MC 3LZ0A 3AFAD 4CAYB 5C3IC 3AZED 3W97B 5B31G 3KXBC 2NQBB 4Z66A 3X1SC 4G91B 5F99D 5GSUD 3MGSB 5B2IC 3AZHB 1P3IA 3TU4A 2HIOC 4ZUXD 5AV5C 1M1AD 1N1JB 3X1UD 4XUJB 5JRGC 4G92C 1P3AC 3A6NB 3AYWD 2AROB 5B0ZD 3MGQC 3LJAA 1ZLAA 3WAAB 4E45A 3WKJA 5B33D 5CPKD 4UUZA 1ID3A 3C1BC 1P3KC 5B40D 2BYMB 1P3BC 3AV2C 3REHB 3W98D 3WA9A 5B1MB 5C3IB 3KXBB 4X23D 5AV9D 2CV5C 1P34C 3O62D 3X1SB 3WTPE 4J8VD 3AV1C 3B6GC 1EQZC 4H9PA 4KHAB 5B2IB 3AZJD 1P3MD 1P3OA 4WU8C 1P3FA 4QLCD 3AZND 1U35D 5AV8C 2HIOB 4KUDD 5AV5B 5DNMD 5JRGB 4G92B 5B2JA 1P3AB 4Z5TA 4R8PC 3AN2A 3UT9A 4H9OB 5GXQD 3MGQB 1TZYA 2YFVA 3KSYA 4J8UA 3REJD 4YS3D 2F8NG 4H9SC 2F8NA 4XZQC 5GT3A 2NZDA 3UTBC 3C1BB 3MVDC 5KDMB 1P3KB 4KGCA 5CPIA 5B24D 3REKA 1P3BB 5GT0D 3AZEA 1KX4C 1JFIA 2FJ7D 2HUEC 5CP6D 1S32C 5BNXA 5F99A 5B32C 2CV5B 1P34B 5AVBA 3AV1B 3B6GB 1EQZB 5B31D 3VH6A 4WU8B 4Z66D 3AZFC 5AV8B 2PYOC 3NQUA 3KWQC 3X1TC 4R8PB 1P3GC 4DRAA 5E5AC 5AVCD 3UTAA 5CPKA 1M18A 3LELC 4XZQB 3AZHA 3UTBB 3MVDB 3LJAD 1ZLAD 1F66C 3WKJD 3MGPC 3AZIC 1KX4B 1ID3D 4NE6A 4XUJA 5B0YC 5AV9A 4X23A 2HUEB 3O62A 1S32B 5B32B 3WA9D 2AROA 1WWSA 3WAAA 4QLCA 3AZMA 1ULYA 3AZFB 4J8WC 4KUDA 5DNMA 2PYOB 5G49B 3KWQB 4AWLC 2BYMA 1P3OD 1P3FD 1R4VA 3X1TB 1P3GB 5B1LC 4H9QB 5E5AB 3X1UC 5AY8C 3REJA 3X1SA 5B2JD 3RELC 3AN2D 3LELB 3UT9D 4KHAA 5GT0A 4YM6D 4J8UD 3VH6W 1F66B 5B33C 2F8ND 3MGPB 3AZIB 5AV5A 3MGRC 1KX3D 5GT3D 5CP6A 4KGCD 5B0YB 1P3AA 5BNVA 2JSSA 3REKD 3W98C 3MNNC 1P3LC 4WU9C 2RVQD 3MGQA 5B31A 5AVBD 4J8WB 1M19C 3W96C 3X1VC 4AWLB 5CPJD 1P3MC 1P3BA 3AZLC 3NQJB 3REIC 3WTPC 1H3OA 1U35C 1P3PC 5AVCA 5B1LB 1WWIA 5AY8B 3X1UB 2CV5A 3C1CC
chains in the Genus database with same CATH superfamily
3AV1A 3RELB 3B6GA 4H9RB 2NQBD 3AL0C 3AZKC 3VH5T 4WU8A 3UTAD 1M18D 5AV8A 3B0CT 1KX5A 4Z2MH 5B33B 2Y2QA 3AZHD 3MGRB 3LZ1C 3B0BA 1AOIC 1BH9B 5CHLB 3AZGC 5B24C 5AV6C 3W98B 3MNNB 1P3LB 4WU9B 4XUJD 5DNNA 5BO0A 3A6ND 4J8XC 3W99C 4XZQA 2AROD 1M19B 3UTBA 3LZ0C 3MVDA 3X1VB 3W96B 3WAAD 2IO5C 3F6TA 3AZMD 3AZLB 4LD9C 3KUYC 3VH5W 3REIB 3WTPB 1U35B 1P3PB 2RIQA 3B0CW 4M6BA 5B32G 1S32A 1P3IC 3REHD 1HQ3C 3C1CB 5JA4B 3TU4C 2BYKB 3KXBD 4YM6A 3AZKB 4JJNC 3FDDA 3X1SD 1KX3A 5G49A 4NE3A 5B2ID 3EPLA 3LZ1B 5BT1C 3R45B 2W8SA 1AOIB 3AV2B 4WZSB 3AZGB 5B24B 1ZLAC 2HIOD 5AV6B 3X1TA 1P3GA 1B6WA 5AV5D 5JRGD 4CSRA 1P3AD 2Y2IA 4J8XB 3LELA 3W99B 3LZ0B 3MGQD 5CPJA 3IP4C 2IO5B 4LD9B 3MGPA 3KUYB 3C1BD 1P3KD 5B0YA 1B67A 1P3BD 1P3IB 4CAYA 1HQ3B 3W97A 1Z2CB 2NQBA 3TU4B 3MGSA 2CV5D 4JJNB 1P34D 4J8WA 5B2JC 3V9RB 4Z5TC 3AV1D 3B6GD 1EQZD 4WU8D 1TZYC 1ZLAB 5AV8D 1N1JA 1KX5D 4UUZB 2NZDC 3B6FC 3A6NA 5CPIC 3RELA 2CWEA 3AFAC 3AZEC 4H9RA 3VH6T 2F2AC 2RVQC 5DNND 5GSUC 5F99C 4XZQD 3MGRA 3UTBD 3MVDD 2J8PA 2YFWB 1BH9A 3REHA 5B1MA 2L5AA 1KX4D 3MNNA 1P3LA 4ZUXC 3KXBA 1M1AC 3B0DC 4UPKA 1S32D 5B32D 3AYWC 2F8NH 5B2JB 1M19A 5B2IA 4Z5TB 3X1VA 5B0ZC 3AZLA 2HIOA 3UTAC 3REIA 1TZYB 2YFVB 3WTPA 5CPKC 1M18C 2PYOD 3KWQD 5JRGA 2F8NB 5B40C 2NZDB 3B6FB 1TAFB 5CPIB 4NFTA 4H9OA 3X1TD 1P3GD 3AFAB 3AZEB 4XUJC 4H9NB 5FUGB 5AV9C 4X23C 3O62C 5GSUB 5F99B 4J8VC 3LELD 3C1BA 5KDMA 1P3KA 3LZ1A 3R45A 3AZJC 1AOIA 4ZBJC 3AV2A 3AZGA 5AV6A 4QLCC 3AZMC 3AZNC 3MGPD 3AZID 4ZUXB 4KUDC 5DNMC 1M1AB 3B0DB 3NQUB 5B0YD 1P34A 3EPKA 4J8XA 3W97D 3AYWB 5BS7C 1EQZA 5GXQC 5B0ZB 2LY8A 3REJC 3MGSD 4WNNB 4YS3C 4LD9A 3UTAB 3KUYA 4J8WD 5CPKB 1M18B 5B40B 2F8NK 1PZRA 1HQ3A 4R8PA 5GT0C 5B1LD 2FJ7C 5AY8D 5CP6C 4JJNA 4X23B 5AV9B 4H9SA 4EO5C 3V9RA 3RELD 3O62B 4J8VB 5B31C 3AZJB 1P3MB 4ZBJB 1KX4A 4Z66C 4QLCB 3AZNB 3AZMB 3MGRD 4KUDB 1Q9CA 5DNMB 5B32A 1HTAA 5B1MD 2UWXA 3MNND 1P3LD 4WU9D 5GXQB 4HGAC 5AVCC 2JCHA 3AZFA 3REJB 4YS3B 2PYOA 3KWQA 1M19D 3W96D 3X1VD 1BH8B 2YFWA 3EG5B 3LJAC 3H0LC 3AZLD 3REID 3WKJC 5GT0B 3WTPD 1P3PD 4H9QA 4NE5A 5E5AA 1KX5C 1ID3C 3KFUG 2FJ7B 2ZM5A 5CP6B 3C1CD 4EO5B 3WA9C 5BNVB 3AZKD 5DNNC 5B31B 1F66A 3AZIA 4Z66B 3LZ1D 3B6FA 1TAFA 1AOID 1P3OC 3AV2D 1P3FC 3AZGD 2XD1A 5AV6D 3AFAA 2XD5A 1KU5A 1H3OB 4H9NA 2FFFB 5FUGA 4HGAB 5AVCB 5GSUA 4J8XD 2Y2GA 3W99D 3AN2C 3UT9C 3LZ0D 3NQJA 2DF4C 3LJAB 4YM6C 4J8UC 4LD9D 1F1EA 3KUYD 3WKJB 5B1LA 4ZUXA 1KX3C 1M1AA 5GT3C 5AY8A 3X1UA 1KX5B 1ID3B 4KGCC 2Y2LA 1P3ID 1HQ3D 4DQYB 3REKC 4R8PD 3AYWA 3WA9B 3TU4D 5B0ZA 4WNNA 4JJND 5DNNB 5BO0B 5B33A 2Y2KA 5AVBC 4E44A 5B40A 2JE5A 5BT1D 4H9PB 5CPJC 1P3OB 1P3FB 3W98A 4WU9A 4WV4B 4Z2MG 4J8VA 3W96A 3W97C 3AN2B 3UT9B 2NQBC 3AZJA 1P3MA 2Y2OA 3AZFD 4G91C 4YM6B 3MGSC 4J8UB 3AZNA 1U35A 1P3PA 1KX3B 3AZHC 5GT3B 4KGCB 3C1CA 5JA4A 3REKB 2BYKA 5BS7A 1A7WA 5E5AD 5GXQA 3AZKA 1JFIB 3A6NC 4YS3A 5BNXB 4CSRB 4Z5TD 5AVBB 2AROC 1BH8A 4DRBA 3WAAC 5B24A 5CPJB 1F66D 1TZYD 3VH5A 2ZY2A 2FJ7A 2NZDD 2ZY3A 3B6FD 1BFMA 3REHC 5CPID 3W99A 5B1MC 3LZ0A 3AFAD 4CAYB 5C3IC 3AZED 3W97B 5B31G 3KXBC 2NQBB 2ZY5A 4Z66A 3X1SC 4G91B 5F99D 5GSUD 3MGSB 5B2IC 3AZHB 1P3IA 3TU4A 2HIOC 4ZUXD 3P5JB 3H0RC 2G5HC 5AV5C 1M1AD 1N1JB 3X1UD 4XUJB 5JRGC 4G92C 1P3AC 3A6NB 3AYWD 2AROB 5B0ZD 3MGQC 3A1KA 3LJAA 1ZLAA 3WAAB 4E45A 3WKJA 5B33D 5CPKD 4UUZA 1ID3A 3C1BC 1P3KC 5B40D 2Y2HA 2BYMB 1P3BC 3AV2C 3REHB 3W98D 3WA9A 5B1MB 3H0MC 5C3IB 3KXBB 4X23D 5AV9D 2CV5C 1P34C 3O62D 3X1SB 3WTPE 4J8VD 3AV1C 3B6GC 1EQZC 4H9PA 4KHAB 5B2IB 3AZJD 1P3MD 1P3OA 4WU8C 1P3FA 4QLCD 3AZND 1U35D 5AV8C 3A1IA 2HIOB 4KUDD 5AV5B 5DNMD 5JRGB 4G92B 5B2JA 1P3AB 4Z5TA 4R8PC 3AN2A 3UT9A 4H9OB 5GXQD 3MGQB 1TZYA 1T3UA 2YFVA 3KSYA 4J8UA 3REJD 4YS3D 2F8NG 4H9SC 2F8NA 4XZQC 5GT3A 2NZDA 3UTBC 3C1BB 3MVDC 5KDMB 1P3KB 4KGCA 5CPIA 5B24D 3REKA 1P3BB 5GT0D 3AZEA 1KX4C 1JFIA 2FJ7D 2HUEC 5CP6D 1S32C 5BNXA 5F99A 5B32C 2CV5B 1P34B 2DQNC 5AVBA 2G5IC 3AV1B 3B6GB 1EQZB 5B31D 3VH6A 4WU8B 4Z66D 3AZFC 5AV8B 2PYOC 3NQUA 3KWQC 3EPHA 3X1TC 4R8PB 1P3GC 4DRAA 5E5AC 5AVCD 3UTAA 5CPKA 1M18A 3LELC 3EPJA 4XZQB 3AZHA 3UTBB 3MVDB 3LJAD 1ZLAD 1F66C 3WKJD 3MGPC 3AZIC 1KX4B 1ID3D 4NE6A 4XUJA 5B0YC 5AV9A 2BG1A 4X23A 2HUEB 3O62A 1S32B 2Y2MA 5B32B 3WA9D 2AROA 1WWSA 3WAAA 1W2EA 4QLCA 3AZMA 1ULYA 3AZFB 4J8WC 4KUDA 5DNMA 2PYOB 2Y2JA 5G49B 3KWQB 4AWLC 2BYMA 1P3OD 1P3FD 2Y2PA 1R4VA 3X1TB 1P3GB 5B1LC 4H9QB 5E5AB 3X1UC 5AY8C 3REJA 2ZY4A 3X1SA 5B2JD 3RELC 2Y2NA 3LELB 3UT9D 3AN2D 4KHAA 5GT0A 4YM6D 4J8UD 3VH6W 1F66B 5B33C 2F8ND 3MGPB 3AZIB 5AV5A 3MGRC 1KX3D 5GT3D 5CP6A 4KGCD 5B0YB 1P3AA 5BNVA 2JSSA 3REKD 3W98C 3MNNC 1P3LC 4WU9C 2RVQD 3MGQA 5B31A 4WJ3C 5AVBD 4J8WB 1M19C 3W96C 3X1VC 4AWLB 5CPJD 1P3MC 1P3BA 3AZLC 3NQJB 3REIC 3WTPC 1H3OA 1U35C 1P3PC 5AVCA 5B1LB 2VQRA 1WWIA 5AY8B 3X1UB 2CV5A 3C1CC
chains in the Genus database with same CATH topology
3AV1A 3RELB 3B6GA 4H9RB 2NQBD 3AL0C 3AZKC 3VH5T 4WU8A 3UTAD 1M18D 5AV8A 3B0CT 1KX5A 4Z2MH 5B33B 2Y2QA 3AZHD 3MGRB 3LZ1C 3B0BA 1AOIC 1BH9B 5CHLB 3AZGC 5B24C 5AV6C 3W98B 3MNNB 1P3LB 4WU9B 4XUJD 5DNNA 5BO0A 3A6ND 4J8XC 3W99C 4XZQA 2AROD 1M19B 3UTBA 3LZ0C 3MVDA 3X1VB 3W96B 3WAAD 2IO5C 3F6TA 3AZMD 3AZLB 4LD9C 3KUYC 3VH5W 3REIB 3WTPB 1U35B 1P3PB 2RIQA 3B0CW 4M6BA 5B32G 1S32A 1P3IC 3REHD 1HQ3C 3C1CB 5JA4B 3TU4C 2BYKB 3KXBD 4YM6A 3AZKB 4JJNC 3FDDA 3X1SD 1KX3A 5G49A 4NE3A 5B2ID 3EPLA 3LZ1B 5BT1C 3R45B 2W8SA 1AOIB 3AV2B 4WZSB 3AZGB 5B24B 1ZLAC 2HIOD 5AV6B 3X1TA 1P3GA 1B6WA 5AV5D 5JRGD 4CSRA 1P3AD 2Y2IA 4J8XB 3LELA 3W99B 3LZ0B 3MGQD 5CPJA 3IP4C 2IO5B 4LD9B 3MGPA 3KUYB 3C1BD 1P3KD 5B0YA 1B67A 1P3BD 1P3IB 4CAYA 1HQ3B 3W97A 1Z2CB 2NQBA 3TU4B 3MGSA 2CV5D 4JJNB 1P34D 4J8WA 5B2JC 3V9RB 4Z5TC 3AV1D 3B6GD 1EQZD 4WU8D 1TZYC 1ZLAB 5AV8D 1N1JA 1KX5D 4UUZB 2NZDC 3B6FC 3A6NA 5CPIC 3RELA 2CWEA 3AFAC 3AZEC 4H9RA 3VH6T 2F2AC 2RVQC 5DNND 5GSUC 5F99C 4XZQD 3MGRA 3UTBD 3MVDD 2J8PA 2YFWB 1BH9A 3REHA 5B1MA 2L5AA 1KX4D 3MNNA 1P3LA 4ZUXC 3KXBA 1M1AC 3B0DC 4UPKA 1S32D 5B32D 3AYWC 2F8NH 5B2JB 1M19A 5B2IA 4Z5TB 3X1VA 5B0ZC 3AZLA 2HIOA 3UTAC 3REIA 1TZYB 2YFVB 3WTPA 5CPKC 1M18C 2PYOD 3KWQD 5JRGA 2F8NB 5B40C 2NZDB 3B6FB 1TAFB 5CPIB 4NFTA 4H9OA 3X1TD 1P3GD 3AFAB 3AZEB 4XUJC 4H9NB 5FUGB 5AV9C 4X23C 3O62C 5GSUB 5F99B 4J8VC 3LELD 3C1BA 5KDMA 1P3KA 3LZ1A 3R45A 3AZJC 1AOIA 4ZBJC 3AV2A 3AZGA 5AV6A 4QLCC 3AZMC 3AZNC 3MGPD 3AZID 4ZUXB 4KUDC 5DNMC 1M1AB 3B0DB 3NQUB 5B0YD 1P34A 3EPKA 4J8XA 3W97D 3AYWB 5BS7C 1EQZA 5GXQC 5B0ZB 2LY8A 3REJC 3MGSD 4WNNB 4YS3C 4LD9A 3UTAB 3KUYA 4J8WD 5CPKB 1M18B 5B40B 2F8NK 1PZRA 1HQ3A 4R8PA 5GT0C 5B1LD 2FJ7C 5AY8D 5CP6C 4JJNA 4X23B 5AV9B 4H9SA 4EO5C 3V9RA 3RELD 3O62B 4J8VB 5B31C 3AZJB 1P3MB 4ZBJB 1KX4A 4Z66C 4QLCB 3AZNB 3AZMB 3MGRD 4KUDB 1Q9CA 5DNMB 5B32A 1HTAA 5B1MD 2UWXA 3MNND 1P3LD 4WU9D 5GXQB 4HGAC 5AVCC 2JCHA 3AZFA 3REJB 4YS3B 2PYOA 3KWQA 1M19D 3W96D 3X1VD 1BH8B 2YFWA 3EG5B 3LJAC 3H0LC 3AZLD 3REID 3WKJC 5GT0B 3WTPD 1P3PD 4H9QA 4NE5A 5E5AA 1KX5C 1ID3C 3KFUG 2FJ7B 2ZM5A 5CP6B 3C1CD 4EO5B 3WA9C 5BNVB 3AZKD 5DNNC 5B31B 1F66A 3AZIA 4Z66B 3LZ1D 3B6FA 1TAFA 1AOID 1P3OC 3AV2D 1P3FC 3AZGD 2XD1A 5AV6D 3AFAA 2XD5A 1KU5A 1H3OB 4H9NA 2FFFB 5FUGA 4HGAB 5AVCB 5GSUA 4J8XD 2Y2GA 3W99D 3AN2C 3UT9C 3LZ0D 3NQJA 2DF4C 3LJAB 4YM6C 4J8UC 4LD9D 1F1EA 3KUYD 3WKJB 5B1LA 4ZUXA 1KX3C 1M1AA 5GT3C 5AY8A 3X1UA 1KX5B 1ID3B 4KGCC 2Y2LA 1P3ID 1HQ3D 4DQYB 3REKC 4R8PD 3AYWA 3WA9B 3TU4D 5B0ZA 4WNNA 4JJND 5DNNB 5BO0B 5B33A 2Y2KA 5AVBC 4E44A 5B40A 2JE5A 5BT1D 4H9PB 5CPJC 1P3OB 1P3FB 3W98A 4WU9A 4WV4B 4Z2MG 4J8VA 3W96A 3W97C 3AN2B 3UT9B 2NQBC 3AZJA 1P3MA 2Y2OA 3AZFD 4G91C 4YM6B 3MGSC 4J8UB 3AZNA 1U35A 1P3PA 1KX3B 3AZHC 5GT3B 4KGCB 3C1CA 5JA4A 3REKB 2BYKA 5BS7A 1A7WA 5E5AD 5GXQA 3AZKA 1JFIB 3A6NC 4YS3A 5BNXB 4CSRB 4Z5TD 5AVBB 2AROC 1BH8A 4DRBA 3WAAC 5B24A 5CPJB 1F66D 1TZYD 3VH5A 2ZY2A 2FJ7A 2NZDD 2ZY3A 3B6FD 1BFMA 3REHC 5CPID 3W99A 5B1MC 3LZ0A 3AFAD 4CAYB 5C3IC 3AZED 3W97B 5B31G 3KXBC 2NQBB 2ZY5A 4Z66A 3X1SC 4G91B 5F99D 5GSUD 3MGSB 5B2IC 3AZHB 1P3IA 3TU4A 2HIOC 4ZUXD 3P5JB 3H0RC 2G5HC 5AV5C 1M1AD 1N1JB 3X1UD 4XUJB 5JRGC 4G92C 1P3AC 3A6NB 3AYWD 2AROB 5B0ZD 3MGQC 3A1KA 3LJAA 1ZLAA 3WAAB 4E45A 3WKJA 5B33D 5CPKD 4UUZA 1ID3A 3C1BC 1P3KC 5B40D 2Y2HA 2BYMB 1P3BC 3AV2C 3REHB 3W98D 3WA9A 5B1MB 3H0MC 5C3IB 3KXBB 4X23D 5AV9D 2CV5C 1P34C 3O62D 3X1SB 3WTPE 4J8VD 3AV1C 3B6GC 1EQZC 4H9PA 4KHAB 5B2IB 3AZJD 1P3MD 1P3OA 4WU8C 1P3FA 4QLCD 3AZND 1U35D 5AV8C 3A1IA 2HIOB 4KUDD 5AV5B 5DNMD 5JRGB 4G92B 5B2JA 1P3AB 4Z5TA 4R8PC 3AN2A 3UT9A 4H9OB 5GXQD 3MGQB 1TZYA 1T3UA 2YFVA 3KSYA 4J8UA 3REJD 4YS3D 2F8NG 4H9SC 2F8NA 4XZQC 5GT3A 2NZDA 3UTBC 3C1BB 3MVDC 5KDMB 1P3KB 4KGCA 5CPIA 5B24D 3REKA 1P3BB 5GT0D 3AZEA 1KX4C 1JFIA 2FJ7D 2HUEC 5CP6D 1S32C 5BNXA 5F99A 5B32C 2CV5B 1P34B 2DQNC 5AVBA 2G5IC 3AV1B 3B6GB 1EQZB 5B31D 3VH6A 4WU8B 4Z66D 3AZFC 5AV8B 2PYOC 3NQUA 3KWQC 3EPHA 3X1TC 4R8PB 1P3GC 4DRAA 5E5AC 5AVCD 3UTAA 5CPKA 1M18A 3LELC 3EPJA 4XZQB 3AZHA 3UTBB 3MVDB 3LJAD 1ZLAD 1F66C 3WKJD 3MGPC 3AZIC 1KX4B 1ID3D 4NE6A 4XUJA 5B0YC 5AV9A 2BG1A 4X23A 2HUEB 3O62A 1S32B 2Y2MA 5B32B 3WA9D 2AROA 1WWSA 3WAAA 1W2EA 4QLCA 3AZMA 1ULYA 3AZFB 4J8WC 4KUDA 5DNMA 2PYOB 2Y2JA 5G49B 3KWQB 4AWLC 2BYMA 1P3OD 1P3FD 2Y2PA 1R4VA 3X1TB 1P3GB 5B1LC 4H9QB 5E5AB 3X1UC 5AY8C 3REJA 2ZY4A 3X1SA 5B2JD 3RELC 2Y2NA 3LELB 3UT9D 3AN2D 4KHAA 5GT0A 4YM6D 4J8UD 3VH6W 1F66B 5B33C 2F8ND 3MGPB 3AZIB 5AV5A 3MGRC 1KX3D 5GT3D 5CP6A 4KGCD 5B0YB 1P3AA 5BNVA 2JSSA 3REKD 3W98C 3MNNC 1P3LC 4WU9C 2RVQD 3MGQA 5B31A 4WJ3C 5AVBD 4J8WB 1M19C 3W96C 3X1VC 4AWLB 5CPJD 1P3MC 1P3BA 3AZLC 3NQJB 3REIC 3WTPC 1H3OA 1U35C 1P3PC 5AVCA 5B1LB 2VQRA 1WWIA 5AY8B 3X1UB 2CV5A 3C1CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 A;  3REL B;  3B6G A;  4H9R B;  2NQB D;  3AZK C;  3VH5 T;  4WU8 A;  3UTA D;  1M18 D;  5AV8 A;  3B0C T;  1KX5 A;  4Z2M H;  5B33 B;  3AZH D;  3MGR B;  3LZ1 C;  3B0B A;  1AOI C;  1BH9 B;  5CHL B;  3AZG C;  5B24 C;  5AV6 C;  3W98 B;  3MNN B;  1P3L B;  4WU9 B;  4XUJ D;  5DNN A;  5BO0 A;  3A6N D;  4J8X C;  3W99 C;  4XZQ A;  2ARO D;  1M19 B;  3UTB A;  3LZ0 C;  3MVD A;  3X1V B;  3W96 B;  3WAA D;  2IO5 C;  3AZM D;  3AZL B;  4LD9 C;  3KUY C;  3VH5 W;  3REI B;  3WTP B;  1U35 B;  1P3P B;  3B0C W;  4M6B A;  5B32 G;  1S32 A;  1P3I C;  3REH D;  1HQ3 C;  3C1C B;  5JA4 B;  3TU4 C;  2BYK B;  3KXB D;  4YM6 A;  3AZK B;  4JJN C;  3X1S D;  1KX3 A;  5G49 A;  4NE3 A;  5B2I D;  3LZ1 B;  5BT1 C;  3R45 B;  1AOI B;  3AV2 B;  4WZS B;  3AZG B;  5B24 B;  1ZLA C;  2HIO D;  5AV6 B;  3X1T A;  1P3G A;  1B6W A;  5AV5 D;  5JRG D;  4CSR A;  1P3A D;  4J8X B;  3LEL A;  3W99 B;  3LZ0 B;  3MGQ D;  5CPJ A;  2IO5 B;  4LD9 B;  3MGP A;  3KUY B;  3C1B D;  1P3K D;  5B0Y A;  1B67 A;  1P3B D;  1P3I B;  4CAY A;  1HQ3 B;  3W97 A;  2NQB A;  3TU4 B;  3MGS A;  2CV5 D;  4JJN B;  1P34 D;  4J8W A;  5B2J C;  3V9R B;  4Z5T C;  3AV1 D;  3B6G D;  1EQZ D;  4WU8 D;  1TZY C;  1ZLA B;  5AV8 D;  1N1J A;  1KX5 D;  4UUZ B;  2NZD C;  3B6F C;  3A6N A;  5CPI C;  3REL A;  2CWE A;  3AFA C;  3AZE C;  4H9R A;  3VH6 T;  2RVQ C;  5DNN D;  5GSU C;  5F99 C;  4XZQ D;  3MGR A;  3UTB D;  3MVD D;  2YFW B;  1BH9 A;  3REH A;  5B1M A;  2L5A A;  1KX4 D;  3MNN A;  1P3L A;  4ZUX C;  3KXB A;  1M1A C;  3B0D C;  1S32 D;  5B32 D;  3AYW C;  2F8N H;  5B2J B;  1M19 A;  5B2I A;  4Z5T B;  3X1V A;  5B0Z C;  3AZL A;  2HIO A;  3UTA C;  3REI A;  1TZY B;  2YFV B;  3WTP A;  5CPK C;  1M18 C;  2PYO D;  3KWQ D;  5JRG A;  2F8N B;  5B40 C;  2NZD B;  3B6F B;  1TAF B;  5CPI B;  4NFT A;  4H9O A;  3X1T D;  1P3G D;  3AFA B;  3AZE B;  4XUJ C;  4H9N B;  5FUG B;  5AV9 C;  4X23 C;  3O62 C;  5GSU B;  5F99 B;  4J8V C;  3LEL D;  3C1B A;  5KDM A;  1P3K A;  3LZ1 A;  3R45 A;  3AZJ C;  1AOI A;  4ZBJ C;  3AV2 A;  3AZG A;  5AV6 A;  4QLC C;  3AZM C;  3AZN C;  3MGP D;  3AZI D;  4ZUX B;  4KUD C;  5DNM C;  1M1A B;  3B0D B;  3NQU B;  5B0Y D;  1P34 A;  4J8X A;  3W97 D;  3AYW B;  5BS7 C;  1EQZ A;  5GXQ C;  5B0Z B;  2LY8 A;  3REJ C;  3MGS D;  4WNN B;  4YS3 C;  4LD9 A;  3UTA B;  3KUY A;  4J8W D;  5CPK B;  1M18 B;  5B40 B;  2F8N K;  1HQ3 A;  4R8P A;  5GT0 C;  5B1L D;  2FJ7 C;  5AY8 D;  5CP6 C;  4JJN A;  4X23 B;  5AV9 B;  4H9S A;  4EO5 C;  3V9R A;  3REL D;  3O62 B;  4J8V B;  5B31 C;  3AZJ B;  1P3M B;  4ZBJ B;  1KX4 A;  4Z66 C;  4QLC B;  3AZN B;  3AZM B;  3MGR D;  4KUD B;  1Q9C A;  5DNM B;  5B32 A;  1HTA A;  5B1M D;  3MNN D;  1P3L D;  4WU9 D;  5GXQ B;  4HGA C;  5AVC C;  3AZF A;  3REJ B;  4YS3 B;  2PYO A;  3KWQ A;  1M19 D;  3W96 D;  3X1V D;  1BH8 B;  2YFW A;  3LJA C;  3AZL D;  3REI D;  3WKJ C;  5GT0 B;  3WTP D;  1P3P D;  4H9Q A;  4NE5 A;  5E5A A;  1KX5 C;  1ID3 C;  2FJ7 B;  5CP6 B;  3C1C D;  4EO5 B;  3WA9 C;  5BNV B;  3AZK D;  5DNN C;  5B31 B;  1F66 A;  3AZI A;  4Z66 B;  3LZ1 D;  3B6F A;  1TAF A;  1AOI D;  1P3O C;  3AV2 D;  1P3F C;  3AZG D;  5AV6 D;  3AFA A;  1KU5 A;  1H3O B;  4H9N A;  5FUG A;  4HGA B;  5AVC B;  5GSU A;  4J8X D;  3W99 D;  3AN2 C;  3UT9 C;  3LZ0 D;  3NQJ A;  3LJA B;  4YM6 C;  4J8U C;  4LD9 D;  1F1E A;  3KUY D;  3WKJ B;  5B1L A;  4ZUX A;  1KX3 C;  1M1A A;  5GT3 C;  5AY8 A;  3X1U A;  1KX5 B;  1ID3 B;  4KGC C;  1P3I D;  1HQ3 D;  3REK C;  3AYW A;  4R8P D;  3WA9 B;  3TU4 D;  5B0Z A;  4WNN A;  4JJN D;  5DNN B;  5BO0 B;  5B33 A;  5AVB C;  4E44 A;  5B40 A;  5BT1 D;  4H9P B;  5CPJ C;  1P3O B;  1P3F B;  3W98 A;  4WU9 A;  4WV4 B;  4Z2M G;  4J8V A;  3W96 A;  3W97 C;  3AN2 B;  3UT9 B;  2NQB C;  3AZJ A;  1P3M A;  3AZF D;  4G91 C;  4YM6 B;  3MGS C;  4J8U B;  3AZN A;  1U35 A;  1P3P A;  1KX3 B;  3AZH C;  5GT3 B;  4KGC B;  3C1C A;  5JA4 A;  3REK B;  2BYK A;  5BS7 A;  1A7W A;  5E5A D;  5GXQ A;  3AZK A;  1JFI B;  3A6N C;  4YS3 A;  5BNX B;  4CSR B;  4Z5T D;  5AVB B;  2ARO C;  1BH8 A;  4DRB A;  3WAA C;  5B24 A;  5CPJ B;  1F66 D;  1TZY D;  3VH5 A;  2FJ7 A;  2NZD D;  3B6F D;  1BFM A;  3REH C;  5CPI D;  3W99 A;  5B1M C;  3LZ0 A;  3AFA D;  4CAY B;  5C3I C;  3AZE D;  3W97 B;  5B31 G;  3KXB C;  2NQB B;  4Z66 A;  3X1S C;  4G91 B;  5F99 D;  5GSU D;  3MGS B;  5B2I C;  3AZH B;  1P3I A;  3TU4 A;  2HIO C;  4ZUX D;  5AV5 C;  1M1A D;  1N1J B;  3X1U D;  4XUJ B;  5JRG C;  4G92 C;  1P3A C;  3A6N B;  3AYW D;  2ARO B;  5B0Z D;  3MGQ C;  3LJA A;  1ZLA A;  3WAA B;  4E45 A;  3WKJ A;  5B33 D;  5CPK D;  4UUZ A;  1ID3 A;  3C1B C;  1P3K C;  5B40 D;  2BYM B;  1P3B C;  3AV2 C;  3REH B;  3W98 D;  3WA9 A;  5B1M B;  5C3I B;  3KXB B;  4X23 D;  5AV9 D;  2CV5 C;  1P34 C;  3O62 D;  3X1S B;  3WTP E;  4J8V D;  3AV1 C;  3B6G C;  1EQZ C;  4H9P A;  4KHA B;  5B2I B;  3AZJ D;  1P3M D;  1P3O A;  4WU8 C;  1P3F A;  4QLC D;  3AZN D;  1U35 D;  5AV8 C;  2HIO B;  4KUD D;  5AV5 B;  5DNM D;  5JRG B;  4G92 B;  5B2J A;  1P3A B;  4Z5T A;  4R8P C;  3AN2 A;  3UT9 A;  4H9O B;  5GXQ D;  3MGQ B;  1TZY A;  2YFV A;  3KSY A;  4J8U A;  3REJ D;  4YS3 D;  2F8N G;  4H9S C;  2F8N A;  4XZQ C;  5GT3 A;  2NZD A;  3UTB C;  3C1B B;  3MVD C;  5KDM B;  1P3K B;  4KGC A;  5CPI A;  5B24 D;  3REK A;  1P3B B;  5GT0 D;  3AZE A;  1KX4 C;  1JFI A;  2FJ7 D;  2HUE C;  5CP6 D;  1S32 C;  5BNX A;  5F99 A;  5B32 C;  2CV5 B;  1P34 B;  5AVB A;  3AV1 B;  3B6G B;  1EQZ B;  5B31 D;  3VH6 A;  4WU8 B;  4Z66 D;  3AZF C;  5AV8 B;  2PYO C;  3NQU A;  3KWQ C;  3X1T C;  4R8P B;  1P3G C;  4DRA A;  5E5A C;  5AVC D;  3UTA A;  5CPK A;  1M18 A;  3LEL C;  4XZQ B;  3AZH A;  3UTB B;  3MVD B;  3LJA D;  1ZLA D;  1F66 C;  3WKJ D;  3MGP C;  3AZI C;  1KX4 B;  1ID3 D;  4NE6 A;  4XUJ A;  5B0Y C;  5AV9 A;  4X23 A;  2HUE B;  3O62 A;  1S32 B;  5B32 B;  3WA9 D;  2ARO A;  1WWS A;  3WAA A;  4QLC A;  3AZM A;  1ULY A;  3AZF B;  4J8W C;  4KUD A;  5DNM A;  2PYO B;  5G49 B;  3KWQ B;  4AWL C;  2BYM A;  1P3O D;  1P3F D;  1R4V A;  3X1T B;  1P3G B;  5B1L C;  4H9Q B;  5E5A B;  3X1U C;  5AY8 C;  3REJ A;  3X1S A;  5B2J D;  3REL C;  3AN2 D;  3LEL B;  3UT9 D;  4KHA A;  5GT0 A;  4YM6 D;  4J8U D;  3VH6 W;  1F66 B;  5B33 C;  2F8N D;  3MGP B;  3AZI B;  5AV5 A;  3MGR C;  1KX3 D;  5GT3 D;  5CP6 A;  4KGC D;  5B0Y B;  1P3A A;  5BNV A;  2JSS A;  3REK D;  3W98 C;  3MNN C;  1P3L C;  4WU9 C;  2RVQ D;  3MGQ A;  5B31 A;  5AVB D;  4J8W B;  1M19 C;  3W96 C;  3X1V C;  4AWL B;  5CPJ D;  1P3M C;  1P3B A;  3AZL C;  3NQJ B;  3REI C;  3WTP C;  1H3O A;  1U35 C;  1P3P C;  5AVC A;  5B1L B;  1WWI A;  5AY8 B;  3X1U B;  2CV5 A;  3C1C C; 
#chains in the Genus database with same CATH topology
 3AV1 A;  3REL B;  3B6G A;  4H9R B;  2NQB D;  3AL0 C;  3AZK C;  3VH5 T;  4WU8 A;  3UTA D;  1M18 D;  5AV8 A;  3B0C T;  1KX5 A;  4Z2M H;  5B33 B;  2Y2Q A;  3AZH D;  3MGR B;  3LZ1 C;  3B0B A;  1AOI C;  1BH9 B;  5CHL B;  3AZG C;  5B24 C;  5AV6 C;  3W98 B;  3MNN B;  1P3L B;  4WU9 B;  4XUJ D;  5DNN A;  5BO0 A;  3A6N D;  4J8X C;  3W99 C;  4XZQ A;  2ARO D;  1M19 B;  3UTB A;  3LZ0 C;  3MVD A;  3X1V B;  3W96 B;  3WAA D;  2IO5 C;  3F6T A;  3AZM D;  3AZL B;  4LD9 C;  3KUY C;  3VH5 W;  3REI B;  3WTP B;  1U35 B;  1P3P B;  2RIQ A;  3B0C W;  4M6B A;  5B32 G;  1S32 A;  1P3I C;  3REH D;  1HQ3 C;  3C1C B;  5JA4 B;  3TU4 C;  2BYK B;  3KXB D;  4YM6 A;  3AZK B;  4JJN C;  3FDD A;  3X1S D;  1KX3 A;  5G49 A;  4NE3 A;  5B2I D;  3EPL A;  3LZ1 B;  5BT1 C;  3R45 B;  2W8S A;  1AOI B;  3AV2 B;  4WZS B;  3AZG B;  5B24 B;  1ZLA C;  2HIO D;  5AV6 B;  3X1T A;  1P3G A;  1B6W A;  5AV5 D;  5JRG D;  4CSR A;  1P3A D;  2Y2I A;  4J8X B;  3LEL A;  3W99 B;  3LZ0 B;  3MGQ D;  5CPJ A;  3IP4 C;  2IO5 B;  4LD9 B;  3MGP A;  3KUY B;  3C1B D;  1P3K D;  5B0Y A;  1B67 A;  1P3B D;  1P3I B;  4CAY A;  1HQ3 B;  3W97 A;  1Z2C B;  2NQB A;  3TU4 B;  3MGS A;  2CV5 D;  4JJN B;  1P34 D;  4J8W A;  5B2J C;  3V9R B;  4Z5T C;  3AV1 D;  3B6G D;  1EQZ D;  4WU8 D;  1TZY C;  1ZLA B;  5AV8 D;  1N1J A;  1KX5 D;  4UUZ B;  2NZD C;  3B6F C;  3A6N A;  5CPI C;  3REL A;  2CWE A;  3AFA C;  3AZE C;  4H9R A;  3VH6 T;  2F2A C;  2RVQ C;  5DNN D;  5GSU C;  5F99 C;  4XZQ D;  3MGR A;  3UTB D;  3MVD D;  2J8P A;  2YFW B;  1BH9 A;  3REH A;  5B1M A;  2L5A A;  1KX4 D;  3MNN A;  1P3L A;  4ZUX C;  3KXB A;  1M1A C;  3B0D C;  4UPK A;  1S32 D;  5B32 D;  3AYW C;  2F8N H;  5B2J B;  1M19 A;  5B2I A;  4Z5T B;  3X1V A;  5B0Z C;  3AZL A;  2HIO A;  3UTA C;  3REI A;  1TZY B;  2YFV B;  3WTP A;  5CPK C;  1M18 C;  2PYO D;  3KWQ D;  5JRG A;  2F8N B;  5B40 C;  2NZD B;  3B6F B;  1TAF B;  5CPI B;  4NFT A;  4H9O A;  3X1T D;  1P3G D;  3AFA B;  3AZE B;  4XUJ C;  4H9N B;  5FUG B;  5AV9 C;  4X23 C;  3O62 C;  5GSU B;  5F99 B;  4J8V C;  3LEL D;  3C1B A;  5KDM A;  1P3K A;  3LZ1 A;  3R45 A;  3AZJ C;  1AOI A;  4ZBJ C;  3AV2 A;  3AZG A;  5AV6 A;  4QLC C;  3AZM C;  3AZN C;  3MGP D;  3AZI D;  4ZUX B;  4KUD C;  5DNM C;  1M1A B;  3B0D B;  3NQU B;  5B0Y D;  1P34 A;  3EPK A;  4J8X A;  3W97 D;  3AYW B;  5BS7 C;  1EQZ A;  5GXQ C;  5B0Z B;  2LY8 A;  3REJ C;  3MGS D;  4WNN B;  4YS3 C;  4LD9 A;  3UTA B;  3KUY A;  4J8W D;  5CPK B;  1M18 B;  5B40 B;  2F8N K;  1PZR A;  1HQ3 A;  4R8P A;  5GT0 C;  5B1L D;  2FJ7 C;  5AY8 D;  5CP6 C;  4JJN A;  4X23 B;  5AV9 B;  4H9S A;  4EO5 C;  3V9R A;  3REL D;  3O62 B;  4J8V B;  5B31 C;  3AZJ B;  1P3M B;  4ZBJ B;  1KX4 A;  4Z66 C;  4QLC B;  3AZN B;  3AZM B;  3MGR D;  4KUD B;  1Q9C A;  5DNM B;  5B32 A;  1HTA A;  5B1M D;  2UWX A;  3MNN D;  1P3L D;  4WU9 D;  5GXQ B;  4HGA C;  5AVC C;  2JCH A;  3AZF A;  3REJ B;  4YS3 B;  2PYO A;  3KWQ A;  1M19 D;  3W96 D;  3X1V D;  1BH8 B;  2YFW A;  3EG5 B;  3LJA C;  3H0L C;  3AZL D;  3REI D;  3WKJ C;  5GT0 B;  3WTP D;  1P3P D;  4H9Q A;  4NE5 A;  5E5A A;  1KX5 C;  1ID3 C;  3KFU G;  2FJ7 B;  2ZM5 A;  5CP6 B;  3C1C D;  4EO5 B;  3WA9 C;  5BNV B;  3AZK D;  5DNN C;  5B31 B;  1F66 A;  3AZI A;  4Z66 B;  3LZ1 D;  3B6F A;  1TAF A;  1AOI D;  1P3O C;  3AV2 D;  1P3F C;  3AZG D;  2XD1 A;  5AV6 D;  3AFA A;  2XD5 A;  1KU5 A;  1H3O B;  4H9N A;  2FFF B;  5FUG A;  4HGA B;  5AVC B;  5GSU A;  4J8X D;  2Y2G A;  3W99 D;  3AN2 C;  3UT9 C;  3LZ0 D;  3NQJ A;  2DF4 C;  3LJA B;  4YM6 C;  4J8U C;  4LD9 D;  1F1E A;  3KUY D;  3WKJ B;  5B1L A;  4ZUX A;  1KX3 C;  1M1A A;  5GT3 C;  5AY8 A;  3X1U A;  1KX5 B;  1ID3 B;  4KGC C;  2Y2L A;  1P3I D;  1HQ3 D;  4DQY B;  3REK C;  4R8P D;  3AYW A;  3WA9 B;  3TU4 D;  5B0Z A;  4WNN A;  4JJN D;  5DNN B;  5BO0 B;  5B33 A;  2Y2K A;  5AVB C;  4E44 A;  5B40 A;  2JE5 A;  5BT1 D;  4H9P B;  5CPJ C;  1P3O B;  1P3F B;  3W98 A;  4WU9 A;  4WV4 B;  4Z2M G;  4J8V A;  3W96 A;  3W97 C;  3AN2 B;  3UT9 B;  2NQB C;  3AZJ A;  1P3M A;  2Y2O A;  3AZF D;  4G91 C;  4YM6 B;  3MGS C;  4J8U B;  3AZN A;  1U35 A;  1P3P A;  1KX3 B;  3AZH C;  5GT3 B;  4KGC B;  3C1C A;  5JA4 A;  3REK B;  2BYK A;  5BS7 A;  1A7W A;  5E5A D;  5GXQ A;  3AZK A;  1JFI B;  3A6N C;  4YS3 A;  5BNX B;  4CSR B;  4Z5T D;  5AVB B;  2ARO C;  1BH8 A;  4DRB A;  3WAA C;  5B24 A;  5CPJ B;  1F66 D;  1TZY D;  3VH5 A;  2ZY2 A;  2FJ7 A;  2NZD D;  2ZY3 A;  3B6F D;  1BFM A;  3REH C;  5CPI D;  3W99 A;  5B1M C;  3LZ0 A;  3AFA D;  4CAY B;  5C3I C;  3AZE D;  3W97 B;  5B31 G;  3KXB C;  2NQB B;  2ZY5 A;  4Z66 A;  3X1S C;  4G91 B;  5F99 D;  5GSU D;  3MGS B;  5B2I C;  3AZH B;  1P3I A;  3TU4 A;  2HIO C;  4ZUX D;  3P5J B;  3H0R C;  2G5H C;  5AV5 C;  1M1A D;  1N1J B;  3X1U D;  4XUJ B;  5JRG C;  4G92 C;  1P3A C;  3A6N B;  3AYW D;  2ARO B;  5B0Z D;  3MGQ C;  3A1K A;  3LJA A;  1ZLA A;  3WAA B;  4E45 A;  3WKJ A;  5B33 D;  5CPK D;  4UUZ A;  1ID3 A;  3C1B C;  1P3K C;  5B40 D;  2Y2H A;  2BYM B;  1P3B C;  3AV2 C;  3REH B;  3W98 D;  3WA9 A;  5B1M B;  3H0M C;  5C3I B;  3KXB B;  4X23 D;  5AV9 D;  2CV5 C;  1P34 C;  3O62 D;  3X1S B;  3WTP E;  4J8V D;  3AV1 C;  3B6G C;  1EQZ C;  4H9P A;  4KHA B;  5B2I B;  3AZJ D;  1P3M D;  1P3O A;  4WU8 C;  1P3F A;  4QLC D;  3AZN D;  1U35 D;  5AV8 C;  3A1I A;  2HIO B;  4KUD D;  5AV5 B;  5DNM D;  5JRG B;  4G92 B;  5B2J A;  1P3A B;  4Z5T A;  4R8P C;  3AN2 A;  3UT9 A;  4H9O B;  5GXQ D;  3MGQ B;  1TZY A;  1T3U A;  2YFV A;  3KSY A;  4J8U A;  3REJ D;  4YS3 D;  2F8N G;  4H9S C;  2F8N A;  4XZQ C;  5GT3 A;  2NZD A;  3UTB C;  3C1B B;  3MVD C;  5KDM B;  1P3K B;  4KGC A;  5CPI A;  5B24 D;  3REK A;  1P3B B;  5GT0 D;  3AZE A;  1KX4 C;  1JFI A;  2FJ7 D;  2HUE C;  5CP6 D;  1S32 C;  5BNX A;  5F99 A;  5B32 C;  2CV5 B;  1P34 B;  2DQN C;  5AVB A;  2G5I C;  3AV1 B;  3B6G B;  1EQZ B;  5B31 D;  3VH6 A;  4WU8 B;  4Z66 D;  3AZF C;  5AV8 B;  2PYO C;  3NQU A;  3KWQ C;  3EPH A;  3X1T C;  4R8P B;  1P3G C;  4DRA A;  5E5A C;  5AVC D;  3UTA A;  5CPK A;  1M18 A;  3LEL C;  3EPJ A;  4XZQ B;  3AZH A;  3UTB B;  3MVD B;  3LJA D;  1ZLA D;  1F66 C;  3WKJ D;  3MGP C;  3AZI C;  1KX4 B;  1ID3 D;  4NE6 A;  4XUJ A;  5B0Y C;  5AV9 A;  2BG1 A;  4X23 A;  2HUE B;  3O62 A;  1S32 B;  2Y2M A;  5B32 B;  3WA9 D;  2ARO A;  1WWS A;  3WAA A;  1W2E A;  4QLC A;  3AZM A;  1ULY A;  3AZF B;  4J8W C;  4KUD A;  5DNM A;  2PYO B;  2Y2J A;  5G49 B;  3KWQ B;  4AWL C;  2BYM A;  1P3O D;  1P3F D;  2Y2P A;  1R4V A;  3X1T B;  1P3G B;  5B1L C;  4H9Q B;  5E5A B;  3X1U C;  5AY8 C;  3REJ A;  2ZY4 A;  3X1S A;  5B2J D;  3REL C;  2Y2N A;  3LEL B;  3UT9 D;  3AN2 D;  4KHA A;  5GT0 A;  4YM6 D;  4J8U D;  3VH6 W;  1F66 B;  5B33 C;  2F8N D;  3MGP B;  3AZI B;  5AV5 A;  3MGR C;  1KX3 D;  5GT3 D;  5CP6 A;  4KGC D;  5B0Y B;  1P3A A;  5BNV A;  2JSS A;  3REK D;  3W98 C;  3MNN C;  1P3L C;  4WU9 C;  2RVQ D;  3MGQ A;  5B31 A;  4WJ3 C;  5AVB D;  4J8W B;  1M19 C;  3W96 C;  3X1V C;  4AWL B;  5CPJ D;  1P3M C;  1P3B A;  3AZL C;  3NQJ B;  3REI C;  3WTP C;  1H3O A;  1U35 C;  1P3P C;  5AVC A;  5B1L B;  2VQR A;  1WWI A;  5AY8 B;  3X1U B;  2CV5 A;  3C1C C; 
#chains in the Genus database with same CATH homology
 3AV1 A;  3REL B;  3B6G A;  4H9R B;  2NQB D;  3AL0 C;  3AZK C;  3VH5 T;  4WU8 A;  3UTA D;  1M18 D;  5AV8 A;  3B0C T;  1KX5 A;  4Z2M H;  5B33 B;  2Y2Q A;  3AZH D;  3MGR B;  3LZ1 C;  3B0B A;  1AOI C;  1BH9 B;  5CHL B;  3AZG C;  5B24 C;  5AV6 C;  3W98 B;  3MNN B;  1P3L B;  4WU9 B;  4XUJ D;  5DNN A;  5BO0 A;  3A6N D;  4J8X C;  3W99 C;  4XZQ A;  2ARO D;  1M19 B;  3UTB A;  3LZ0 C;  3MVD A;  3X1V B;  3W96 B;  3WAA D;  2IO5 C;  3F6T A;  3AZM D;  3AZL B;  4LD9 C;  3KUY C;  3VH5 W;  3REI B;  3WTP B;  1U35 B;  1P3P B;  2RIQ A;  3B0C W;  4M6B A;  5B32 G;  1S32 A;  1P3I C;  3REH D;  1HQ3 C;  3C1C B;  5JA4 B;  3TU4 C;  2BYK B;  3KXB D;  4YM6 A;  3AZK B;  4JJN C;  3FDD A;  3X1S D;  1KX3 A;  5G49 A;  4NE3 A;  5B2I D;  3EPL A;  3LZ1 B;  5BT1 C;  3R45 B;  2W8S A;  1AOI B;  3AV2 B;  4WZS B;  3AZG B;  5B24 B;  1ZLA C;  2HIO D;  5AV6 B;  3X1T A;  1P3G A;  1B6W A;  5AV5 D;  5JRG D;  4CSR A;  1P3A D;  2Y2I A;  4J8X B;  3LEL A;  3W99 B;  3LZ0 B;  3MGQ D;  5CPJ A;  3IP4 C;  2IO5 B;  4LD9 B;  3MGP A;  3KUY B;  3C1B D;  1P3K D;  5B0Y A;  1B67 A;  1P3B D;  1P3I B;  4CAY A;  1HQ3 B;  3W97 A;  1Z2C B;  2NQB A;  3TU4 B;  3MGS A;  2CV5 D;  4JJN B;  1P34 D;  4J8W A;  5B2J C;  3V9R B;  4Z5T C;  3AV1 D;  3B6G D;  1EQZ D;  4WU8 D;  1TZY C;  1ZLA B;  5AV8 D;  1N1J A;  1KX5 D;  4UUZ B;  2NZD C;  3B6F C;  3A6N A;  5CPI C;  3REL A;  2CWE A;  3AFA C;  3AZE C;  4H9R A;  3VH6 T;  2F2A C;  2RVQ C;  5DNN D;  5GSU C;  5F99 C;  4XZQ D;  3MGR A;  3UTB D;  3MVD D;  2J8P A;  2YFW B;  1BH9 A;  3REH A;  5B1M A;  2L5A A;  1KX4 D;  3MNN A;  1P3L A;  4ZUX C;  3KXB A;  1M1A C;  3B0D C;  4UPK A;  1S32 D;  5B32 D;  3AYW C;  2F8N H;  5B2J B;  1M19 A;  5B2I A;  4Z5T B;  3X1V A;  5B0Z C;  3AZL A;  2HIO A;  3UTA C;  3REI A;  1TZY B;  2YFV B;  3WTP A;  5CPK C;  1M18 C;  2PYO D;  3KWQ D;  5JRG A;  2F8N B;  5B40 C;  2NZD B;  3B6F B;  1TAF B;  5CPI B;  4NFT A;  4H9O A;  3X1T D;  1P3G D;  3AFA B;  3AZE B;  4XUJ C;  4H9N B;  5FUG B;  5AV9 C;  4X23 C;  3O62 C;  5GSU B;  5F99 B;  4J8V C;  3LEL D;  3C1B A;  5KDM A;  1P3K A;  3LZ1 A;  3R45 A;  3AZJ C;  1AOI A;  4ZBJ C;  3AV2 A;  3AZG A;  5AV6 A;  4QLC C;  3AZM C;  3AZN C;  3MGP D;  3AZI D;  4ZUX B;  4KUD C;  5DNM C;  1M1A B;  3B0D B;  3NQU B;  5B0Y D;  1P34 A;  3EPK A;  4J8X A;  3W97 D;  3AYW B;  5BS7 C;  1EQZ A;  5GXQ C;  5B0Z B;  2LY8 A;  3REJ C;  3MGS D;  4WNN B;  4YS3 C;  4LD9 A;  3UTA B;  3KUY A;  4J8W D;  5CPK B;  1M18 B;  5B40 B;  2F8N K;  1PZR A;  1HQ3 A;  4R8P A;  5GT0 C;  5B1L D;  2FJ7 C;  5AY8 D;  5CP6 C;  4JJN A;  4X23 B;  5AV9 B;  4H9S A;  4EO5 C;  3V9R A;  3REL D;  3O62 B;  4J8V B;  5B31 C;  3AZJ B;  1P3M B;  4ZBJ B;  1KX4 A;  4Z66 C;  4QLC B;  3AZN B;  3AZM B;  3MGR D;  4KUD B;  1Q9C A;  5DNM B;  5B32 A;  1HTA A;  5B1M D;  2UWX A;  3MNN D;  1P3L D;  4WU9 D;  5GXQ B;  4HGA C;  5AVC C;  2JCH A;  3AZF A;  3REJ B;  4YS3 B;  2PYO A;  3KWQ A;  1M19 D;  3W96 D;  3X1V D;  1BH8 B;  2YFW A;  3EG5 B;  3LJA C;  3H0L C;  3AZL D;  3REI D;  3WKJ C;  5GT0 B;  3WTP D;  1P3P D;  4H9Q A;  4NE5 A;  5E5A A;  1KX5 C;  1ID3 C;  3KFU G;  2FJ7 B;  2ZM5 A;  5CP6 B;  3C1C D;  4EO5 B;  3WA9 C;  5BNV B;  3AZK D;  5DNN C;  5B31 B;  1F66 A;  3AZI A;  4Z66 B;  3LZ1 D;  3B6F A;  1TAF A;  1AOI D;  1P3O C;  3AV2 D;  1P3F C;  3AZG D;  2XD1 A;  5AV6 D;  3AFA A;  2XD5 A;  1KU5 A;  1H3O B;  4H9N A;  2FFF B;  5FUG A;  4HGA B;  5AVC B;  5GSU A;  4J8X D;  2Y2G A;  3W99 D;  3AN2 C;  3UT9 C;  3LZ0 D;  3NQJ A;  2DF4 C;  3LJA B;  4YM6 C;  4J8U C;  4LD9 D;  1F1E A;  3KUY D;  3WKJ B;  5B1L A;  4ZUX A;  1KX3 C;  1M1A A;  5GT3 C;  5AY8 A;  3X1U A;  1KX5 B;  1ID3 B;  4KGC C;  2Y2L A;  1P3I D;  1HQ3 D;  4DQY B;  3REK C;  4R8P D;  3AYW A;  3WA9 B;  3TU4 D;  5B0Z A;  4WNN A;  4JJN D;  5DNN B;  5BO0 B;  5B33 A;  2Y2K A;  5AVB C;  4E44 A;  5B40 A;  2JE5 A;  5BT1 D;  4H9P B;  5CPJ C;  1P3O B;  1P3F B;  3W98 A;  4WU9 A;  4WV4 B;  4Z2M G;  4J8V A;  3W96 A;  3W97 C;  3AN2 B;  3UT9 B;  2NQB C;  3AZJ A;  1P3M A;  2Y2O A;  3AZF D;  4G91 C;  4YM6 B;  3MGS C;  4J8U B;  3AZN A;  1U35 A;  1P3P A;  1KX3 B;  3AZH C;  5GT3 B;  4KGC B;  3C1C A;  5JA4 A;  3REK B;  2BYK A;  5BS7 A;  1A7W A;  5E5A D;  5GXQ A;  3AZK A;  1JFI B;  3A6N C;  4YS3 A;  5BNX B;  4CSR B;  4Z5T D;  5AVB B;  2ARO C;  1BH8 A;  4DRB A;  3WAA C;  5B24 A;  5CPJ B;  1F66 D;  1TZY D;  3VH5 A;  2ZY2 A;  2FJ7 A;  2NZD D;  2ZY3 A;  3B6F D;  1BFM A;  3REH C;  5CPI D;  3W99 A;  5B1M C;  3LZ0 A;  3AFA D;  4CAY B;  5C3I C;  3AZE D;  3W97 B;  5B31 G;  3KXB C;  2NQB B;  2ZY5 A;  4Z66 A;  3X1S C;  4G91 B;  5F99 D;  5GSU D;  3MGS B;  5B2I C;  3AZH B;  1P3I A;  3TU4 A;  2HIO C;  4ZUX D;  3P5J B;  3H0R C;  2G5H C;  5AV5 C;  1M1A D;  1N1J B;  3X1U D;  4XUJ B;  5JRG C;  4G92 C;  1P3A C;  3A6N B;  3AYW D;  2ARO B;  5B0Z D;  3MGQ C;  3A1K A;  3LJA A;  1ZLA A;  3WAA B;  4E45 A;  3WKJ A;  5B33 D;  5CPK D;  4UUZ A;  1ID3 A;  3C1B C;  1P3K C;  5B40 D;  2Y2H A;  2BYM B;  1P3B C;  3AV2 C;  3REH B;  3W98 D;  3WA9 A;  5B1M B;  3H0M C;  5C3I B;  3KXB B;  4X23 D;  5AV9 D;  2CV5 C;  1P34 C;  3O62 D;  3X1S B;  3WTP E;  4J8V D;  3AV1 C;  3B6G C;  1EQZ C;  4H9P A;  4KHA B;  5B2I B;  3AZJ D;  1P3M D;  1P3O A;  4WU8 C;  1P3F A;  4QLC D;  3AZN D;  1U35 D;  5AV8 C;  3A1I A;  2HIO B;  4KUD D;  5AV5 B;  5DNM D;  5JRG B;  4G92 B;  5B2J A;  1P3A B;  4Z5T A;  4R8P C;  3AN2 A;  3UT9 A;  4H9O B;  5GXQ D;  3MGQ B;  1TZY A;  1T3U A;  2YFV A;  3KSY A;  4J8U A;  3REJ D;  4YS3 D;  2F8N G;  4H9S C;  2F8N A;  4XZQ C;  5GT3 A;  2NZD A;  3UTB C;  3C1B B;  3MVD C;  5KDM B;  1P3K B;  4KGC A;  5CPI A;  5B24 D;  3REK A;  1P3B B;  5GT0 D;  3AZE A;  1KX4 C;  1JFI A;  2FJ7 D;  2HUE C;  5CP6 D;  1S32 C;  5BNX A;  5F99 A;  5B32 C;  2CV5 B;  1P34 B;  2DQN C;  5AVB A;  2G5I C;  3AV1 B;  3B6G B;  1EQZ B;  5B31 D;  3VH6 A;  4WU8 B;  4Z66 D;  3AZF C;  5AV8 B;  2PYO C;  3NQU A;  3KWQ C;  3EPH A;  3X1T C;  4R8P B;  1P3G C;  4DRA A;  5E5A C;  5AVC D;  3UTA A;  5CPK A;  1M18 A;  3LEL C;  3EPJ A;  4XZQ B;  3AZH A;  3UTB B;  3MVD B;  3LJA D;  1ZLA D;  1F66 C;  3WKJ D;  3MGP C;  3AZI C;  1KX4 B;  1ID3 D;  4NE6 A;  4XUJ A;  5B0Y C;  5AV9 A;  2BG1 A;  4X23 A;  2HUE B;  3O62 A;  1S32 B;  2Y2M A;  5B32 B;  3WA9 D;  2ARO A;  1WWS A;  3WAA A;  1W2E A;  4QLC A;  3AZM A;  1ULY A;  3AZF B;  4J8W C;  4KUD A;  5DNM A;  2PYO B;  2Y2J A;  5G49 B;  3KWQ B;  4AWL C;  2BYM A;  1P3O D;  1P3F D;  2Y2P A;  1R4V A;  3X1T B;  1P3G B;  5B1L C;  4H9Q B;  5E5A B;  3X1U C;  5AY8 C;  3REJ A;  2ZY4 A;  3X1S A;  5B2J D;  3REL C;  2Y2N A;  3LEL B;  3UT9 D;  3AN2 D;  4KHA A;  5GT0 A;  4YM6 D;  4J8U D;  3VH6 W;  1F66 B;  5B33 C;  2F8N D;  3MGP B;  3AZI B;  5AV5 A;  3MGR C;  1KX3 D;  5GT3 D;  5CP6 A;  4KGC D;  5B0Y B;  1P3A A;  5BNV A;  2JSS A;  3REK D;  3W98 C;  3MNN C;  1P3L C;  4WU9 C;  2RVQ D;  3MGQ A;  5B31 A;  4WJ3 C;  5AVB D;  4J8W B;  1M19 C;  3W96 C;  3X1V C;  4AWL B;  5CPJ D;  1P3M C;  1P3B A;  3AZL C;  3NQJ B;  3REI C;  3WTP C;  1H3O A;  1U35 C;  1P3P C;  5AVC A;  5B1L B;  2VQR A;  1WWI A;  5AY8 B;  3X1U B;  2CV5 A;  3C1C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...