1TAFB

Drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
70
structure length
70
Chain Sequence
MLYGSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRDIDMSLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (two transcription factors)
molecule keywords TFIID TBP ASSOCIATED FACTOR 42
publication title Structural similarity between TAFs and the heterotetrameric core of the histone octamer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 26
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1996-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02969 TAF TATA box binding protein associated factor (TAF)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tafB00
4Z5TA 1P3OC 5DNNB 1M1AB 5AV9C 5KDMB 3NQJB 4YM6D 5B31A 5E5AD 3A6NB 3KUYB 3LZ1B 1M18D 1ZLAD 5B40B 3LZ0A 2NZDD 3AZLA 1M19A 1N1JA 5GXQC 5CPKD 3AN2A 3AZGC 5AV6C 3W97B 2HIOA 4G91C 5BS7C 5B32C 2YFWA 5AV8A 4Z66A 3W99C 1P3OD 2AROB 1P3MD 5AVCC 5GT3C 3C1CB 3AZKA 3WA9D 3KXBA 4G92C 5B1LB 4HGAB 4CSRA 5GXQD 4YM6B 3AZGD 5B2JD 5AV6D 1M18B 5F99B 4ZUXD 1ZLAB 3REJD 5B32D 5CPKB 3W99D 4UUZB 5AY8A 3X1TC 1P3LD 3B6FA 5GT3D 2YFVA 3AZIB 4NE5A 4WZSB 1P3MB 3AZMC 1TZYA 3R45B 5B24D 3AYWA 5B31G 1F66B 3VH5A 3WA9B 5GXQB 3C1BD 5B2JB 3VH6A 1P3PB 1P3KC 4YS3C 4ZUXB 3REHB 3REJB 2PYOC 1P3AA 1B67A 3X1TD 4KGCD 4X23C 3AV2D 1U35C 4WU8C 4Z5TC 5DNMB 1P3LB 3MGSA 5GT3B 3AZEB 5B24B 4Z2MG 3LZ0C 3AZLC 3B0CW 4EO5B 1P3KD 4YS3D 1M19C 3X1UB 3TU4A 2HUEC 2HIOC 5B33A 3REKC 4X23D 3C1BB 1U35D 3W98C 5AV8C 4H9QA 4KGCB 3AV2B 5B31D 5AVBA 2F8NK 3LZ0D 3AZLD 1P3IA 1M19D 4J8WA 3MGRC 1ID3A 3AN2D 3REIA 4AWLC 1P3FA 3WTPE 5JRGA 4WNNB 4Z66D 1BH8A 3AFAB 5FUGB 4J8VA 5CP6B 1BFMA 4J8XB 3AZKD 2IO5B 3KXBD 5BS7A 5B31B 3AYWC 3AZHC 3X1VA 5GT0B 1ID3C 3AN2B 5AVCA 3UTBB 5BNXB 3X1SB 5BO0B 5C3IB 3AV1B 5AY8D 4NFTA 1P3AC 5CPJA 2YFWB 4Z66B 3RELB 3AZFA 3WAAA 3B6FD 2LY8A 2NQBA 3B6GC 1B6WA 3LELA 1TZYD 2RVQD 1EQZC 4H9OA 3AZKB 5CPIA 3KXBB 4XZQC 1TAFB 1KX3A 4LD9A 5B2IA 5B33C 3WKJB 3AZMA 3AZNB 5G49A 4WU9A 5AY8B 3B0DB 3MGPA 3AZJA 1P34A 3MVDC 1S32A 3MGSD 3B6FB 2YFVB 5B0ZB 1TZYB 5AVBC 2PYOA 3TU4D 5B33D 3WTPD 3REIC 1Q9CA 1P3FC 5JRGC 3UTAA 1U35A 3B0BA 4J8VC 3UT9B 4R8PB 5B1MC 1KX5D 5AVBD 3MNNC 3REKA 1P3ID 4H9RB 4J8WD 3MGSB 1ID3D 3LJAA 3W98A 4XUJA 3X1VC 5AV9D 5BT1C 3O62A 3TU4B 5B33B 3WTPB 5CPJC 3MGRA 3AZFC 3WAAC 3V9RA 5E5AB 2NQBC 3LELC 4H9PB 5JA4B 1P3BC 1WWSA 2NZDB 1KX5B 5CPIC 3X1VD 1KX4A 1P3IB 4ZBJB 4J8WB 1ID3B 5GSUA 5AVCD 1KX3C 4LD9C 1P3OB 5CPJD 5B2IC 5AV9B 4QLCC 3KWQA 1BH8B 3AZFD 3WAAD 2NQBD 3LELD 4KHAA 4WU9C 3AZJC 3MGPC 4J8UC 1P34C 3AZHA 3MGQA 1S32C 4JJNA 2FJ7A 3AZGB 5CPID 5AV6B 4G91B 5B32B 2F8NA 4LD9D 2BYMA 3W99B 3W96C 4H9NB 1P3GA 3B6GA 3AZMD 5AVCB 1EQZA 3UTAC 3MGPD 1P34D 4G92B 4XZQA 1S32D 1JFIA 1AOIC 2PYOD 5AV5C 3LJAC 4WU8D 4CAYA 5DNNA 1M1AA 4XUJC 4H9SA 4Z5TD 5KDMA 1HQ3C 3MVDA 3NQJA 3X1TB 3KUYA 3LZ1A 3O62C 5B40A 3AZMB 1HTAA 5G49B 3W97A 4DRBA 2HIOD 3REKD 2BYKB 3LJAD 3KSYA 3W98D 1P3KB 4YS3B 5AV8D 4XUJD 2PYOB 1KX4C 4X23B 1U35B 5GSUC 4E45A 4WU8B 3O62D 3C1CA 4Z5TB 5B1MA 5B1LA 5B0YC 4YM6A 3MNNA 3KWQC 3MGRD 5F99A 4DRAA 1ZLAA 3LZ0B 3MGQC 3AZLB 1M19B 4UUZA 4JJNC 1N1JB 5BNVA 2FJ7C 1F1EA 2HUEB 2HIOB 3REKB 5GSUD 3W98B 5AV8B 3AZIA 1R4VA 1P3GC 4Z2MH 3KWQD 1P3BA 1F66A 3AYWD 3WA9A 3AZHD 4CSRB 3MGRB 4JJND 2CV5C 1P3PA 2FJ7D 3REHA 4AWLB 1P3AD 4QLCA 5DNMA 5DNNC 2JSSA 1M1AC 3B6GD 4H9SC 4J8UA 1EQZD 1BH9A 3A6NC 3KUYC 3LZ1C 3AZEA 5B40C 4XZQD 4NE6A 3X1UA 3AYWB 3W97C 3W96A 3AZHB 3C1BA 4JJNB 5DNND 2AROC 1P3AB 3MVDD 2BYMB 3LZ1D 3B6GB 5B40D 3C1CC 1AOIA 5B1LC 4HGAC 4YM6C 1EQZB 4KUDA 5AV5A 3W97D 5F99C 1ZLAC 4XZQB 3REID 1P3FD 5CPKC 1HQ3A 5JRGD 5FUGA 3AFAA 1WWIA 5CP6A 4J8VD 4CAYB 4J8XA 3C1CD 3AZIC 5B1MD 4H9QB 5B1LD 1P3MC 3MVDB 3MNND 3NQUA 5F99D 1F66C 3WA9C 5AVBB 5GT0A 5BT1D 5B2JC 3UTBA 5BNXA 1P3PC 3X1SA 5BO0A 4ZUXC 3AV1A 3REHC 3REJC 3REIB 1P3FB 1KU5A 5B0YA 3RELA 5JRGB 3AZID 3VH5T 5DNMC 4J8VB 1P3BD 1P3LC 1F66D 3VH6T 3AZEC 5B1MB 5B24C 1TAFA 3MNNB 4EO5C 1P3PD 3REHD 3X1UC 1KX3D 3WKJA 3X1VB 5B2ID 3C1BC 4QLCD 3AZNA 5BNVB 5DNMD 1ULYA 2L5AA 4WU9D 3AZJD 4KGCC 4J8UD 5CPJB 3AV2C 4E44A 5B0ZA 3AZED 3AZFB 2CV5A 3WAAB 2NQBB 3LELB 1P3BB 1H3OA 4KUDC 4H9OB 3X1UD 5CPIB 3W96D 3AFAC 1KX3B 3UTAD 4LD9B 3A6NA 5B2IB 5CP6C 4QLCB 3UT9A 4R8PA 4J8XC 2IO5C 4WU9B 3AZJB 3MGPB 1AOID 4H9RA 4J8UB 1P34B 5B31C 4KUDD 1BH9B 5AV5D 1S32B 2AROA 5GT0C 1HQ3D 3AN2C 3AFAD 3UTBC 3WTPA 3X1SC 5C3IC 3AV1C 3W96B 2F8NG 5CP6D 4Z66C 3RELC 4J8XD 5E5AA 3UTAB 1M18A 4H9PA 5JA4A 2NZDA 5CPKA 1KX5A 3AZKC 3KXBC 1AOIB 5GT0D 1KX4D 4KUDB 5AV5B 3UTBD 3X1SD 3LJAB 3AV1D 1P3OA 1A7WA 5CHLB 4XUJB 5AV9A 3WKJC 5B0YD 1P3MA 1HQ3B 3R45A 3RELD 3AZNC 3O62B 3B0CT 3B0DC 5AY8C 5GXQA 3MGQD 3B6FC 3AZGA 5B0ZC 5B2JA 5AV6A 3V9RB 4ZUXA 1TZYC 2RVQC 3REJA 3NQUB 5B32A 3W99A 4WV4B 4H9NA 2F8ND 3WKJD 1P3GD 1KX4B 3AZND 5GSUB 1P3LA 5GT3A 5B0YB 5B24A 3KWQB 5B0ZD 3UT9C 2CV5D 4R8PC 4KHAB 3MGSC 3MGQB 2FJ7B 2F8NH 1M1AD 3X1TA 4KGCA 3AV2A 2F8NB 3TU4C 4NE3A 3WTPC 3A6ND 3KUYD 1P3GB 3UT9D 2CWEA 4R8PD 5E5AC 1M18C 4M6BA 2BYKA 2NZDC 4X23A 3VH5W 2CV5B 1P3KA 4YS3A 4WNNA 1KX5C 1JFIB 2AROD 1P3IC 4ZBJC 3VH6W 4J8WC 1H3OB 5B32G 4WU8A
chains in the Genus database with same CATH superfamily
4Z5TA 1P3OC 5DNNB 1M1AB 5AV9C 5KDMB 3NQJB 4YM6D 5B31A 5E5AD 3A6NB 3KUYB 3LZ1B 1M18D 1ZLAD 5B40B 3LZ0A 2NZDD 3AZLA 4WJ3C 1M19A 1N1JA 5GXQC 5CPKD 3AN2A 3AZGC 5AV6C 3W97B 2HIOA 4G91C 5BS7C 5B32C 2YFWA 3EPJA 5AV8A 4Z66A 3W99C 1P3OD 2AROB 1P3MD 4UPKA 5AVCC 2Y2NA 5GT3C 3C1CB 3AZKA 3WA9D 3KXBA 4G92C 5B1LB 4HGAB 4CSRA 5GXQD 4YM6B 3AZGD 5B2JD 5AV6D 1M18B 5F99B 4ZUXD 2G5HC 1ZLAB 3REJD 5B32D 1T3UA 5CPKB 3W99D 4UUZB 5AY8A 3X1TC 1P3LD 3B6FA 5GT3D 2YFVA 3AZIB 2ZY5A 4NE5A 4WZSB 1P3MB 3AZMC 1TZYA 3R45B 5B24D 3AYWA 5B31G 1F66B 3VH5A 3WA9B 5GXQB 3C1BD 5B2JB 3VH6A 1P3PB 1P3KC 4YS3C 4ZUXB 3REHB 3REJB 2PYOC 1P3AA 1B67A 3X1TD 4KGCD 4DQYB 4X23C 3AV2D 1U35C 4WU8C 4Z5TC 5DNMB 2Y2JA 1P3LB 3MGSA 5GT3B 3AZEB 5B24B 4Z2MG 3LZ0C 3AZLC 3B0CW 4EO5B 1P3KD 4YS3D 1M19C 3X1UB 3TU4A 2HUEC 5B33A 2HIOC 3REKC 2FFFB 4X23D 3C1BB 1U35D 3W98C 5AV8C 4H9QA 4KGCB 3AV2B 3IP4C 5B31D 2Y2GA 5AVBA 2F8NK 3LZ0D 3AZLD 1P3IA 1M19D 4J8WA 3MGRC 1ID3A 3AN2D 3REIA 4AWLC 2ZY2A 1P3FA 3WTPE 5JRGA 4WNNB 4Z66D 1BH8A 2Y2QA 3AFAB 5FUGB 4J8VA 5CP6B 1BFMA 4J8XB 3AZKD 2IO5B 3KXBD 5BS7A 5B31B 3AYWC 3H0RC 3AZHC 3X1VA 5GT0B 1ID3C 3AN2B 5AVCA 3UTBB 5BNXB 3X1SB 5BO0B 2Y2LA 5C3IB 5AY8D 3AV1B 4NFTA 1P3AC 5CPJA 2YFWB 4Z66B 3RELB 3AZFA 3WAAA 3B6FD 2LY8A 3H0MC 2NQBA 3B6GC 1B6WA 3LELA 1TZYD 2RVQD 1EQZC 4H9OA 3AZKB 5CPIA 3KXBB 4XZQC 1TAFB 1KX3A 4LD9A 5B2IA 5B33C 3WKJB 3AZMA 3AZNB 5G49A 2Y2HA 5AY8B 3B0DB 3MGPA 3AZJA 2DF4C 4WU9A 1P34A 3MVDC 1S32A 3MGSD 3B6FB 2YFVB 5B0ZB 1TZYB 5AVBC 2PYOA 1PZRA 3TU4D 5B33D 3WTPD 3REIC 1Q9CA 1P3FC 5JRGC 3UTAA 1U35A 3B0BA 4J8VC 3UT9B 4R8PB 5B1MC 1KX5D 5AVBD 3MNNC 3REKA 1P3ID 4H9RB 4J8WD 3MGSB 1ID3D 3LJAA 3W98A 2XD5A 4XUJA 3X1VC 5AV9D 5BT1C 3O62A 3TU4B 5B33B 3WTPB 5CPJC 3MGRA 3AZFC 3WAAC 3V9RA 5E5AB 2NQBC 2Y2MA 3LELC 4H9PB 5JA4B 1P3BC 1WWSA 2NZDB 1KX5B 5CPIC 3X1VD 1KX4A 1P3IB 4ZBJB 4J8WB 1ID3B 5GSUA 5AVCD 1KX3C 4LD9C 1P3OB 5B2IC 5CPJD 5AV9B 2F2AC 4QLCC 3KWQA 1BH8B 3AZFD 3WAAD 2NQBD 3LELD 4KHAA 4WU9C 3AZJC 3MGPC 4J8UC 1P34C 3AZHA 3MGQA 1S32C 4JJNA 2FJ7A 3AZGB 5CPID 5AV6B 4G91B 5B32B 2F8NA 4LD9D 2BYMA 3W99B 3W96C 4H9NB 1P3GA 3B6GA 3A1KA 3AZMD 5AVCB 3P5JB 1EQZA 3UTAC 3MGPD 1P34D 4G92B 4XZQA 1S32D 3KFUG 2W8SA 1JFIA 1AOIC 2PYOD 5AV5C 3LJAC 4WU8D 4CAYA 5DNNA 1M1AA 4XUJC 4H9SA 4Z5TD 5KDMA 1HQ3C 3MVDA 3NQJA 3X1TB 3KUYA 3LZ1A 3O62C 5B40A 3AZMB 1HTAA 5G49B 3W97A 2BG1A 4DRBA 2HIOD 3REKD 2BYKB 3LJAD 3KSYA 3W98D 1P3KB 4YS3B 5AV8D 4XUJD 2PYOB 2DQNC 1KX4C 3H0LC 4X23B 1U35B 5GSUC 4E45A 4WU8B 3O62D 3C1CA 4Z5TB 5B1MA 5B1LA 5B0YC 4YM6A 3MNNA 3KWQC 3MGRD 5F99A 4DRAA 1ZLAA 3LZ0B 3MGQC 3AZLB 1M19B 4UUZA 4JJNC 1N1JB 5BNVA 2FJ7C 1F1EA 2HUEB 2HIOB 3REKB 5GSUD 3W98B 5AV8B 3AZIA 1R4VA 1P3GC 4Z2MH 3KWQD 2Y2PA 1P3BA 1F66A 3AYWD 3WA9A 3AZHD 4CSRB 3MGRB 4JJND 2CV5C 1P3PA 2FJ7D 3REHA 1Z2CB 4AWLB 1P3AD 4QLCA 5DNMA 5DNNC 2JSSA 1M1AC 3B6GD 4H9SC 4J8UA 1EQZD 1BH9A 3A6NC 3KUYC 3LZ1C 3AZEA 5B40C 4XZQD 4NE6A 3X1UA 3AYWB 3W97C 3W96A 3AZHB 3C1BA 4JJNB 5DNND 2AROC 1P3AB 3MVDD 2BYMB 3LZ1D 3B6GB 5B40D 3C1CC 1AOIA 5B1LC 4HGAC 4YM6C 1EQZB 4KUDA 5AV5A 3W97D 5F99C 1ZLAC 4XZQB 3REID 2J8PA 3EG5B 1P3FD 5CPKC 1HQ3A 5JRGD 5FUGA 3AFAA 3A1IA 1WWIA 3EPLA 2ZY3A 5CP6A 2RIQA 4J8VD 4CAYB 4J8XA 3C1CD 3AZIC 5B1MD 2ZY4A 4H9QB 5B1LD 1P3MC 3MVDB 3MNND 3NQUA 5F99D 2XD1A 1F66C 3WA9C 5AVBB 2Y2KA 5GT0A 5BT1D 3EPKA 5B2JC 3UTBA 5BNXA 1P3PC 3X1SA 5BO0A 4ZUXC 3AV1A 3REHC 3REJC 3REIB 1P3FB 1KU5A 5B0YA 3RELA 5JRGB 3AZID 1W2EA 3VH5T 5DNMC 4J8VB 1P3BD 1P3LC 1F66D 3VH6T 3AL0C 3AZEC 5B1MB 5B24C 1TAFA 3MNNB 4EO5C 1P3PD 3REHD 3X1UC 1KX3D 3WKJA 3X1VB 5B2ID 3C1BC 2JE5A 4QLCD 3AZNA 5BNVB 3FDDA 5DNMD 1ULYA 2L5AA 4WU9D 3AZJD 4KGCC 4J8UD 5CPJB 3AV2C 4E44A 5B0ZA 3AZED 3AZFB 2JCHA 2CV5A 3WAAB 2NQBB 3LELB 1P3BB 1H3OA 4KUDC 4H9OB 3X1UD 5CPIB 3W96D 3AFAC 1KX3B 3UTAD 4LD9B 3A6NA 5B2IB 5CP6C 4QLCB 3UT9A 4R8PA 4J8XC 2IO5C 4WU9B 3AZJB 3MGPB 1AOID 4H9RA 4J8UB 1P34B 5B31C 4KUDD 1BH9B 5AV5D 1S32B 2AROA 3F6TA 5GT0C 1HQ3D 3AN2C 3AFAD 3UTBC 3WTPA 3X1SC 5C3IC 3AV1C 3W96B 2F8NG 5CP6D 4Z66C 3RELC 4J8XD 5E5AA 3UTAB 1M18A 4H9PA 5JA4A 2NZDA 5CPKA 2ZM5A 1KX5A 3AZKC 3KXBC 1AOIB 5GT0D 1KX4D 4KUDB 5AV5B 3UTBD 3X1SD 3LJAB 3AV1D 1P3OA 1A7WA 5CHLB 4XUJB 5AV9A 2G5IC 3WKJC 5B0YD 1P3MA 1HQ3B 3R45A 3RELD 3AZNC 3O62B 3B0CT 3B0DC 5AY8C 2VQRA 2UWXA 5GXQA 3MGQD 3B6FC 3AZGA 5B0ZC 5B2JA 5AV6A 3V9RB 4ZUXA 1TZYC 2RVQC 3REJA 3NQUB 5B32A 3W99A 4WV4B 4H9NA 2F8ND 3WKJD 1P3GD 1KX4B 3AZND 5GSUB 1P3LA 5GT3A 5B0YB 5B24A 3KWQB 5B0ZD 3UT9C 2Y2OA 2CV5D 4R8PC 4KHAB 3MGSC 3MGQB 2FJ7B 2F8NH 1M1AD 3X1TA 4KGCA 3AV2A 2F8NB 3TU4C 4NE3A 3WTPC 3A6ND 3KUYD 1P3GB 2Y2IA 3EPHA 3UT9D 2CWEA 4R8PD 5E5AC 1M18C 4M6BA 2BYKA 2NZDC 4X23A 3VH5W 2CV5B 1P3KA 4YS3A 4WNNA 1KX5C 1JFIB 2AROD 1P3IC 4ZBJC 3VH6W 4J8WC 1H3OB 5B32G 4WU8A
chains in the Genus database with same CATH topology
4Z5TA 1P3OC 5DNNB 1M1AB 5AV9C 5KDMB 3NQJB 4YM6D 5B31A 5E5AD 3A6NB 3KUYB 3LZ1B 1M18D 1ZLAD 5B40B 3LZ0A 2NZDD 3AZLA 4WJ3C 1M19A 1N1JA 5GXQC 5CPKD 3AN2A 3AZGC 5AV6C 3W97B 2HIOA 4G91C 5BS7C 5B32C 2YFWA 3EPJA 5AV8A 4Z66A 3W99C 1P3OD 2AROB 1P3MD 4UPKA 5AVCC 2Y2NA 5GT3C 3C1CB 3AZKA 3WA9D 3KXBA 4G92C 5B1LB 4HGAB 4CSRA 5GXQD 4YM6B 3AZGD 5B2JD 5AV6D 1M18B 5F99B 4ZUXD 2G5HC 1ZLAB 3REJD 5B32D 1T3UA 5CPKB 3W99D 4UUZB 5AY8A 3X1TC 1P3LD 3B6FA 5GT3D 2YFVA 3AZIB 2ZY5A 4NE5A 4WZSB 1P3MB 3AZMC 1TZYA 3R45B 5B24D 3AYWA 5B31G 1F66B 3VH5A 3WA9B 5GXQB 3C1BD 5B2JB 3VH6A 1P3PB 1P3KC 4YS3C 4ZUXB 3REHB 3REJB 2PYOC 1P3AA 1B67A 3X1TD 4KGCD 4DQYB 4X23C 3AV2D 1U35C 4WU8C 4Z5TC 5DNMB 2Y2JA 1P3LB 3MGSA 5GT3B 3AZEB 5B24B 4Z2MG 3LZ0C 3AZLC 3B0CW 4EO5B 1P3KD 4YS3D 1M19C 3X1UB 3TU4A 2HUEC 5B33A 2HIOC 3REKC 2FFFB 4X23D 3C1BB 1U35D 3W98C 5AV8C 4H9QA 4KGCB 3AV2B 3IP4C 5B31D 2Y2GA 5AVBA 2F8NK 3LZ0D 3AZLD 1P3IA 1M19D 4J8WA 3MGRC 1ID3A 3AN2D 3REIA 4AWLC 2ZY2A 1P3FA 3WTPE 5JRGA 4WNNB 4Z66D 1BH8A 2Y2QA 3AFAB 5FUGB 4J8VA 5CP6B 1BFMA 4J8XB 3AZKD 2IO5B 3KXBD 5BS7A 5B31B 3AYWC 3H0RC 3AZHC 3X1VA 5GT0B 1ID3C 3AN2B 5AVCA 3UTBB 5BNXB 3X1SB 5BO0B 2Y2LA 5C3IB 5AY8D 3AV1B 4NFTA 1P3AC 5CPJA 2YFWB 4Z66B 3RELB 3AZFA 3WAAA 3B6FD 2LY8A 3H0MC 2NQBA 3B6GC 1B6WA 3LELA 1TZYD 2RVQD 1EQZC 4H9OA 3AZKB 5CPIA 3KXBB 4XZQC 1TAFB 1KX3A 4LD9A 5B2IA 5B33C 3WKJB 3AZMA 3AZNB 5G49A 2Y2HA 5AY8B 3B0DB 3MGPA 3AZJA 2DF4C 4WU9A 1P34A 3MVDC 1S32A 3MGSD 3B6FB 2YFVB 5B0ZB 1TZYB 5AVBC 2PYOA 1PZRA 3TU4D 5B33D 3WTPD 3REIC 1Q9CA 1P3FC 5JRGC 3UTAA 1U35A 3B0BA 4J8VC 3UT9B 4R8PB 5B1MC 1KX5D 5AVBD 3MNNC 3REKA 1P3ID 4H9RB 4J8WD 3MGSB 1ID3D 3LJAA 3W98A 2XD5A 4XUJA 3X1VC 5AV9D 5BT1C 3O62A 3TU4B 5B33B 3WTPB 5CPJC 3MGRA 3AZFC 3WAAC 3V9RA 5E5AB 2NQBC 2Y2MA 3LELC 4H9PB 5JA4B 1P3BC 1WWSA 2NZDB 1KX5B 5CPIC 3X1VD 1KX4A 1P3IB 4ZBJB 4J8WB 1ID3B 5GSUA 5AVCD 1KX3C 4LD9C 1P3OB 5B2IC 5CPJD 5AV9B 2F2AC 4QLCC 3KWQA 1BH8B 3AZFD 3WAAD 2NQBD 3LELD 4KHAA 4WU9C 3AZJC 3MGPC 4J8UC 1P34C 3AZHA 3MGQA 1S32C 4JJNA 2FJ7A 3AZGB 5CPID 5AV6B 4G91B 5B32B 2F8NA 4LD9D 2BYMA 3W99B 3W96C 4H9NB 1P3GA 3B6GA 3A1KA 3AZMD 5AVCB 3P5JB 1EQZA 3UTAC 3MGPD 1P34D 4G92B 4XZQA 1S32D 3KFUG 2W8SA 1JFIA 1AOIC 2PYOD 5AV5C 3LJAC 4WU8D 4CAYA 5DNNA 1M1AA 4XUJC 4H9SA 4Z5TD 5KDMA 1HQ3C 3MVDA 3NQJA 3X1TB 3KUYA 3LZ1A 3O62C 5B40A 3AZMB 1HTAA 5G49B 3W97A 2BG1A 4DRBA 2HIOD 3REKD 2BYKB 3LJAD 3KSYA 3W98D 1P3KB 4YS3B 5AV8D 4XUJD 2PYOB 2DQNC 1KX4C 3H0LC 4X23B 1U35B 5GSUC 4E45A 4WU8B 3O62D 3C1CA 4Z5TB 5B1MA 5B1LA 5B0YC 4YM6A 3MNNA 3KWQC 3MGRD 5F99A 4DRAA 1ZLAA 3LZ0B 3MGQC 3AZLB 1M19B 4UUZA 4JJNC 1N1JB 5BNVA 2FJ7C 1F1EA 2HUEB 2HIOB 3REKB 5GSUD 3W98B 5AV8B 3AZIA 1R4VA 1P3GC 4Z2MH 3KWQD 2Y2PA 1P3BA 1F66A 3AYWD 3WA9A 3AZHD 4CSRB 3MGRB 4JJND 2CV5C 1P3PA 2FJ7D 3REHA 1Z2CB 4AWLB 1P3AD 4QLCA 5DNMA 5DNNC 2JSSA 1M1AC 3B6GD 4H9SC 4J8UA 1EQZD 1BH9A 3A6NC 3KUYC 3LZ1C 3AZEA 5B40C 4XZQD 4NE6A 3X1UA 3AYWB 3W97C 3W96A 3AZHB 3C1BA 4JJNB 5DNND 2AROC 1P3AB 3MVDD 2BYMB 3LZ1D 3B6GB 5B40D 3C1CC 1AOIA 5B1LC 4HGAC 4YM6C 1EQZB 4KUDA 5AV5A 3W97D 5F99C 1ZLAC 4XZQB 3REID 2J8PA 3EG5B 1P3FD 5CPKC 1HQ3A 5JRGD 5FUGA 3AFAA 3A1IA 1WWIA 3EPLA 2ZY3A 5CP6A 2RIQA 4J8VD 4CAYB 4J8XA 3C1CD 3AZIC 5B1MD 2ZY4A 4H9QB 5B1LD 1P3MC 3MVDB 3MNND 3NQUA 5F99D 2XD1A 1F66C 3WA9C 5AVBB 2Y2KA 5GT0A 5BT1D 3EPKA 5B2JC 3UTBA 5BNXA 1P3PC 3X1SA 5BO0A 4ZUXC 3AV1A 3REHC 3REJC 3REIB 1P3FB 1KU5A 5B0YA 3RELA 5JRGB 3AZID 1W2EA 3VH5T 5DNMC 4J8VB 1P3BD 1P3LC 1F66D 3VH6T 3AL0C 3AZEC 5B1MB 5B24C 1TAFA 3MNNB 4EO5C 1P3PD 3REHD 3X1UC 1KX3D 3WKJA 3X1VB 5B2ID 3C1BC 2JE5A 4QLCD 3AZNA 5BNVB 3FDDA 5DNMD 1ULYA 2L5AA 4WU9D 3AZJD 4KGCC 4J8UD 5CPJB 3AV2C 4E44A 5B0ZA 3AZED 3AZFB 2JCHA 2CV5A 3WAAB 2NQBB 3LELB 1P3BB 1H3OA 4KUDC 4H9OB 3X1UD 5CPIB 3W96D 3AFAC 1KX3B 3UTAD 4LD9B 3A6NA 5B2IB 5CP6C 4QLCB 3UT9A 4R8PA 4J8XC 2IO5C 4WU9B 3AZJB 3MGPB 1AOID 4H9RA 4J8UB 1P34B 5B31C 4KUDD 1BH9B 5AV5D 1S32B 2AROA 3F6TA 5GT0C 1HQ3D 3AN2C 3AFAD 3UTBC 3WTPA 3X1SC 5C3IC 3AV1C 3W96B 2F8NG 5CP6D 4Z66C 3RELC 4J8XD 5E5AA 3UTAB 1M18A 4H9PA 5JA4A 2NZDA 5CPKA 2ZM5A 1KX5A 3AZKC 3KXBC 1AOIB 5GT0D 1KX4D 4KUDB 5AV5B 3UTBD 3X1SD 3LJAB 3AV1D 1P3OA 1A7WA 5CHLB 4XUJB 5AV9A 2G5IC 3WKJC 5B0YD 1P3MA 1HQ3B 3R45A 3RELD 3AZNC 3O62B 3B0CT 3B0DC 5AY8C 2VQRA 2UWXA 5GXQA 3MGQD 3B6FC 3AZGA 5B0ZC 5B2JA 5AV6A 3V9RB 4ZUXA 1TZYC 2RVQC 3REJA 3NQUB 5B32A 3W99A 4WV4B 4H9NA 2F8ND 3WKJD 1P3GD 1KX4B 3AZND 5GSUB 1P3LA 5GT3A 5B0YB 5B24A 3KWQB 5B0ZD 3UT9C 2Y2OA 2CV5D 4R8PC 4KHAB 3MGSC 3MGQB 2FJ7B 2F8NH 1M1AD 3X1TA 4KGCA 3AV2A 2F8NB 3TU4C 4NE3A 3WTPC 3A6ND 3KUYD 1P3GB 2Y2IA 3EPHA 3UT9D 2CWEA 4R8PD 5E5AC 1M18C 4M6BA 2BYKA 2NZDC 4X23A 3VH5W 2CV5B 1P3KA 4YS3A 4WNNA 1KX5C 1JFIB 2AROD 1P3IC 4ZBJC 3VH6W 4J8WC 1H3OB 5B32G 4WU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T A;  1P3O C;  5DNN B;  1M1A B;  5AV9 C;  5KDM B;  3NQJ B;  4YM6 D;  5B31 A;  5E5A D;  3A6N B;  3KUY B;  3LZ1 B;  1M18 D;  1ZLA D;  5B40 B;  3LZ0 A;  2NZD D;  3AZL A;  1M19 A;  1N1J A;  5GXQ C;  5CPK D;  3AN2 A;  3AZG C;  5AV6 C;  3W97 B;  2HIO A;  4G91 C;  5BS7 C;  5B32 C;  2YFW A;  5AV8 A;  4Z66 A;  3W99 C;  1P3O D;  2ARO B;  1P3M D;  5AVC C;  5GT3 C;  3C1C B;  3AZK A;  3WA9 D;  3KXB A;  4G92 C;  5B1L B;  4HGA B;  4CSR A;  5GXQ D;  4YM6 B;  3AZG D;  5B2J D;  5AV6 D;  1M18 B;  5F99 B;  4ZUX D;  1ZLA B;  3REJ D;  5B32 D;  5CPK B;  3W99 D;  4UUZ B;  5AY8 A;  3X1T C;  1P3L D;  3B6F A;  5GT3 D;  2YFV A;  3AZI B;  4NE5 A;  4WZS B;  1P3M B;  3AZM C;  1TZY A;  3R45 B;  5B24 D;  3AYW A;  5B31 G;  1F66 B;  3VH5 A;  3WA9 B;  5GXQ B;  3C1B D;  5B2J B;  3VH6 A;  1P3P B;  1P3K C;  4YS3 C;  4ZUX B;  3REH B;  3REJ B;  2PYO C;  1P3A A;  1B67 A;  3X1T D;  4KGC D;  4X23 C;  3AV2 D;  1U35 C;  4WU8 C;  4Z5T C;  5DNM B;  1P3L B;  3MGS A;  5GT3 B;  3AZE B;  5B24 B;  4Z2M G;  3LZ0 C;  3AZL C;  3B0C W;  4EO5 B;  1P3K D;  4YS3 D;  1M19 C;  3X1U B;  3TU4 A;  2HUE C;  2HIO C;  5B33 A;  3REK C;  4X23 D;  3C1B B;  1U35 D;  3W98 C;  5AV8 C;  4H9Q A;  4KGC B;  3AV2 B;  5B31 D;  5AVB A;  2F8N K;  3LZ0 D;  3AZL D;  1P3I A;  1M19 D;  4J8W A;  3MGR C;  1ID3 A;  3AN2 D;  3REI A;  4AWL C;  1P3F A;  3WTP E;  5JRG A;  4WNN B;  4Z66 D;  1BH8 A;  3AFA B;  5FUG B;  4J8V A;  5CP6 B;  1BFM A;  4J8X B;  3AZK D;  2IO5 B;  3KXB D;  5BS7 A;  5B31 B;  3AYW C;  3AZH C;  3X1V A;  5GT0 B;  1ID3 C;  3AN2 B;  5AVC A;  3UTB B;  5BNX B;  3X1S B;  5BO0 B;  5C3I B;  3AV1 B;  5AY8 D;  4NFT A;  1P3A C;  5CPJ A;  2YFW B;  4Z66 B;  3REL B;  3AZF A;  3WAA A;  3B6F D;  2LY8 A;  2NQB A;  3B6G C;  1B6W A;  3LEL A;  1TZY D;  2RVQ D;  1EQZ C;  4H9O A;  3AZK B;  5CPI A;  3KXB B;  4XZQ C;  1TAF B;  1KX3 A;  4LD9 A;  5B2I A;  5B33 C;  3WKJ B;  3AZM A;  3AZN B;  5G49 A;  4WU9 A;  5AY8 B;  3B0D B;  3MGP A;  3AZJ A;  1P34 A;  3MVD C;  1S32 A;  3MGS D;  3B6F B;  2YFV B;  5B0Z B;  1TZY B;  5AVB C;  2PYO A;  3TU4 D;  5B33 D;  3WTP D;  3REI C;  1Q9C A;  1P3F C;  5JRG C;  3UTA A;  1U35 A;  3B0B A;  4J8V C;  3UT9 B;  4R8P B;  5B1M C;  1KX5 D;  5AVB D;  3MNN C;  3REK A;  1P3I D;  4H9R B;  4J8W D;  3MGS B;  1ID3 D;  3LJA A;  3W98 A;  4XUJ A;  3X1V C;  5AV9 D;  5BT1 C;  3O62 A;  3TU4 B;  5B33 B;  3WTP B;  5CPJ C;  3MGR A;  3AZF C;  3WAA C;  3V9R A;  5E5A B;  2NQB C;  3LEL C;  4H9P B;  5JA4 B;  1P3B C;  1WWS A;  2NZD B;  1KX5 B;  5CPI C;  3X1V D;  1KX4 A;  1P3I B;  4ZBJ B;  4J8W B;  1ID3 B;  5GSU A;  5AVC D;  1KX3 C;  4LD9 C;  1P3O B;  5CPJ D;  5B2I C;  5AV9 B;  4QLC C;  3KWQ A;  1BH8 B;  3AZF D;  3WAA D;  2NQB D;  3LEL D;  4KHA A;  4WU9 C;  3AZJ C;  3MGP C;  4J8U C;  1P34 C;  3AZH A;  3MGQ A;  1S32 C;  4JJN A;  2FJ7 A;  3AZG B;  5CPI D;  5AV6 B;  4G91 B;  5B32 B;  2F8N A;  4LD9 D;  2BYM A;  3W99 B;  3W96 C;  4H9N B;  1P3G A;  3B6G A;  3AZM D;  5AVC B;  1EQZ A;  3UTA C;  3MGP D;  1P34 D;  4G92 B;  4XZQ A;  1S32 D;  1JFI A;  1AOI C;  2PYO D;  5AV5 C;  3LJA C;  4WU8 D;  4CAY A;  5DNN A;  1M1A A;  4XUJ C;  4H9S A;  4Z5T D;  5KDM A;  1HQ3 C;  3MVD A;  3NQJ A;  3X1T B;  3KUY A;  3LZ1 A;  3O62 C;  5B40 A;  3AZM B;  1HTA A;  5G49 B;  3W97 A;  4DRB A;  2HIO D;  3REK D;  2BYK B;  3LJA D;  3KSY A;  3W98 D;  1P3K B;  4YS3 B;  5AV8 D;  4XUJ D;  2PYO B;  1KX4 C;  4X23 B;  1U35 B;  5GSU C;  4E45 A;  4WU8 B;  3O62 D;  3C1C A;  4Z5T B;  5B1M A;  5B1L A;  5B0Y C;  4YM6 A;  3MNN A;  3KWQ C;  3MGR D;  5F99 A;  4DRA A;  1ZLA A;  3LZ0 B;  3MGQ C;  3AZL B;  1M19 B;  4UUZ A;  4JJN C;  1N1J B;  5BNV A;  2FJ7 C;  1F1E A;  2HUE B;  2HIO B;  3REK B;  5GSU D;  3W98 B;  5AV8 B;  3AZI A;  1R4V A;  1P3G C;  4Z2M H;  3KWQ D;  1P3B A;  1F66 A;  3AYW D;  3WA9 A;  3AZH D;  4CSR B;  3MGR B;  4JJN D;  2CV5 C;  1P3P A;  2FJ7 D;  3REH A;  4AWL B;  1P3A D;  4QLC A;  5DNM A;  5DNN C;  2JSS A;  1M1A C;  3B6G D;  4H9S C;  4J8U A;  1EQZ D;  1BH9 A;  3A6N C;  3KUY C;  3LZ1 C;  3AZE A;  5B40 C;  4XZQ D;  4NE6 A;  3X1U A;  3AYW B;  3W97 C;  3W96 A;  3AZH B;  3C1B A;  4JJN B;  5DNN D;  2ARO C;  1P3A B;  3MVD D;  2BYM B;  3LZ1 D;  3B6G B;  5B40 D;  3C1C C;  1AOI A;  5B1L C;  4HGA C;  4YM6 C;  1EQZ B;  4KUD A;  5AV5 A;  3W97 D;  5F99 C;  1ZLA C;  4XZQ B;  3REI D;  1P3F D;  5CPK C;  1HQ3 A;  5JRG D;  5FUG A;  3AFA A;  1WWI A;  5CP6 A;  4J8V D;  4CAY B;  4J8X A;  3C1C D;  3AZI C;  5B1M D;  4H9Q B;  5B1L D;  1P3M C;  3MVD B;  3MNN D;  3NQU A;  5F99 D;  1F66 C;  3WA9 C;  5AVB B;  5GT0 A;  5BT1 D;  5B2J C;  3UTB A;  5BNX A;  1P3P C;  3X1S A;  5BO0 A;  4ZUX C;  3AV1 A;  3REH C;  3REJ C;  3REI B;  1P3F B;  1KU5 A;  5B0Y A;  3REL A;  5JRG B;  3AZI D;  3VH5 T;  5DNM C;  4J8V B;  1P3B D;  1P3L C;  1F66 D;  3VH6 T;  3AZE C;  5B1M B;  5B24 C;  1TAF A;  3MNN B;  4EO5 C;  1P3P D;  3REH D;  3X1U C;  1KX3 D;  3WKJ A;  3X1V B;  5B2I D;  3C1B C;  4QLC D;  3AZN A;  5BNV B;  5DNM D;  1ULY A;  2L5A A;  4WU9 D;  3AZJ D;  4KGC C;  4J8U D;  5CPJ B;  3AV2 C;  4E44 A;  5B0Z A;  3AZE D;  3AZF B;  2CV5 A;  3WAA B;  2NQB B;  3LEL B;  1P3B B;  1H3O A;  4KUD C;  4H9O B;  3X1U D;  5CPI B;  3W96 D;  3AFA C;  1KX3 B;  3UTA D;  4LD9 B;  3A6N A;  5B2I B;  5CP6 C;  4QLC B;  3UT9 A;  4R8P A;  4J8X C;  2IO5 C;  4WU9 B;  3AZJ B;  3MGP B;  1AOI D;  4H9R A;  4J8U B;  1P34 B;  5B31 C;  4KUD D;  1BH9 B;  5AV5 D;  1S32 B;  2ARO A;  5GT0 C;  1HQ3 D;  3AN2 C;  3AFA D;  3UTB C;  3WTP A;  3X1S C;  5C3I C;  3AV1 C;  3W96 B;  2F8N G;  5CP6 D;  4Z66 C;  3REL C;  4J8X D;  5E5A A;  3UTA B;  1M18 A;  4H9P A;  5JA4 A;  2NZD A;  5CPK A;  1KX5 A;  3AZK C;  3KXB C;  1AOI B;  5GT0 D;  1KX4 D;  4KUD B;  5AV5 B;  3UTB D;  3X1S D;  3LJA B;  3AV1 D;  1P3O A;  1A7W A;  5CHL B;  4XUJ B;  5AV9 A;  3WKJ C;  5B0Y D;  1P3M A;  1HQ3 B;  3R45 A;  3REL D;  3AZN C;  3O62 B;  3B0C T;  3B0D C;  5AY8 C;  5GXQ A;  3MGQ D;  3B6F C;  3AZG A;  5B0Z C;  5B2J A;  5AV6 A;  3V9R B;  4ZUX A;  1TZY C;  2RVQ C;  3REJ A;  3NQU B;  5B32 A;  3W99 A;  4WV4 B;  4H9N A;  2F8N D;  3WKJ D;  1P3G D;  1KX4 B;  3AZN D;  5GSU B;  1P3L A;  5GT3 A;  5B0Y B;  5B24 A;  3KWQ B;  5B0Z D;  3UT9 C;  2CV5 D;  4R8P C;  4KHA B;  3MGS C;  3MGQ B;  2FJ7 B;  2F8N H;  1M1A D;  3X1T A;  4KGC A;  3AV2 A;  2F8N B;  3TU4 C;  4NE3 A;  3WTP C;  3A6N D;  3KUY D;  1P3G B;  3UT9 D;  2CWE A;  4R8P D;  5E5A C;  1M18 C;  4M6B A;  2BYK A;  2NZD C;  4X23 A;  3VH5 W;  2CV5 B;  1P3K A;  4YS3 A;  4WNN A;  1KX5 C;  1JFI B;  2ARO D;  1P3I C;  4ZBJ C;  3VH6 W;  4J8W C;  1H3O B;  5B32 G;  4WU8 A; 
#chains in the Genus database with same CATH topology
 4Z5T A;  1P3O C;  5DNN B;  1M1A B;  5AV9 C;  5KDM B;  3NQJ B;  4YM6 D;  5B31 A;  5E5A D;  3A6N B;  3KUY B;  3LZ1 B;  1M18 D;  1ZLA D;  5B40 B;  3LZ0 A;  2NZD D;  3AZL A;  4WJ3 C;  1M19 A;  1N1J A;  5GXQ C;  5CPK D;  3AN2 A;  3AZG C;  5AV6 C;  3W97 B;  2HIO A;  4G91 C;  5BS7 C;  5B32 C;  2YFW A;  3EPJ A;  5AV8 A;  4Z66 A;  3W99 C;  1P3O D;  2ARO B;  1P3M D;  4UPK A;  5AVC C;  2Y2N A;  5GT3 C;  3C1C B;  3AZK A;  3WA9 D;  3KXB A;  4G92 C;  5B1L B;  4HGA B;  4CSR A;  5GXQ D;  4YM6 B;  3AZG D;  5B2J D;  5AV6 D;  1M18 B;  5F99 B;  4ZUX D;  2G5H C;  1ZLA B;  3REJ D;  5B32 D;  1T3U A;  5CPK B;  3W99 D;  4UUZ B;  5AY8 A;  3X1T C;  1P3L D;  3B6F A;  5GT3 D;  2YFV A;  3AZI B;  2ZY5 A;  4NE5 A;  4WZS B;  1P3M B;  3AZM C;  1TZY A;  3R45 B;  5B24 D;  3AYW A;  5B31 G;  1F66 B;  3VH5 A;  3WA9 B;  5GXQ B;  3C1B D;  5B2J B;  3VH6 A;  1P3P B;  1P3K C;  4YS3 C;  4ZUX B;  3REH B;  3REJ B;  2PYO C;  1P3A A;  1B67 A;  3X1T D;  4KGC D;  4DQY B;  4X23 C;  3AV2 D;  1U35 C;  4WU8 C;  4Z5T C;  5DNM B;  2Y2J A;  1P3L B;  3MGS A;  5GT3 B;  3AZE B;  5B24 B;  4Z2M G;  3LZ0 C;  3AZL C;  3B0C W;  4EO5 B;  1P3K D;  4YS3 D;  1M19 C;  3X1U B;  3TU4 A;  2HUE C;  5B33 A;  2HIO C;  3REK C;  2FFF B;  4X23 D;  3C1B B;  1U35 D;  3W98 C;  5AV8 C;  4H9Q A;  4KGC B;  3AV2 B;  3IP4 C;  5B31 D;  2Y2G A;  5AVB A;  2F8N K;  3LZ0 D;  3AZL D;  1P3I A;  1M19 D;  4J8W A;  3MGR C;  1ID3 A;  3AN2 D;  3REI A;  4AWL C;  2ZY2 A;  1P3F A;  3WTP E;  5JRG A;  4WNN B;  4Z66 D;  1BH8 A;  2Y2Q A;  3AFA B;  5FUG B;  4J8V A;  5CP6 B;  1BFM A;  4J8X B;  3AZK D;  2IO5 B;  3KXB D;  5BS7 A;  5B31 B;  3AYW C;  3H0R C;  3AZH C;  3X1V A;  5GT0 B;  1ID3 C;  3AN2 B;  5AVC A;  3UTB B;  5BNX B;  3X1S B;  5BO0 B;  2Y2L A;  5C3I B;  5AY8 D;  3AV1 B;  4NFT A;  1P3A C;  5CPJ A;  2YFW B;  4Z66 B;  3REL B;  3AZF A;  3WAA A;  3B6F D;  2LY8 A;  3H0M C;  2NQB A;  3B6G C;  1B6W A;  3LEL A;  1TZY D;  2RVQ D;  1EQZ C;  4H9O A;  3AZK B;  5CPI A;  3KXB B;  4XZQ C;  1TAF B;  1KX3 A;  4LD9 A;  5B2I A;  5B33 C;  3WKJ B;  3AZM A;  3AZN B;  5G49 A;  2Y2H A;  5AY8 B;  3B0D B;  3MGP A;  3AZJ A;  2DF4 C;  4WU9 A;  1P34 A;  3MVD C;  1S32 A;  3MGS D;  3B6F B;  2YFV B;  5B0Z B;  1TZY B;  5AVB C;  2PYO A;  1PZR A;  3TU4 D;  5B33 D;  3WTP D;  3REI C;  1Q9C A;  1P3F C;  5JRG C;  3UTA A;  1U35 A;  3B0B A;  4J8V C;  3UT9 B;  4R8P B;  5B1M C;  1KX5 D;  5AVB D;  3MNN C;  3REK A;  1P3I D;  4H9R B;  4J8W D;  3MGS B;  1ID3 D;  3LJA A;  3W98 A;  2XD5 A;  4XUJ A;  3X1V C;  5AV9 D;  5BT1 C;  3O62 A;  3TU4 B;  5B33 B;  3WTP B;  5CPJ C;  3MGR A;  3AZF C;  3WAA C;  3V9R A;  5E5A B;  2NQB C;  2Y2M A;  3LEL C;  4H9P B;  5JA4 B;  1P3B C;  1WWS A;  2NZD B;  1KX5 B;  5CPI C;  3X1V D;  1KX4 A;  1P3I B;  4ZBJ B;  4J8W B;  1ID3 B;  5GSU A;  5AVC D;  1KX3 C;  4LD9 C;  1P3O B;  5B2I C;  5CPJ D;  5AV9 B;  2F2A C;  4QLC C;  3KWQ A;  1BH8 B;  3AZF D;  3WAA D;  2NQB D;  3LEL D;  4KHA A;  4WU9 C;  3AZJ C;  3MGP C;  4J8U C;  1P34 C;  3AZH A;  3MGQ A;  1S32 C;  4JJN A;  2FJ7 A;  3AZG B;  5CPI D;  5AV6 B;  4G91 B;  5B32 B;  2F8N A;  4LD9 D;  2BYM A;  3W99 B;  3W96 C;  4H9N B;  1P3G A;  3B6G A;  3A1K A;  3AZM D;  5AVC B;  3P5J B;  1EQZ A;  3UTA C;  3MGP D;  1P34 D;  4G92 B;  4XZQ A;  1S32 D;  3KFU G;  2W8S A;  1JFI A;  1AOI C;  2PYO D;  5AV5 C;  3LJA C;  4WU8 D;  4CAY A;  5DNN A;  1M1A A;  4XUJ C;  4H9S A;  4Z5T D;  5KDM A;  1HQ3 C;  3MVD A;  3NQJ A;  3X1T B;  3KUY A;  3LZ1 A;  3O62 C;  5B40 A;  3AZM B;  1HTA A;  5G49 B;  3W97 A;  2BG1 A;  4DRB A;  2HIO D;  3REK D;  2BYK B;  3LJA D;  3KSY A;  3W98 D;  1P3K B;  4YS3 B;  5AV8 D;  4XUJ D;  2PYO B;  2DQN C;  1KX4 C;  3H0L C;  4X23 B;  1U35 B;  5GSU C;  4E45 A;  4WU8 B;  3O62 D;  3C1C A;  4Z5T B;  5B1M A;  5B1L A;  5B0Y C;  4YM6 A;  3MNN A;  3KWQ C;  3MGR D;  5F99 A;  4DRA A;  1ZLA A;  3LZ0 B;  3MGQ C;  3AZL B;  1M19 B;  4UUZ A;  4JJN C;  1N1J B;  5BNV A;  2FJ7 C;  1F1E A;  2HUE B;  2HIO B;  3REK B;  5GSU D;  3W98 B;  5AV8 B;  3AZI A;  1R4V A;  1P3G C;  4Z2M H;  3KWQ D;  2Y2P A;  1P3B A;  1F66 A;  3AYW D;  3WA9 A;  3AZH D;  4CSR B;  3MGR B;  4JJN D;  2CV5 C;  1P3P A;  2FJ7 D;  3REH A;  1Z2C B;  4AWL B;  1P3A D;  4QLC A;  5DNM A;  5DNN C;  2JSS A;  1M1A C;  3B6G D;  4H9S C;  4J8U A;  1EQZ D;  1BH9 A;  3A6N C;  3KUY C;  3LZ1 C;  3AZE A;  5B40 C;  4XZQ D;  4NE6 A;  3X1U A;  3AYW B;  3W97 C;  3W96 A;  3AZH B;  3C1B A;  4JJN B;  5DNN D;  2ARO C;  1P3A B;  3MVD D;  2BYM B;  3LZ1 D;  3B6G B;  5B40 D;  3C1C C;  1AOI A;  5B1L C;  4HGA C;  4YM6 C;  1EQZ B;  4KUD A;  5AV5 A;  3W97 D;  5F99 C;  1ZLA C;  4XZQ B;  3REI D;  2J8P A;  3EG5 B;  1P3F D;  5CPK C;  1HQ3 A;  5JRG D;  5FUG A;  3AFA A;  3A1I A;  1WWI A;  3EPL A;  2ZY3 A;  5CP6 A;  2RIQ A;  4J8V D;  4CAY B;  4J8X A;  3C1C D;  3AZI C;  5B1M D;  2ZY4 A;  4H9Q B;  5B1L D;  1P3M C;  3MVD B;  3MNN D;  3NQU A;  5F99 D;  2XD1 A;  1F66 C;  3WA9 C;  5AVB B;  2Y2K A;  5GT0 A;  5BT1 D;  3EPK A;  5B2J C;  3UTB A;  5BNX A;  1P3P C;  3X1S A;  5BO0 A;  4ZUX C;  3AV1 A;  3REH C;  3REJ C;  3REI B;  1P3F B;  1KU5 A;  5B0Y A;  3REL A;  5JRG B;  3AZI D;  1W2E A;  3VH5 T;  5DNM C;  4J8V B;  1P3B D;  1P3L C;  1F66 D;  3VH6 T;  3AL0 C;  3AZE C;  5B1M B;  5B24 C;  1TAF A;  3MNN B;  4EO5 C;  1P3P D;  3REH D;  3X1U C;  1KX3 D;  3WKJ A;  3X1V B;  5B2I D;  3C1B C;  2JE5 A;  4QLC D;  3AZN A;  5BNV B;  3FDD A;  5DNM D;  1ULY A;  2L5A A;  4WU9 D;  3AZJ D;  4KGC C;  4J8U D;  5CPJ B;  3AV2 C;  4E44 A;  5B0Z A;  3AZE D;  3AZF B;  2JCH A;  2CV5 A;  3WAA B;  2NQB B;  3LEL B;  1P3B B;  1H3O A;  4KUD C;  4H9O B;  3X1U D;  5CPI B;  3W96 D;  3AFA C;  1KX3 B;  3UTA D;  4LD9 B;  3A6N A;  5B2I B;  5CP6 C;  4QLC B;  3UT9 A;  4R8P A;  4J8X C;  2IO5 C;  4WU9 B;  3AZJ B;  3MGP B;  1AOI D;  4H9R A;  4J8U B;  1P34 B;  5B31 C;  4KUD D;  1BH9 B;  5AV5 D;  1S32 B;  2ARO A;  3F6T A;  5GT0 C;  1HQ3 D;  3AN2 C;  3AFA D;  3UTB C;  3WTP A;  3X1S C;  5C3I C;  3AV1 C;  3W96 B;  2F8N G;  5CP6 D;  4Z66 C;  3REL C;  4J8X D;  5E5A A;  3UTA B;  1M18 A;  4H9P A;  5JA4 A;  2NZD A;  5CPK A;  2ZM5 A;  1KX5 A;  3AZK C;  3KXB C;  1AOI B;  5GT0 D;  1KX4 D;  4KUD B;  5AV5 B;  3UTB D;  3X1S D;  3LJA B;  3AV1 D;  1P3O A;  1A7W A;  5CHL B;  4XUJ B;  5AV9 A;  2G5I C;  3WKJ C;  5B0Y D;  1P3M A;  1HQ3 B;  3R45 A;  3REL D;  3AZN C;  3O62 B;  3B0C T;  3B0D C;  5AY8 C;  2VQR A;  2UWX A;  5GXQ A;  3MGQ D;  3B6F C;  3AZG A;  5B0Z C;  5B2J A;  5AV6 A;  3V9R B;  4ZUX A;  1TZY C;  2RVQ C;  3REJ A;  3NQU B;  5B32 A;  3W99 A;  4WV4 B;  4H9N A;  2F8N D;  3WKJ D;  1P3G D;  1KX4 B;  3AZN D;  5GSU B;  1P3L A;  5GT3 A;  5B0Y B;  5B24 A;  3KWQ B;  5B0Z D;  3UT9 C;  2Y2O A;  2CV5 D;  4R8P C;  4KHA B;  3MGS C;  3MGQ B;  2FJ7 B;  2F8N H;  1M1A D;  3X1T A;  4KGC A;  3AV2 A;  2F8N B;  3TU4 C;  4NE3 A;  3WTP C;  3A6N D;  3KUY D;  1P3G B;  2Y2I A;  3EPH A;  3UT9 D;  2CWE A;  4R8P D;  5E5A C;  1M18 C;  4M6B A;  2BYK A;  2NZD C;  4X23 A;  3VH5 W;  2CV5 B;  1P3K A;  4YS3 A;  4WNN A;  1KX5 C;  1JFI B;  2ARO D;  1P3I C;  4ZBJ C;  3VH6 W;  4J8W C;  1H3O B;  5B32 G;  4WU8 A; 
#chains in the Genus database with same CATH homology
 4Z5T A;  1P3O C;  5DNN B;  1M1A B;  5AV9 C;  5KDM B;  3NQJ B;  4YM6 D;  5B31 A;  5E5A D;  3A6N B;  3KUY B;  3LZ1 B;  1M18 D;  1ZLA D;  5B40 B;  3LZ0 A;  2NZD D;  3AZL A;  4WJ3 C;  1M19 A;  1N1J A;  5GXQ C;  5CPK D;  3AN2 A;  3AZG C;  5AV6 C;  3W97 B;  2HIO A;  4G91 C;  5BS7 C;  5B32 C;  2YFW A;  3EPJ A;  5AV8 A;  4Z66 A;  3W99 C;  1P3O D;  2ARO B;  1P3M D;  4UPK A;  5AVC C;  2Y2N A;  5GT3 C;  3C1C B;  3AZK A;  3WA9 D;  3KXB A;  4G92 C;  5B1L B;  4HGA B;  4CSR A;  5GXQ D;  4YM6 B;  3AZG D;  5B2J D;  5AV6 D;  1M18 B;  5F99 B;  4ZUX D;  2G5H C;  1ZLA B;  3REJ D;  5B32 D;  1T3U A;  5CPK B;  3W99 D;  4UUZ B;  5AY8 A;  3X1T C;  1P3L D;  3B6F A;  5GT3 D;  2YFV A;  3AZI B;  2ZY5 A;  4NE5 A;  4WZS B;  1P3M B;  3AZM C;  1TZY A;  3R45 B;  5B24 D;  3AYW A;  5B31 G;  1F66 B;  3VH5 A;  3WA9 B;  5GXQ B;  3C1B D;  5B2J B;  3VH6 A;  1P3P B;  1P3K C;  4YS3 C;  4ZUX B;  3REH B;  3REJ B;  2PYO C;  1P3A A;  1B67 A;  3X1T D;  4KGC D;  4DQY B;  4X23 C;  3AV2 D;  1U35 C;  4WU8 C;  4Z5T C;  5DNM B;  2Y2J A;  1P3L B;  3MGS A;  5GT3 B;  3AZE B;  5B24 B;  4Z2M G;  3LZ0 C;  3AZL C;  3B0C W;  4EO5 B;  1P3K D;  4YS3 D;  1M19 C;  3X1U B;  3TU4 A;  2HUE C;  5B33 A;  2HIO C;  3REK C;  2FFF B;  4X23 D;  3C1B B;  1U35 D;  3W98 C;  5AV8 C;  4H9Q A;  4KGC B;  3AV2 B;  3IP4 C;  5B31 D;  2Y2G A;  5AVB A;  2F8N K;  3LZ0 D;  3AZL D;  1P3I A;  1M19 D;  4J8W A;  3MGR C;  1ID3 A;  3AN2 D;  3REI A;  4AWL C;  2ZY2 A;  1P3F A;  3WTP E;  5JRG A;  4WNN B;  4Z66 D;  1BH8 A;  2Y2Q A;  3AFA B;  5FUG B;  4J8V A;  5CP6 B;  1BFM A;  4J8X B;  3AZK D;  2IO5 B;  3KXB D;  5BS7 A;  5B31 B;  3AYW C;  3H0R C;  3AZH C;  3X1V A;  5GT0 B;  1ID3 C;  3AN2 B;  5AVC A;  3UTB B;  5BNX B;  3X1S B;  5BO0 B;  2Y2L A;  5C3I B;  5AY8 D;  3AV1 B;  4NFT A;  1P3A C;  5CPJ A;  2YFW B;  4Z66 B;  3REL B;  3AZF A;  3WAA A;  3B6F D;  2LY8 A;  3H0M C;  2NQB A;  3B6G C;  1B6W A;  3LEL A;  1TZY D;  2RVQ D;  1EQZ C;  4H9O A;  3AZK B;  5CPI A;  3KXB B;  4XZQ C;  1TAF B;  1KX3 A;  4LD9 A;  5B2I A;  5B33 C;  3WKJ B;  3AZM A;  3AZN B;  5G49 A;  2Y2H A;  5AY8 B;  3B0D B;  3MGP A;  3AZJ A;  2DF4 C;  4WU9 A;  1P34 A;  3MVD C;  1S32 A;  3MGS D;  3B6F B;  2YFV B;  5B0Z B;  1TZY B;  5AVB C;  2PYO A;  1PZR A;  3TU4 D;  5B33 D;  3WTP D;  3REI C;  1Q9C A;  1P3F C;  5JRG C;  3UTA A;  1U35 A;  3B0B A;  4J8V C;  3UT9 B;  4R8P B;  5B1M C;  1KX5 D;  5AVB D;  3MNN C;  3REK A;  1P3I D;  4H9R B;  4J8W D;  3MGS B;  1ID3 D;  3LJA A;  3W98 A;  2XD5 A;  4XUJ A;  3X1V C;  5AV9 D;  5BT1 C;  3O62 A;  3TU4 B;  5B33 B;  3WTP B;  5CPJ C;  3MGR A;  3AZF C;  3WAA C;  3V9R A;  5E5A B;  2NQB C;  2Y2M A;  3LEL C;  4H9P B;  5JA4 B;  1P3B C;  1WWS A;  2NZD B;  1KX5 B;  5CPI C;  3X1V D;  1KX4 A;  1P3I B;  4ZBJ B;  4J8W B;  1ID3 B;  5GSU A;  5AVC D;  1KX3 C;  4LD9 C;  1P3O B;  5B2I C;  5CPJ D;  5AV9 B;  2F2A C;  4QLC C;  3KWQ A;  1BH8 B;  3AZF D;  3WAA D;  2NQB D;  3LEL D;  4KHA A;  4WU9 C;  3AZJ C;  3MGP C;  4J8U C;  1P34 C;  3AZH A;  3MGQ A;  1S32 C;  4JJN A;  2FJ7 A;  3AZG B;  5CPI D;  5AV6 B;  4G91 B;  5B32 B;  2F8N A;  4LD9 D;  2BYM A;  3W99 B;  3W96 C;  4H9N B;  1P3G A;  3B6G A;  3A1K A;  3AZM D;  5AVC B;  3P5J B;  1EQZ A;  3UTA C;  3MGP D;  1P34 D;  4G92 B;  4XZQ A;  1S32 D;  3KFU G;  2W8S A;  1JFI A;  1AOI C;  2PYO D;  5AV5 C;  3LJA C;  4WU8 D;  4CAY A;  5DNN A;  1M1A A;  4XUJ C;  4H9S A;  4Z5T D;  5KDM A;  1HQ3 C;  3MVD A;  3NQJ A;  3X1T B;  3KUY A;  3LZ1 A;  3O62 C;  5B40 A;  3AZM B;  1HTA A;  5G49 B;  3W97 A;  2BG1 A;  4DRB A;  2HIO D;  3REK D;  2BYK B;  3LJA D;  3KSY A;  3W98 D;  1P3K B;  4YS3 B;  5AV8 D;  4XUJ D;  2PYO B;  2DQN C;  1KX4 C;  3H0L C;  4X23 B;  1U35 B;  5GSU C;  4E45 A;  4WU8 B;  3O62 D;  3C1C A;  4Z5T B;  5B1M A;  5B1L A;  5B0Y C;  4YM6 A;  3MNN A;  3KWQ C;  3MGR D;  5F99 A;  4DRA A;  1ZLA A;  3LZ0 B;  3MGQ C;  3AZL B;  1M19 B;  4UUZ A;  4JJN C;  1N1J B;  5BNV A;  2FJ7 C;  1F1E A;  2HUE B;  2HIO B;  3REK B;  5GSU D;  3W98 B;  5AV8 B;  3AZI A;  1R4V A;  1P3G C;  4Z2M H;  3KWQ D;  2Y2P A;  1P3B A;  1F66 A;  3AYW D;  3WA9 A;  3AZH D;  4CSR B;  3MGR B;  4JJN D;  2CV5 C;  1P3P A;  2FJ7 D;  3REH A;  1Z2C B;  4AWL B;  1P3A D;  4QLC A;  5DNM A;  5DNN C;  2JSS A;  1M1A C;  3B6G D;  4H9S C;  4J8U A;  1EQZ D;  1BH9 A;  3A6N C;  3KUY C;  3LZ1 C;  3AZE A;  5B40 C;  4XZQ D;  4NE6 A;  3X1U A;  3AYW B;  3W97 C;  3W96 A;  3AZH B;  3C1B A;  4JJN B;  5DNN D;  2ARO C;  1P3A B;  3MVD D;  2BYM B;  3LZ1 D;  3B6G B;  5B40 D;  3C1C C;  1AOI A;  5B1L C;  4HGA C;  4YM6 C;  1EQZ B;  4KUD A;  5AV5 A;  3W97 D;  5F99 C;  1ZLA C;  4XZQ B;  3REI D;  2J8P A;  3EG5 B;  1P3F D;  5CPK C;  1HQ3 A;  5JRG D;  5FUG A;  3AFA A;  3A1I A;  1WWI A;  3EPL A;  2ZY3 A;  5CP6 A;  2RIQ A;  4J8V D;  4CAY B;  4J8X A;  3C1C D;  3AZI C;  5B1M D;  2ZY4 A;  4H9Q B;  5B1L D;  1P3M C;  3MVD B;  3MNN D;  3NQU A;  5F99 D;  2XD1 A;  1F66 C;  3WA9 C;  5AVB B;  2Y2K A;  5GT0 A;  5BT1 D;  3EPK A;  5B2J C;  3UTB A;  5BNX A;  1P3P C;  3X1S A;  5BO0 A;  4ZUX C;  3AV1 A;  3REH C;  3REJ C;  3REI B;  1P3F B;  1KU5 A;  5B0Y A;  3REL A;  5JRG B;  3AZI D;  1W2E A;  3VH5 T;  5DNM C;  4J8V B;  1P3B D;  1P3L C;  1F66 D;  3VH6 T;  3AL0 C;  3AZE C;  5B1M B;  5B24 C;  1TAF A;  3MNN B;  4EO5 C;  1P3P D;  3REH D;  3X1U C;  1KX3 D;  3WKJ A;  3X1V B;  5B2I D;  3C1B C;  2JE5 A;  4QLC D;  3AZN A;  5BNV B;  3FDD A;  5DNM D;  1ULY A;  2L5A A;  4WU9 D;  3AZJ D;  4KGC C;  4J8U D;  5CPJ B;  3AV2 C;  4E44 A;  5B0Z A;  3AZE D;  3AZF B;  2JCH A;  2CV5 A;  3WAA B;  2NQB B;  3LEL B;  1P3B B;  1H3O A;  4KUD C;  4H9O B;  3X1U D;  5CPI B;  3W96 D;  3AFA C;  1KX3 B;  3UTA D;  4LD9 B;  3A6N A;  5B2I B;  5CP6 C;  4QLC B;  3UT9 A;  4R8P A;  4J8X C;  2IO5 C;  4WU9 B;  3AZJ B;  3MGP B;  1AOI D;  4H9R A;  4J8U B;  1P34 B;  5B31 C;  4KUD D;  1BH9 B;  5AV5 D;  1S32 B;  2ARO A;  3F6T A;  5GT0 C;  1HQ3 D;  3AN2 C;  3AFA D;  3UTB C;  3WTP A;  3X1S C;  5C3I C;  3AV1 C;  3W96 B;  2F8N G;  5CP6 D;  4Z66 C;  3REL C;  4J8X D;  5E5A A;  3UTA B;  1M18 A;  4H9P A;  5JA4 A;  2NZD A;  5CPK A;  2ZM5 A;  1KX5 A;  3AZK C;  3KXB C;  1AOI B;  5GT0 D;  1KX4 D;  4KUD B;  5AV5 B;  3UTB D;  3X1S D;  3LJA B;  3AV1 D;  1P3O A;  1A7W A;  5CHL B;  4XUJ B;  5AV9 A;  2G5I C;  3WKJ C;  5B0Y D;  1P3M A;  1HQ3 B;  3R45 A;  3REL D;  3AZN C;  3O62 B;  3B0C T;  3B0D C;  5AY8 C;  2VQR A;  2UWX A;  5GXQ A;  3MGQ D;  3B6F C;  3AZG A;  5B0Z C;  5B2J A;  5AV6 A;  3V9R B;  4ZUX A;  1TZY C;  2RVQ C;  3REJ A;  3NQU B;  5B32 A;  3W99 A;  4WV4 B;  4H9N A;  2F8N D;  3WKJ D;  1P3G D;  1KX4 B;  3AZN D;  5GSU B;  1P3L A;  5GT3 A;  5B0Y B;  5B24 A;  3KWQ B;  5B0Z D;  3UT9 C;  2Y2O A;  2CV5 D;  4R8P C;  4KHA B;  3MGS C;  3MGQ B;  2FJ7 B;  2F8N H;  1M1A D;  3X1T A;  4KGC A;  3AV2 A;  2F8N B;  3TU4 C;  4NE3 A;  3WTP C;  3A6N D;  3KUY D;  1P3G B;  2Y2I A;  3EPH A;  3UT9 D;  2CWE A;  4R8P D;  5E5A C;  1M18 C;  4M6B A;  2BYK A;  2NZD C;  4X23 A;  3VH5 W;  2CV5 B;  1P3K A;  4YS3 A;  4WNN A;  1KX5 C;  1JFI B;  2ARO D;  1P3I C;  4ZBJ C;  3VH6 W;  4J8W C;  1H3O B;  5B32 G;  4WU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...