3UT9C

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9C00
1BH8B 1P3BB 5CP6C 3AZKB 3KWQC 4J8UB 3AV2B 2PYOD 3WAAB 4UUZB 2FJ7D 1P3AC 2NZDC 5AV5C 1R4VA 4WU9B 5AVBA 3AYWD 3B6GA 5B24A 4H9OB 1AOIC 1P3FC 3WA9A 5B2JB 1M18B 3O62B 2CWEA 5CPJD 5DNNA 5B1LA 3AZMC 3AZFD 4NFTA 3VH5W 5B31C 3REKB 3C1BC 1ZLAA 1F66B 1P3KB 1U35B 3NQJA 5B0ZA 5B1MC 5B32G 3AV1A 1TZYC 3RELA 4ZBJB 3LZ0C 2PYOB 2FJ7B 3MVDA 5C3IC 1N1JB 1KX5D 5E5AC 3AZID 5BO0A 4QLCD 1F1EA 3WTPB 3AYWB 2BYMA 5AV8B 3MGRD 4KGCA 4NE3A 1BFMA 5CPJB 4WU8A 4YS3D 4J8XC 2JSSA 5DNMC 3UTAC 3AZFB 4ZUXD 3UT9D 5CPKA 3A6ND 3MNNC 1M1AC 4JJNA 2NQBC 1P3MC 3W97A 4CSRA 1KX4A 4Z2MH 5GT3A 5B2IA 1S32C 3AZLC 1KX5B 3AZIB 3MGSA 3X1UC 3WKJC 4QLCB 3REIA 5AVBD 3B6GD 5B24D 1HQ3C 3MGRB 3WA9D 3AN2C 5AV9A 3X1VC 3AZGC 1P3OC 4YS3B 5DNND 5B1LD 4H9QB 4ZUXB 3UT9B 3LELA 1ZLAD 3A6NB 3LZ1A 5BNXA 5AY8C 5B0ZD 5CPIA 2F8NA 5GXQC 2YFVB 1P3BC 3REHA 3NQUB 4AWLB 3RELD 3AV2C 4XUJA 3C1CA 2CV5A 4KUDA 3MVDD 4WZSB 5AVBB 4DRBA 5B2JC 5B24B 1M18C 3B6GB 3WA9B 1P3LA 5JRGC 4KGCD 1ID3A 5DNNB 4WU8D 5B1LB 5B31G 5B40A 2HIOA 5CPKD 1ZLAB 3UTBA 1P34A 3W96C 3NQJB 5B0ZB 4JJND 3AZJC 4Z66D 3W97D 3AV1B 4H9SC 4YM6A 3RELB 3KUYA 2PYOC 2FJ7C 1KX4D 2L5AA 5GT3D 5B2ID 3MVDB 3X1TA 3AYWC 3WTPC 1TAFA 5AV8C 3MGSD 5BO0B 4R8PA 3REID 4Z5TA 2BYMB 4Z2MG 5CPJC 2YFWA 5AV9D 4KGCB 5CP6A 4WU8B 2NZDA 5CPKB 3LELD 3W98A 5AV5A 4XZQC 3LZ1D 1P3FA 4JJNB 5CPID 2F8ND 1BH9A 3W97B 3REHD 3AZNC 3AZMA 4H9RA 4CSRB 4XUJD 1KX4B 3C1BA 3C1CD 5GT3B 2CV5D 5B2IB 4KUDD 4QLCC 5CHLB 3MGSB 5B1MA 3MGRC 3REIB 1TZYA 5B33C 4YS3C 5AV9B 1P3LD 1P3PC 3UT9C 1ID3D 5GT0A 5B40D 3REJA 3A6NC 4J8VC 3LELB 2HIOD 5E5AA 1WWIA 3LZ1B 3UTBD 1P34D 5BNXB 5CPIB 2BYKA 4AWLC 2F8NB 3X1SC 4X23C 3REHB 1P3ID 4YM6D 4EO5B 5DNMA 5B0YA 3UTAA 3KUYD 4XUJB 3TU4A 3C1CB 2AROC 3W99A 5BS7C 5BT1D 2CV5B 1WWSA 4KUDB 1EQZA 3X1TD 1M1AA 3AZEA 2NQBA 4R8PD 4Z5TD 5JA4A 3KXBC 1P3LB 5CP6D 1ID3B 3MGQA 1P3GA 3MGPA 5B40B 4NE5A 1S32A 5GSUC 3AZLA 4Z66A 5AV6A 2HIOB 2RVQC 3B0DB 5AV5D 3W98D 2NZDD 3UTBB 1P34B 1H3OA 1HQ3A 3AV1C 1P3FD 3KSYA 2HUEC 1P3OA 4YM6B 3AZMD 3KUYB 3AFAC 3MVDC 5B32A 5KDMA 3C1BD 1KX3A 3X1TB 5AY8A 1TAFB 5B1MD 5AVCA 5GXQA 4R8PB 4Z5TB 1TZYD 3WTPE 2YFWB 5CP6B 4LD9C 5CPKC 5GT0D 3REJD 2NZDB 2F8NK 3W98B 5AV5B 5E5AD 3AZKC 4JJNC 3WAAC 4J8UC 3W97C 1P3FB 5G49A 4WNNA 5JRGA 1BH9B 4WU9C 3B6FA 3UTAD 5DNMD 5F99A 5B0YD 4H9RB 3TU4D 5B2IC 3LJAA 3C1BB 3W99D 4J8WA 3O62C 3MGSC 3AZHA 3W96A 1EQZD 3REIC 1M1AD 5B1MB 3AZED 3AZJA 3REKC 2NQBD 1TZYB 4H9SA 4HGAB 1F66C 1P3KC 1U35C 3MGQD 4KHAA 1P3GD 5GT0B 3MGPD 3REJB 5C3IB 1S32D 3AZLD 5AV6D 4ZBJC 5E5AB 1P3IA 3REHC 1HQ3D 2BYKB 4XUJC 1P3OD 3UTAB 5B0YB 5DNMB 3TU4B 1M19A 4M6BA 3W99B 5B32D 1KX3D 4XZQA 3AZFC 1EQZB 1M1AB 5AY8D 3AZEB 3KWQA 2NQBB 5AVCD 5GXQD 3VH6T 3AZNA 5JA4B 1P3AA 2F8NH 5B40C 1JFIA 3MGQB 1P3GB 3MGPB 2HIOC 3B0DC 1AOIA 3R45A 1S32B 1KU5A 3AZLB 4Z66B 5AV6B 1P34C 1H3OB 5B33A 1HQ3B 5B31A 4YM6C 1KX5C 5JRGD 1P3PA 3AZIC 1P3OB 4H9QA 3B6FD 5F99D 3V9RA 5BT1C 3B0CT 4J8VA 3VH6W 3LJAD 5B32B 5KDMB 1KX3B 4J8WD 3AZHD 3LZ0A 3W96D 5AY8B 4Z5TC 4CAYA 4ZUXC 5AVCB 5GXQB 3AZJD 4G91B 3X1SA 4X23A 1A7WA 4H9NA 1HTAA 2LY8A 2AROA 5BS7A 3W98C 3WTPD 2IO5B 5AV8D 4G92B 4J8XA 1Q9CA 3B0CW 5G49B 3KXBA 4WNNB 4H9PA 1B67A 5JRGB 1B6WA 3B6FB 3MNNA 5AVBC 5F99B 3B6GC 5B24C 1M19D 5GSUA 3LJAB 1P3MA 3WA9C 4J8WB 4WV4B 5DNNC 4XZQD 5B1LC 3AZHB 3W96B 3KWQD 4HGAC 3AZJB 1ZLAC 3AZND 1P3AD 3AFAA 5GT0C 3X1UA 5B0ZC 3REJC 3WKJA 5FUGA 4KHAB 1AOID 3RELC 3AN2A 4E45A 3AZGA 3X1VA 2F8NG 1P3IB 5B33D 5B31D 5B0YC 3TU4C 1P3PD 4LD9A 3W99C 5BNVA 1M19B 1BH8A 4J8VD 4E44A 1P3BA 1EQZC 4KGCC 3AZKA 3AZEC 4WU8C 4XZQB 4J8UA 3AV2A 3WAAA 3LZ0D 4UUZA 3KWQB 3X1SD 4X23D 4WU9A 3AZNB 1P3AB 3MGQC 1P3GC 4H9OA 3MGPC 1JFIB 5B2JA 5AV6C 2AROD 4Z66C 1M18A 1AOIB 3O62A 3R45B 4DRAA 3AZMB 4J8XD 3REKA 1KX4C 5B33B 5GT3C 5B31B 1F66A 3KXBD 1P3KA 2YFVA 1U35A 1P3PB 3MNND 3V9RB 5B32C 1KX3C 4J8VB 5GSUD 1P3MD 5AV9C 2RVQD 5AVCC 2PYOA 3LZ0B 4G91C 3AV1D 4CAYB 2FJ7A 1N1JA 3LELC 3X1SB 4X23B 3LZ1C 3AYWA 3WTPA 3AFAD 5AV8A 3X1UD 4H9NB 5CPIC 3WKJD 2AROB 5CPJA 2IO5C 4G92C 3AZFA 3AN2D 4EO5C 3AZGD 3X1VD 4J8XB 3C1CC 2CV5C 3KXBB 3B6FC 4H9PB 4KUDC 5F99C 3MNNB 4LD9D 3LJAC 4J8WC 5GSUB 1P3MB 3VH6A 3AZHC 1P3BD 1P3LC 4NE6A 3AZKD 1ID3C 4J8UD 3AV2D 3B0BA 3WAAD 2HUEB 1KX5A 3AZIA 4WU9D 4QLCA 3UTBC 3AFAB 3X1UB 3MGRA 3WKJB 5FUGB 5B2JD 1M18D 1P3IC 3O62D 1ULYA 3AN2B 4YS3A 3AZGB 3X1VB 3KUYC 4ZUXA 3UT9A 3REKD 3A6NA 1F66D 1P3KD 3X1TC 1U35D 1M19C 4LD9B 3VH5A 3VH5T 4R8PC 5BNVB 3NQUA
chains in the Genus database with same CATH superfamily
1BH8B 1P3BB 5CP6C 3AZKB 3EPHA 3KFUG 3KWQC 2Y2NA 4J8UB 3AV2B 2PYOD 3WAAB 4UUZB 2FJ7D 1P3AC 2NZDC 5AV5C 1R4VA 4WU9B 5AVBA 3AYWD 3B6GA 5B24A 4H9OB 3EPKA 1P3FC 1AOIC 3WA9A 5B2JB 1M18B 3O62B 2CWEA 5CPJD 5DNNA 5B1LA 3AZMC 3AZFD 4NFTA 3VH5W 2Y2LA 5B31C 3REKB 3H0MC 3C1BC 1ZLAA 1F66B 1P3KB 1U35B 3NQJA 5B0ZA 5B1MC 5B32G 3AV1A 1TZYC 3RELA 4ZBJB 3LZ0C 2PYOB 2FJ7B 3MVDA 5C3IC 1N1JB 1KX5D 5E5AC 3AZID 2ZY3A 4QLCD 1F1EA 3WTPB 5BO0A 2BYMA 3AYWB 5AV8B 3MGRD 4KGCA 4NE3A 1BFMA 5CPJB 2Y2PA 4WU8A 4YS3D 4J8XC 2JSSA 5DNMC 3UTAC 3AZFB 4ZUXD 3UT9D 5CPKA 2FFFB 3A6ND 3MNNC 2RIQA 1M1AC 4JJNA 2NQBC 1P3MC 3W97A 1Z2CB 4CSRA 1KX4A 4Z2MH 5GT3A 5B2IA 1S32C 3AZLC 1KX5B 3AZIB 3MGSA 3X1UC 3WKJC 4QLCB 3REIA 5AVBD 3B6GD 5B24D 1HQ3C 3MGRB 3WA9D 3AN2C 5AV9A 3X1VC 3AZGC 1P3OC 4YS3B 5DNND 5B1LD 3F6TA 1W2EA 3AL0C 4H9QB 4ZUXB 3UT9B 3LELA 1ZLAD 3A6NB 3LZ1A 5BNXA 5AY8C 5B0ZD 5CPIA 2F8NA 5GXQC 2YFVB 1P3BC 3REHA 3NQUB 4AWLB 3RELD 3EG5B 3AV2C 4XUJA 2VQRA 3C1CA 2CV5A 4KUDA 3MVDD 4WZSB 2JE5A 2ZY4A 5AVBB 4DRBA 5B2JC 5B24B 1M18C 3B6GB 3WA9B 1P3LA 5JRGC 4KGCD 1ID3A 5DNNB 4WU8D 5B1LB 5B31G 5B40A 2Y2GA 2HIOA 5CPKD 1ZLAB 3P5JB 3UTBA 1P34A 3W96C 3NQJB 5B0ZB 4JJND 3AZJC 4Z66D 3W97D 3AV1B 4H9SC 4YM6A 3RELB 3KUYA 2PYOC 2FJ7C 1KX4D 2L5AA 5GT3D 5B2ID 3MVDB 2Y2MA 3AYWC 3X1TA 3WTPC 4DQYB 1TAFA 5AV8C 3MGSD 5BO0B 4R8PA 3REID 2DQNC 2BYMB 4Z5TA 4Z2MG 5CPJC 2YFWA 5AV9D 4KGCB 5CP6A 4WU8B 2NZDA 5CPKB 3LELD 3W98A 5AV5A 3EPLA 4XZQC 3LZ1D 1P3FA 4JJNB 5CPID 2F8ND 1BH9A 3W97B 2G5HC 3REHD 3AZNC 3AZMA 3FDDA 4H9RA 4CSRB 4XUJD 1KX4B 3C1BA 3C1CD 5GT3B 2CV5D 5B2IB 4KUDD 4QLCC 5CHLB 3MGSB 5B1MA 3MGRC 3REIB 1TZYA 5B33C 4YS3C 5AV9B 1P3LD 1P3PC 2XD5A 3UT9C 1ID3D 5GT0A 5B40D 3REJA 3A6NC 4J8VC 3LELB 2HIOD 5E5AA 1WWIA 3LZ1B 3UTBD 1P34D 5BNXB 5CPIB 2BYKA 4AWLC 2F8NB 3X1SC 4X23C 3REHB 1P3ID 2Y2OA 4YM6D 4EO5B 5DNMA 5B0YA 3UTAA 3KUYD 4XUJB 3TU4A 3C1CB 2AROC 3W99A 5BS7C 5BT1D 2CV5B 1WWSA 4KUDB 1EQZA 3X1TD 1M1AA 3AZEA 2NQBA 2BG1A 4R8PD 4Z5TD 5JA4A 3KXBC 1P3LB 5CP6D 4UPKA 1ID3B 3MGQA 2ZM5A 1P3GA 3MGPA 5B40B 4NE5A 1S32A 5GSUC 3AZLA 5AV6A 4Z66A 2HIOB 2RVQC 3B0DB 5AV5D 3W98D 2NZDD 3UTBB 1P34B 1H3OA 1HQ3A 3AV1C 1P3FD 3KSYA 2HUEC 1P3OA 4YM6B 3AZMD 3KUYB 3AFAC 3MVDC 2Y2IA 4WJ3C 5B32A 5KDMA 3C1BD 1KX3A 3X1TB 5AY8A 1TAFB 5B1MD 5AVCA 5GXQA 4R8PB 4Z5TB 1TZYD 3A1KA 3WTPE 2YFWB 5CP6B 4LD9C 5CPKC 5GT0D 3REJD 2NZDB 2F8NK 3W98B 5AV5B 5E5AD 3AZKC 4JJNC 3WAAC 4J8UC 3W97C 1P3FB 5G49A 4WNNA 5JRGA 1T3UA 1BH9B 4WU9C 3B6FA 3UTAD 2Y2JA 5F99A 5DNMD 4H9RB 5B0YD 3TU4D 5B2IC 3LJAA 3C1BB 3W99D 4J8WA 3O62C 3MGSC 3AZHA 3W96A 1EQZD 3REIC 1M1AD 5B1MB 3AZED 3AZJA 3REKC 2NQBD 1TZYB 4H9SA 4HGAB 1F66C 1P3KC 1U35C 3MGQD 4KHAA 1P3GD 5GT0B 3MGPD 3REJB 5C3IB 1S32D 3AZLD 5AV6D 4ZBJC 5E5AB 1P3IA 2ZY5A 3REHC 1HQ3D 2BYKB 4XUJC 1P3OD 3UTAB 5B0YB 5DNMB 3TU4B 1M19A 4M6BA 3W99B 5B32D 1KX3D 4XZQA 3AZFC 1EQZB 1M1AB 5AY8D 3H0LC 3AZEB 3KWQA 2Y2QA 2NQBB 5AVCD 5GXQD 2UWXA 3VH6T 3AZNA 5JA4B 1P3AA 2F8NH 5B40C 1JFIA 3MGQB 1P3GB 3MGPB 2HIOC 3B0DC 1AOIA 3R45A 1S32B 1KU5A 3AZLB 4Z66B 5AV6B 1P34C 1H3OB 5B33A 1HQ3B 5B31A 4YM6C 1KX5C 5JRGD 1P3PA 3AZIC 1P3OB 4H9QA 3B6FD 3A1IA 5F99D 3V9RA 5BT1C 3B0CT 4J8VA 3VH6W 3LJAD 5B32B 5KDMB 1KX3B 4J8WD 3AZHD 3LZ0A 3W96D 5AY8B 4Z5TC 4CAYA 4ZUXC 5AVCB 5GXQB 3AZJD 4G91B 3X1SA 4X23A 1A7WA 4H9NA 1HTAA 2LY8A 2AROA 5BS7A 3W98C 3WTPD 2IO5B 5AV8D 4G92B 4J8XA 1Q9CA 3B0CW 5G49B 3KXBA 4WNNB 4H9PA 1B67A 5JRGB 1B6WA 3B6FB 3MNNA 5AVBC 5F99B 3B6GC 5B24C 1M19D 5GSUA 3LJAB 1P3MA 3WA9C 4J8WB 4WV4B 5DNNC 4XZQD 5B1LC 2W8SA 3AZHB 3W96B 3KWQD 4HGAC 3AZJB 1ZLAC 3AZND 2Y2KA 1P3AD 3AFAA 5GT0C 3X1UA 5B0ZC 2Y2HA 3REJC 3WKJA 5FUGA 4KHAB 1AOID 3RELC 3AN2A 4E45A 3AZGA 3X1VA 2F8NG 1P3IB 5B33D 5B31D 5B0YC 2F2AC 3TU4C 1P3PD 4LD9A 3W99C 5BNVA 1M19B 1BH8A 4J8VD 4E44A 1P3BA 1EQZC 4KGCC 3AZKA 3AZEC 4WU8C 4XZQB 4J8UA 3AV2A 3WAAA 3LZ0D 4UUZA 3KWQB 3X1SD 4X23D 4WU9A 3AZNB 1P3AB 3MGQC 1P3GC 4H9OA 3MGPC 1JFIB 5B2JA 5AV6C 2AROD 4Z66C 1M18A 1AOIB 3O62A 3R45B 4DRAA 2XD1A 3AZMB 4J8XD 3REKA 1KX4C 3IP4C 5B33B 5GT3C 5B31B 1F66A 3KXBD 1P3KA 2YFVA 1U35A 1P3PB 3MNND 3V9RB 5B32C 1KX3C 2JCHA 4J8VB 5GSUD 1P3MD 5AV9C 2G5IC 2RVQD 5AVCC 2PYOA 3LZ0B 4G91C 3AV1D 4CAYB 2FJ7A 1N1JA 3LELC 3X1SB 4X23B 3LZ1C 3AYWA 3WTPA 3AFAD 5AV8A 3X1UD 4H9NB 5CPIC 3WKJD 2AROB 5CPJA 2IO5C 4G92C 3AZFA 3AN2D 4EO5C 3AZGD 3X1VD 4J8XB 3C1CC 2CV5C 3EPJA 3KXBB 3B6FC 4H9PB 4KUDC 5F99C 2DF4C 3MNNB 3LJAC 4LD9D 4J8WC 5GSUB 1P3MB 3VH6A 3AZHC 1P3BD 1P3LC 4NE6A 3AZKD 1ID3C 4J8UD 3AV2D 3B0BA 3WAAD 2ZY2A 2HUEB 1KX5A 3AZIA 4WU9D 4QLCA 3UTBC 2J8PA 3AFAB 3X1UB 3MGRA 3WKJB 3H0RC 5FUGB 5B2JD 1M18D 1P3IC 3O62D 1ULYA 3AN2B 4YS3A 3AZGB 3X1VB 3KUYC 4ZUXA 3UT9A 3REKD 3A6NA 1F66D 1P3KD 3X1TC 1U35D 1PZRA 1M19C 4LD9B 3VH5A 3VH5T 4R8PC 5BNVB 3NQUA
chains in the Genus database with same CATH topology
1BH8B 1P3BB 5CP6C 3AZKB 3EPHA 3KFUG 3KWQC 2Y2NA 4J8UB 3AV2B 2PYOD 3WAAB 4UUZB 2FJ7D 1P3AC 2NZDC 5AV5C 1R4VA 4WU9B 5AVBA 3AYWD 3B6GA 5B24A 4H9OB 3EPKA 1P3FC 1AOIC 3WA9A 5B2JB 1M18B 3O62B 2CWEA 5CPJD 5DNNA 5B1LA 3AZMC 3AZFD 4NFTA 3VH5W 2Y2LA 5B31C 3REKB 3H0MC 3C1BC 1ZLAA 1F66B 1P3KB 1U35B 3NQJA 5B0ZA 5B1MC 5B32G 3AV1A 1TZYC 3RELA 4ZBJB 3LZ0C 2PYOB 2FJ7B 3MVDA 5C3IC 1N1JB 1KX5D 5E5AC 3AZID 2ZY3A 4QLCD 1F1EA 3WTPB 5BO0A 2BYMA 3AYWB 5AV8B 3MGRD 4KGCA 4NE3A 1BFMA 5CPJB 2Y2PA 4WU8A 4YS3D 4J8XC 2JSSA 5DNMC 3UTAC 3AZFB 4ZUXD 3UT9D 5CPKA 2FFFB 3A6ND 3MNNC 2RIQA 1M1AC 4JJNA 2NQBC 1P3MC 3W97A 1Z2CB 4CSRA 1KX4A 4Z2MH 5GT3A 5B2IA 1S32C 3AZLC 1KX5B 3AZIB 3MGSA 3X1UC 3WKJC 4QLCB 3REIA 5AVBD 3B6GD 5B24D 1HQ3C 3MGRB 3WA9D 3AN2C 5AV9A 3X1VC 3AZGC 1P3OC 4YS3B 5DNND 5B1LD 3F6TA 1W2EA 3AL0C 4H9QB 4ZUXB 3UT9B 3LELA 1ZLAD 3A6NB 3LZ1A 5BNXA 5AY8C 5B0ZD 5CPIA 2F8NA 5GXQC 2YFVB 1P3BC 3REHA 3NQUB 4AWLB 3RELD 3EG5B 3AV2C 4XUJA 2VQRA 3C1CA 2CV5A 4KUDA 3MVDD 4WZSB 2JE5A 2ZY4A 5AVBB 4DRBA 5B2JC 5B24B 1M18C 3B6GB 3WA9B 1P3LA 5JRGC 4KGCD 1ID3A 5DNNB 4WU8D 5B1LB 5B31G 5B40A 2Y2GA 2HIOA 5CPKD 1ZLAB 3P5JB 3UTBA 1P34A 3W96C 3NQJB 5B0ZB 4JJND 3AZJC 4Z66D 3W97D 3AV1B 4H9SC 4YM6A 3RELB 3KUYA 2PYOC 2FJ7C 1KX4D 2L5AA 5GT3D 5B2ID 3MVDB 2Y2MA 3AYWC 3X1TA 3WTPC 4DQYB 1TAFA 5AV8C 3MGSD 5BO0B 4R8PA 3REID 2DQNC 2BYMB 4Z5TA 4Z2MG 5CPJC 2YFWA 5AV9D 4KGCB 5CP6A 4WU8B 2NZDA 5CPKB 3LELD 3W98A 5AV5A 3EPLA 4XZQC 3LZ1D 1P3FA 4JJNB 5CPID 2F8ND 1BH9A 3W97B 2G5HC 3REHD 3AZNC 3AZMA 3FDDA 4H9RA 4CSRB 4XUJD 1KX4B 3C1BA 3C1CD 5GT3B 2CV5D 5B2IB 4KUDD 4QLCC 5CHLB 3MGSB 5B1MA 3MGRC 3REIB 1TZYA 5B33C 4YS3C 5AV9B 1P3LD 1P3PC 2XD5A 3UT9C 1ID3D 5GT0A 5B40D 3REJA 3A6NC 4J8VC 3LELB 2HIOD 5E5AA 1WWIA 3LZ1B 3UTBD 1P34D 5BNXB 5CPIB 2BYKA 4AWLC 2F8NB 3X1SC 4X23C 3REHB 1P3ID 2Y2OA 4YM6D 4EO5B 5DNMA 5B0YA 3UTAA 3KUYD 4XUJB 3TU4A 3C1CB 2AROC 3W99A 5BS7C 5BT1D 2CV5B 1WWSA 4KUDB 1EQZA 3X1TD 1M1AA 3AZEA 2NQBA 2BG1A 4R8PD 4Z5TD 5JA4A 3KXBC 1P3LB 5CP6D 4UPKA 1ID3B 3MGQA 2ZM5A 1P3GA 3MGPA 5B40B 4NE5A 1S32A 5GSUC 3AZLA 5AV6A 4Z66A 2HIOB 2RVQC 3B0DB 5AV5D 3W98D 2NZDD 3UTBB 1P34B 1H3OA 1HQ3A 3AV1C 1P3FD 3KSYA 2HUEC 1P3OA 4YM6B 3AZMD 3KUYB 3AFAC 3MVDC 2Y2IA 4WJ3C 5B32A 5KDMA 3C1BD 1KX3A 3X1TB 5AY8A 1TAFB 5B1MD 5AVCA 5GXQA 4R8PB 4Z5TB 1TZYD 3A1KA 3WTPE 2YFWB 5CP6B 4LD9C 5CPKC 5GT0D 3REJD 2NZDB 2F8NK 3W98B 5AV5B 5E5AD 3AZKC 4JJNC 3WAAC 4J8UC 3W97C 1P3FB 5G49A 4WNNA 5JRGA 1T3UA 1BH9B 4WU9C 3B6FA 3UTAD 2Y2JA 5F99A 5DNMD 4H9RB 5B0YD 3TU4D 5B2IC 3LJAA 3C1BB 3W99D 4J8WA 3O62C 3MGSC 3AZHA 3W96A 1EQZD 3REIC 1M1AD 5B1MB 3AZED 3AZJA 3REKC 2NQBD 1TZYB 4H9SA 4HGAB 1F66C 1P3KC 1U35C 3MGQD 4KHAA 1P3GD 5GT0B 3MGPD 3REJB 5C3IB 1S32D 3AZLD 5AV6D 4ZBJC 5E5AB 1P3IA 2ZY5A 3REHC 1HQ3D 2BYKB 4XUJC 1P3OD 3UTAB 5B0YB 5DNMB 3TU4B 1M19A 4M6BA 3W99B 5B32D 1KX3D 4XZQA 3AZFC 1EQZB 1M1AB 5AY8D 3H0LC 3AZEB 3KWQA 2Y2QA 2NQBB 5AVCD 5GXQD 2UWXA 3VH6T 3AZNA 5JA4B 1P3AA 2F8NH 5B40C 1JFIA 3MGQB 1P3GB 3MGPB 2HIOC 3B0DC 1AOIA 3R45A 1S32B 1KU5A 3AZLB 4Z66B 5AV6B 1P34C 1H3OB 5B33A 1HQ3B 5B31A 4YM6C 1KX5C 5JRGD 1P3PA 3AZIC 1P3OB 4H9QA 3B6FD 3A1IA 5F99D 3V9RA 5BT1C 3B0CT 4J8VA 3VH6W 3LJAD 5B32B 5KDMB 1KX3B 4J8WD 3AZHD 3LZ0A 3W96D 5AY8B 4Z5TC 4CAYA 4ZUXC 5AVCB 5GXQB 3AZJD 4G91B 3X1SA 4X23A 1A7WA 4H9NA 1HTAA 2LY8A 2AROA 5BS7A 3W98C 3WTPD 2IO5B 5AV8D 4G92B 4J8XA 1Q9CA 3B0CW 5G49B 3KXBA 4WNNB 4H9PA 1B67A 5JRGB 1B6WA 3B6FB 3MNNA 5AVBC 5F99B 3B6GC 5B24C 1M19D 5GSUA 3LJAB 1P3MA 3WA9C 4J8WB 4WV4B 5DNNC 4XZQD 5B1LC 2W8SA 3AZHB 3W96B 3KWQD 4HGAC 3AZJB 1ZLAC 3AZND 2Y2KA 1P3AD 3AFAA 5GT0C 3X1UA 5B0ZC 2Y2HA 3REJC 3WKJA 5FUGA 4KHAB 1AOID 3RELC 3AN2A 4E45A 3AZGA 3X1VA 2F8NG 1P3IB 5B33D 5B31D 5B0YC 2F2AC 3TU4C 1P3PD 4LD9A 3W99C 5BNVA 1M19B 1BH8A 4J8VD 4E44A 1P3BA 1EQZC 4KGCC 3AZKA 3AZEC 4WU8C 4XZQB 4J8UA 3AV2A 3WAAA 3LZ0D 4UUZA 3KWQB 3X1SD 4X23D 4WU9A 3AZNB 1P3AB 3MGQC 1P3GC 4H9OA 3MGPC 1JFIB 5B2JA 5AV6C 2AROD 4Z66C 1M18A 1AOIB 3O62A 3R45B 4DRAA 2XD1A 3AZMB 4J8XD 3REKA 1KX4C 3IP4C 5B33B 5GT3C 5B31B 1F66A 3KXBD 1P3KA 2YFVA 1U35A 1P3PB 3MNND 3V9RB 5B32C 1KX3C 2JCHA 4J8VB 5GSUD 1P3MD 5AV9C 2G5IC 2RVQD 5AVCC 2PYOA 3LZ0B 4G91C 3AV1D 4CAYB 2FJ7A 1N1JA 3LELC 3X1SB 4X23B 3LZ1C 3AYWA 3WTPA 3AFAD 5AV8A 3X1UD 4H9NB 5CPIC 3WKJD 2AROB 5CPJA 2IO5C 4G92C 3AZFA 3AN2D 4EO5C 3AZGD 3X1VD 4J8XB 3C1CC 2CV5C 3EPJA 3KXBB 3B6FC 4H9PB 4KUDC 5F99C 2DF4C 3MNNB 3LJAC 4LD9D 4J8WC 5GSUB 1P3MB 3VH6A 3AZHC 1P3BD 1P3LC 4NE6A 3AZKD 1ID3C 4J8UD 3AV2D 3B0BA 3WAAD 2ZY2A 2HUEB 1KX5A 3AZIA 4WU9D 4QLCA 3UTBC 2J8PA 3AFAB 3X1UB 3MGRA 3WKJB 3H0RC 5FUGB 5B2JD 1M18D 1P3IC 3O62D 1ULYA 3AN2B 4YS3A 3AZGB 3X1VB 3KUYC 4ZUXA 3UT9A 3REKD 3A6NA 1F66D 1P3KD 3X1TC 1U35D 1PZRA 1M19C 4LD9B 3VH5A 3VH5T 4R8PC 5BNVB 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 B;  1P3B B;  5CP6 C;  3AZK B;  3KWQ C;  4J8U B;  3AV2 B;  2PYO D;  3WAA B;  4UUZ B;  2FJ7 D;  1P3A C;  2NZD C;  5AV5 C;  1R4V A;  4WU9 B;  5AVB A;  3AYW D;  3B6G A;  5B24 A;  4H9O B;  1AOI C;  1P3F C;  3WA9 A;  5B2J B;  1M18 B;  3O62 B;  2CWE A;  5CPJ D;  5DNN A;  5B1L A;  3AZM C;  3AZF D;  4NFT A;  3VH5 W;  5B31 C;  3REK B;  3C1B C;  1ZLA A;  1F66 B;  1P3K B;  1U35 B;  3NQJ A;  5B0Z A;  5B1M C;  5B32 G;  3AV1 A;  1TZY C;  3REL A;  4ZBJ B;  3LZ0 C;  2PYO B;  2FJ7 B;  3MVD A;  5C3I C;  1N1J B;  1KX5 D;  5E5A C;  3AZI D;  5BO0 A;  4QLC D;  1F1E A;  3WTP B;  3AYW B;  2BYM A;  5AV8 B;  3MGR D;  4KGC A;  4NE3 A;  1BFM A;  5CPJ B;  4WU8 A;  4YS3 D;  4J8X C;  2JSS A;  5DNM C;  3UTA C;  3AZF B;  4ZUX D;  3UT9 D;  5CPK A;  3A6N D;  3MNN C;  1M1A C;  4JJN A;  2NQB C;  1P3M C;  3W97 A;  4CSR A;  1KX4 A;  4Z2M H;  5GT3 A;  5B2I A;  1S32 C;  3AZL C;  1KX5 B;  3AZI B;  3MGS A;  3X1U C;  3WKJ C;  4QLC B;  3REI A;  5AVB D;  3B6G D;  5B24 D;  1HQ3 C;  3MGR B;  3WA9 D;  3AN2 C;  5AV9 A;  3X1V C;  3AZG C;  1P3O C;  4YS3 B;  5DNN D;  5B1L D;  4H9Q B;  4ZUX B;  3UT9 B;  3LEL A;  1ZLA D;  3A6N B;  3LZ1 A;  5BNX A;  5AY8 C;  5B0Z D;  5CPI A;  2F8N A;  5GXQ C;  2YFV B;  1P3B C;  3REH A;  3NQU B;  4AWL B;  3REL D;  3AV2 C;  4XUJ A;  3C1C A;  2CV5 A;  4KUD A;  3MVD D;  4WZS B;  5AVB B;  4DRB A;  5B2J C;  5B24 B;  1M18 C;  3B6G B;  3WA9 B;  1P3L A;  5JRG C;  4KGC D;  1ID3 A;  5DNN B;  4WU8 D;  5B1L B;  5B31 G;  5B40 A;  2HIO A;  5CPK D;  1ZLA B;  3UTB A;  1P34 A;  3W96 C;  3NQJ B;  5B0Z B;  4JJN D;  3AZJ C;  4Z66 D;  3W97 D;  3AV1 B;  4H9S C;  4YM6 A;  3REL B;  3KUY A;  2PYO C;  2FJ7 C;  1KX4 D;  2L5A A;  5GT3 D;  5B2I D;  3MVD B;  3X1T A;  3AYW C;  3WTP C;  1TAF A;  5AV8 C;  3MGS D;  5BO0 B;  4R8P A;  3REI D;  4Z5T A;  2BYM B;  4Z2M G;  5CPJ C;  2YFW A;  5AV9 D;  4KGC B;  5CP6 A;  4WU8 B;  2NZD A;  5CPK B;  3LEL D;  3W98 A;  5AV5 A;  4XZQ C;  3LZ1 D;  1P3F A;  4JJN B;  5CPI D;  2F8N D;  1BH9 A;  3W97 B;  3REH D;  3AZN C;  3AZM A;  4H9R A;  4CSR B;  4XUJ D;  1KX4 B;  3C1B A;  3C1C D;  5GT3 B;  2CV5 D;  5B2I B;  4KUD D;  4QLC C;  5CHL B;  3MGS B;  5B1M A;  3MGR C;  3REI B;  1TZY A;  5B33 C;  4YS3 C;  5AV9 B;  1P3L D;  1P3P C;  3UT9 C;  1ID3 D;  5GT0 A;  5B40 D;  3REJ A;  3A6N C;  4J8V C;  3LEL B;  2HIO D;  5E5A A;  1WWI A;  3LZ1 B;  3UTB D;  1P34 D;  5BNX B;  5CPI B;  2BYK A;  4AWL C;  2F8N B;  3X1S C;  4X23 C;  3REH B;  1P3I D;  4YM6 D;  4EO5 B;  5DNM A;  5B0Y A;  3UTA A;  3KUY D;  4XUJ B;  3TU4 A;  3C1C B;  2ARO C;  3W99 A;  5BS7 C;  5BT1 D;  2CV5 B;  1WWS A;  4KUD B;  1EQZ A;  3X1T D;  1M1A A;  3AZE A;  2NQB A;  4R8P D;  4Z5T D;  5JA4 A;  3KXB C;  1P3L B;  5CP6 D;  1ID3 B;  3MGQ A;  1P3G A;  3MGP A;  5B40 B;  4NE5 A;  1S32 A;  5GSU C;  3AZL A;  4Z66 A;  5AV6 A;  2HIO B;  2RVQ C;  3B0D B;  5AV5 D;  3W98 D;  2NZD D;  3UTB B;  1P34 B;  1H3O A;  1HQ3 A;  3AV1 C;  1P3F D;  3KSY A;  2HUE C;  1P3O A;  4YM6 B;  3AZM D;  3KUY B;  3AFA C;  3MVD C;  5B32 A;  5KDM A;  3C1B D;  1KX3 A;  3X1T B;  5AY8 A;  1TAF B;  5B1M D;  5AVC A;  5GXQ A;  4R8P B;  4Z5T B;  1TZY D;  3WTP E;  2YFW B;  5CP6 B;  4LD9 C;  5CPK C;  5GT0 D;  3REJ D;  2NZD B;  2F8N K;  3W98 B;  5AV5 B;  5E5A D;  3AZK C;  4JJN C;  3WAA C;  4J8U C;  3W97 C;  1P3F B;  5G49 A;  4WNN A;  5JRG A;  1BH9 B;  4WU9 C;  3B6F A;  3UTA D;  5DNM D;  5F99 A;  5B0Y D;  4H9R B;  3TU4 D;  5B2I C;  3LJA A;  3C1B B;  3W99 D;  4J8W A;  3O62 C;  3MGS C;  3AZH A;  3W96 A;  1EQZ D;  3REI C;  1M1A D;  5B1M B;  3AZE D;  3AZJ A;  3REK C;  2NQB D;  1TZY B;  4H9S A;  4HGA B;  1F66 C;  1P3K C;  1U35 C;  3MGQ D;  4KHA A;  1P3G D;  5GT0 B;  3MGP D;  3REJ B;  5C3I B;  1S32 D;  3AZL D;  5AV6 D;  4ZBJ C;  5E5A B;  1P3I A;  3REH C;  1HQ3 D;  2BYK B;  4XUJ C;  1P3O D;  3UTA B;  5B0Y B;  5DNM B;  3TU4 B;  1M19 A;  4M6B A;  3W99 B;  5B32 D;  1KX3 D;  4XZQ A;  3AZF C;  1EQZ B;  1M1A B;  5AY8 D;  3AZE B;  3KWQ A;  2NQB B;  5AVC D;  5GXQ D;  3VH6 T;  3AZN A;  5JA4 B;  1P3A A;  2F8N H;  5B40 C;  1JFI A;  3MGQ B;  1P3G B;  3MGP B;  2HIO C;  3B0D C;  1AOI A;  3R45 A;  1S32 B;  1KU5 A;  3AZL B;  4Z66 B;  5AV6 B;  1P34 C;  1H3O B;  5B33 A;  1HQ3 B;  5B31 A;  4YM6 C;  1KX5 C;  5JRG D;  1P3P A;  3AZI C;  1P3O B;  4H9Q A;  3B6F D;  5F99 D;  3V9R A;  5BT1 C;  3B0C T;  4J8V A;  3VH6 W;  3LJA D;  5B32 B;  5KDM B;  1KX3 B;  4J8W D;  3AZH D;  3LZ0 A;  3W96 D;  5AY8 B;  4Z5T C;  4CAY A;  4ZUX C;  5AVC B;  5GXQ B;  3AZJ D;  4G91 B;  3X1S A;  4X23 A;  1A7W A;  4H9N A;  1HTA A;  2LY8 A;  2ARO A;  5BS7 A;  3W98 C;  3WTP D;  2IO5 B;  5AV8 D;  4G92 B;  4J8X A;  1Q9C A;  3B0C W;  5G49 B;  3KXB A;  4WNN B;  4H9P A;  1B67 A;  5JRG B;  1B6W A;  3B6F B;  3MNN A;  5AVB C;  5F99 B;  3B6G C;  5B24 C;  1M19 D;  5GSU A;  3LJA B;  1P3M A;  3WA9 C;  4J8W B;  4WV4 B;  5DNN C;  4XZQ D;  5B1L C;  3AZH B;  3W96 B;  3KWQ D;  4HGA C;  3AZJ B;  1ZLA C;  3AZN D;  1P3A D;  3AFA A;  5GT0 C;  3X1U A;  5B0Z C;  3REJ C;  3WKJ A;  5FUG A;  4KHA B;  1AOI D;  3REL C;  3AN2 A;  4E45 A;  3AZG A;  3X1V A;  2F8N G;  1P3I B;  5B33 D;  5B31 D;  5B0Y C;  3TU4 C;  1P3P D;  4LD9 A;  3W99 C;  5BNV A;  1M19 B;  1BH8 A;  4J8V D;  4E44 A;  1P3B A;  1EQZ C;  4KGC C;  3AZK A;  3AZE C;  4WU8 C;  4XZQ B;  4J8U A;  3AV2 A;  3WAA A;  3LZ0 D;  4UUZ A;  3KWQ B;  3X1S D;  4X23 D;  4WU9 A;  3AZN B;  1P3A B;  3MGQ C;  1P3G C;  4H9O A;  3MGP C;  1JFI B;  5B2J A;  5AV6 C;  2ARO D;  4Z66 C;  1M18 A;  1AOI B;  3O62 A;  3R45 B;  4DRA A;  3AZM B;  4J8X D;  3REK A;  1KX4 C;  5B33 B;  5GT3 C;  5B31 B;  1F66 A;  3KXB D;  1P3K A;  2YFV A;  1U35 A;  1P3P B;  3MNN D;  3V9R B;  5B32 C;  1KX3 C;  4J8V B;  5GSU D;  1P3M D;  5AV9 C;  2RVQ D;  5AVC C;  2PYO A;  3LZ0 B;  4G91 C;  3AV1 D;  4CAY B;  2FJ7 A;  1N1J A;  3LEL C;  3X1S B;  4X23 B;  3LZ1 C;  3AYW A;  3WTP A;  3AFA D;  5AV8 A;  3X1U D;  4H9N B;  5CPI C;  3WKJ D;  2ARO B;  5CPJ A;  2IO5 C;  4G92 C;  3AZF A;  3AN2 D;  4EO5 C;  3AZG D;  3X1V D;  4J8X B;  3C1C C;  2CV5 C;  3KXB B;  3B6F C;  4H9P B;  4KUD C;  5F99 C;  3MNN B;  4LD9 D;  3LJA C;  4J8W C;  5GSU B;  1P3M B;  3VH6 A;  3AZH C;  1P3B D;  1P3L C;  4NE6 A;  3AZK D;  1ID3 C;  4J8U D;  3AV2 D;  3B0B A;  3WAA D;  2HUE B;  1KX5 A;  3AZI A;  4WU9 D;  4QLC A;  3UTB C;  3AFA B;  3X1U B;  3MGR A;  3WKJ B;  5FUG B;  5B2J D;  1M18 D;  1P3I C;  3O62 D;  1ULY A;  3AN2 B;  4YS3 A;  3AZG B;  3X1V B;  3KUY C;  4ZUX A;  3UT9 A;  3REK D;  3A6N A;  1F66 D;  1P3K D;  3X1T C;  1U35 D;  1M19 C;  4LD9 B;  3VH5 A;  3VH5 T;  4R8P C;  5BNV B;  3NQU A; 
#chains in the Genus database with same CATH topology
 1BH8 B;  1P3B B;  5CP6 C;  3AZK B;  3EPH A;  3KFU G;  3KWQ C;  2Y2N A;  4J8U B;  3AV2 B;  2PYO D;  3WAA B;  4UUZ B;  2FJ7 D;  1P3A C;  2NZD C;  5AV5 C;  1R4V A;  4WU9 B;  5AVB A;  3AYW D;  3B6G A;  5B24 A;  4H9O B;  3EPK A;  1P3F C;  1AOI C;  3WA9 A;  5B2J B;  1M18 B;  3O62 B;  2CWE A;  5CPJ D;  5DNN A;  5B1L A;  3AZM C;  3AZF D;  4NFT A;  3VH5 W;  2Y2L A;  5B31 C;  3REK B;  3H0M C;  3C1B C;  1ZLA A;  1F66 B;  1P3K B;  1U35 B;  3NQJ A;  5B0Z A;  5B1M C;  5B32 G;  3AV1 A;  1TZY C;  3REL A;  4ZBJ B;  3LZ0 C;  2PYO B;  2FJ7 B;  3MVD A;  5C3I C;  1N1J B;  1KX5 D;  5E5A C;  3AZI D;  2ZY3 A;  4QLC D;  1F1E A;  3WTP B;  5BO0 A;  2BYM A;  3AYW B;  5AV8 B;  3MGR D;  4KGC A;  4NE3 A;  1BFM A;  5CPJ B;  2Y2P A;  4WU8 A;  4YS3 D;  4J8X C;  2JSS A;  5DNM C;  3UTA C;  3AZF B;  4ZUX D;  3UT9 D;  5CPK A;  2FFF B;  3A6N D;  3MNN C;  2RIQ A;  1M1A C;  4JJN A;  2NQB C;  1P3M C;  3W97 A;  1Z2C B;  4CSR A;  1KX4 A;  4Z2M H;  5GT3 A;  5B2I A;  1S32 C;  3AZL C;  1KX5 B;  3AZI B;  3MGS A;  3X1U C;  3WKJ C;  4QLC B;  3REI A;  5AVB D;  3B6G D;  5B24 D;  1HQ3 C;  3MGR B;  3WA9 D;  3AN2 C;  5AV9 A;  3X1V C;  3AZG C;  1P3O C;  4YS3 B;  5DNN D;  5B1L D;  3F6T A;  1W2E A;  3AL0 C;  4H9Q B;  4ZUX B;  3UT9 B;  3LEL A;  1ZLA D;  3A6N B;  3LZ1 A;  5BNX A;  5AY8 C;  5B0Z D;  5CPI A;  2F8N A;  5GXQ C;  2YFV B;  1P3B C;  3REH A;  3NQU B;  4AWL B;  3REL D;  3EG5 B;  3AV2 C;  4XUJ A;  2VQR A;  3C1C A;  2CV5 A;  4KUD A;  3MVD D;  4WZS B;  2JE5 A;  2ZY4 A;  5AVB B;  4DRB A;  5B2J C;  5B24 B;  1M18 C;  3B6G B;  3WA9 B;  1P3L A;  5JRG C;  4KGC D;  1ID3 A;  5DNN B;  4WU8 D;  5B1L B;  5B31 G;  5B40 A;  2Y2G A;  2HIO A;  5CPK D;  1ZLA B;  3P5J B;  3UTB A;  1P34 A;  3W96 C;  3NQJ B;  5B0Z B;  4JJN D;  3AZJ C;  4Z66 D;  3W97 D;  3AV1 B;  4H9S C;  4YM6 A;  3REL B;  3KUY A;  2PYO C;  2FJ7 C;  1KX4 D;  2L5A A;  5GT3 D;  5B2I D;  3MVD B;  2Y2M A;  3AYW C;  3X1T A;  3WTP C;  4DQY B;  1TAF A;  5AV8 C;  3MGS D;  5BO0 B;  4R8P A;  3REI D;  2DQN C;  2BYM B;  4Z5T A;  4Z2M G;  5CPJ C;  2YFW A;  5AV9 D;  4KGC B;  5CP6 A;  4WU8 B;  2NZD A;  5CPK B;  3LEL D;  3W98 A;  5AV5 A;  3EPL A;  4XZQ C;  3LZ1 D;  1P3F A;  4JJN B;  5CPI D;  2F8N D;  1BH9 A;  3W97 B;  2G5H C;  3REH D;  3AZN C;  3AZM A;  3FDD A;  4H9R A;  4CSR B;  4XUJ D;  1KX4 B;  3C1B A;  3C1C D;  5GT3 B;  2CV5 D;  5B2I B;  4KUD D;  4QLC C;  5CHL B;  3MGS B;  5B1M A;  3MGR C;  3REI B;  1TZY A;  5B33 C;  4YS3 C;  5AV9 B;  1P3L D;  1P3P C;  2XD5 A;  3UT9 C;  1ID3 D;  5GT0 A;  5B40 D;  3REJ A;  3A6N C;  4J8V C;  3LEL B;  2HIO D;  5E5A A;  1WWI A;  3LZ1 B;  3UTB D;  1P34 D;  5BNX B;  5CPI B;  2BYK A;  4AWL C;  2F8N B;  3X1S C;  4X23 C;  3REH B;  1P3I D;  2Y2O A;  4YM6 D;  4EO5 B;  5DNM A;  5B0Y A;  3UTA A;  3KUY D;  4XUJ B;  3TU4 A;  3C1C B;  2ARO C;  3W99 A;  5BS7 C;  5BT1 D;  2CV5 B;  1WWS A;  4KUD B;  1EQZ A;  3X1T D;  1M1A A;  3AZE A;  2NQB A;  2BG1 A;  4R8P D;  4Z5T D;  5JA4 A;  3KXB C;  1P3L B;  5CP6 D;  4UPK A;  1ID3 B;  3MGQ A;  2ZM5 A;  1P3G A;  3MGP A;  5B40 B;  4NE5 A;  1S32 A;  5GSU C;  3AZL A;  5AV6 A;  4Z66 A;  2HIO B;  2RVQ C;  3B0D B;  5AV5 D;  3W98 D;  2NZD D;  3UTB B;  1P34 B;  1H3O A;  1HQ3 A;  3AV1 C;  1P3F D;  3KSY A;  2HUE C;  1P3O A;  4YM6 B;  3AZM D;  3KUY B;  3AFA C;  3MVD C;  2Y2I A;  4WJ3 C;  5B32 A;  5KDM A;  3C1B D;  1KX3 A;  3X1T B;  5AY8 A;  1TAF B;  5B1M D;  5AVC A;  5GXQ A;  4R8P B;  4Z5T B;  1TZY D;  3A1K A;  3WTP E;  2YFW B;  5CP6 B;  4LD9 C;  5CPK C;  5GT0 D;  3REJ D;  2NZD B;  2F8N K;  3W98 B;  5AV5 B;  5E5A D;  3AZK C;  4JJN C;  3WAA C;  4J8U C;  3W97 C;  1P3F B;  5G49 A;  4WNN A;  5JRG A;  1T3U A;  1BH9 B;  4WU9 C;  3B6F A;  3UTA D;  2Y2J A;  5F99 A;  5DNM D;  4H9R B;  5B0Y D;  3TU4 D;  5B2I C;  3LJA A;  3C1B B;  3W99 D;  4J8W A;  3O62 C;  3MGS C;  3AZH A;  3W96 A;  1EQZ D;  3REI C;  1M1A D;  5B1M B;  3AZE D;  3AZJ A;  3REK C;  2NQB D;  1TZY B;  4H9S A;  4HGA B;  1F66 C;  1P3K C;  1U35 C;  3MGQ D;  4KHA A;  1P3G D;  5GT0 B;  3MGP D;  3REJ B;  5C3I B;  1S32 D;  3AZL D;  5AV6 D;  4ZBJ C;  5E5A B;  1P3I A;  2ZY5 A;  3REH C;  1HQ3 D;  2BYK B;  4XUJ C;  1P3O D;  3UTA B;  5B0Y B;  5DNM B;  3TU4 B;  1M19 A;  4M6B A;  3W99 B;  5B32 D;  1KX3 D;  4XZQ A;  3AZF C;  1EQZ B;  1M1A B;  5AY8 D;  3H0L C;  3AZE B;  3KWQ A;  2Y2Q A;  2NQB B;  5AVC D;  5GXQ D;  2UWX A;  3VH6 T;  3AZN A;  5JA4 B;  1P3A A;  2F8N H;  5B40 C;  1JFI A;  3MGQ B;  1P3G B;  3MGP B;  2HIO C;  3B0D C;  1AOI A;  3R45 A;  1S32 B;  1KU5 A;  3AZL B;  4Z66 B;  5AV6 B;  1P34 C;  1H3O B;  5B33 A;  1HQ3 B;  5B31 A;  4YM6 C;  1KX5 C;  5JRG D;  1P3P A;  3AZI C;  1P3O B;  4H9Q A;  3B6F D;  3A1I A;  5F99 D;  3V9R A;  5BT1 C;  3B0C T;  4J8V A;  3VH6 W;  3LJA D;  5B32 B;  5KDM B;  1KX3 B;  4J8W D;  3AZH D;  3LZ0 A;  3W96 D;  5AY8 B;  4Z5T C;  4CAY A;  4ZUX C;  5AVC B;  5GXQ B;  3AZJ D;  4G91 B;  3X1S A;  4X23 A;  1A7W A;  4H9N A;  1HTA A;  2LY8 A;  2ARO A;  5BS7 A;  3W98 C;  3WTP D;  2IO5 B;  5AV8 D;  4G92 B;  4J8X A;  1Q9C A;  3B0C W;  5G49 B;  3KXB A;  4WNN B;  4H9P A;  1B67 A;  5JRG B;  1B6W A;  3B6F B;  3MNN A;  5AVB C;  5F99 B;  3B6G C;  5B24 C;  1M19 D;  5GSU A;  3LJA B;  1P3M A;  3WA9 C;  4J8W B;  4WV4 B;  5DNN C;  4XZQ D;  5B1L C;  2W8S A;  3AZH B;  3W96 B;  3KWQ D;  4HGA C;  3AZJ B;  1ZLA C;  3AZN D;  2Y2K A;  1P3A D;  3AFA A;  5GT0 C;  3X1U A;  5B0Z C;  2Y2H A;  3REJ C;  3WKJ A;  5FUG A;  4KHA B;  1AOI D;  3REL C;  3AN2 A;  4E45 A;  3AZG A;  3X1V A;  2F8N G;  1P3I B;  5B33 D;  5B31 D;  5B0Y C;  2F2A C;  3TU4 C;  1P3P D;  4LD9 A;  3W99 C;  5BNV A;  1M19 B;  1BH8 A;  4J8V D;  4E44 A;  1P3B A;  1EQZ C;  4KGC C;  3AZK A;  3AZE C;  4WU8 C;  4XZQ B;  4J8U A;  3AV2 A;  3WAA A;  3LZ0 D;  4UUZ A;  3KWQ B;  3X1S D;  4X23 D;  4WU9 A;  3AZN B;  1P3A B;  3MGQ C;  1P3G C;  4H9O A;  3MGP C;  1JFI B;  5B2J A;  5AV6 C;  2ARO D;  4Z66 C;  1M18 A;  1AOI B;  3O62 A;  3R45 B;  4DRA A;  2XD1 A;  3AZM B;  4J8X D;  3REK A;  1KX4 C;  3IP4 C;  5B33 B;  5GT3 C;  5B31 B;  1F66 A;  3KXB D;  1P3K A;  2YFV A;  1U35 A;  1P3P B;  3MNN D;  3V9R B;  5B32 C;  1KX3 C;  2JCH A;  4J8V B;  5GSU D;  1P3M D;  5AV9 C;  2G5I C;  2RVQ D;  5AVC C;  2PYO A;  3LZ0 B;  4G91 C;  3AV1 D;  4CAY B;  2FJ7 A;  1N1J A;  3LEL C;  3X1S B;  4X23 B;  3LZ1 C;  3AYW A;  3WTP A;  3AFA D;  5AV8 A;  3X1U D;  4H9N B;  5CPI C;  3WKJ D;  2ARO B;  5CPJ A;  2IO5 C;  4G92 C;  3AZF A;  3AN2 D;  4EO5 C;  3AZG D;  3X1V D;  4J8X B;  3C1C C;  2CV5 C;  3EPJ A;  3KXB B;  3B6F C;  4H9P B;  4KUD C;  5F99 C;  2DF4 C;  3MNN B;  3LJA C;  4LD9 D;  4J8W C;  5GSU B;  1P3M B;  3VH6 A;  3AZH C;  1P3B D;  1P3L C;  4NE6 A;  3AZK D;  1ID3 C;  4J8U D;  3AV2 D;  3B0B A;  3WAA D;  2ZY2 A;  2HUE B;  1KX5 A;  3AZI A;  4WU9 D;  4QLC A;  3UTB C;  2J8P A;  3AFA B;  3X1U B;  3MGR A;  3WKJ B;  3H0R C;  5FUG B;  5B2J D;  1M18 D;  1P3I C;  3O62 D;  1ULY A;  3AN2 B;  4YS3 A;  3AZG B;  3X1V B;  3KUY C;  4ZUX A;  3UT9 A;  3REK D;  3A6N A;  1F66 D;  1P3K D;  3X1T C;  1U35 D;  1PZR A;  1M19 C;  4LD9 B;  3VH5 A;  3VH5 T;  4R8P C;  5BNV B;  3NQU A; 
#chains in the Genus database with same CATH homology
 1BH8 B;  1P3B B;  5CP6 C;  3AZK B;  3EPH A;  3KFU G;  3KWQ C;  2Y2N A;  4J8U B;  3AV2 B;  2PYO D;  3WAA B;  4UUZ B;  2FJ7 D;  1P3A C;  2NZD C;  5AV5 C;  1R4V A;  4WU9 B;  5AVB A;  3AYW D;  3B6G A;  5B24 A;  4H9O B;  3EPK A;  1P3F C;  1AOI C;  3WA9 A;  5B2J B;  1M18 B;  3O62 B;  2CWE A;  5CPJ D;  5DNN A;  5B1L A;  3AZM C;  3AZF D;  4NFT A;  3VH5 W;  2Y2L A;  5B31 C;  3REK B;  3H0M C;  3C1B C;  1ZLA A;  1F66 B;  1P3K B;  1U35 B;  3NQJ A;  5B0Z A;  5B1M C;  5B32 G;  3AV1 A;  1TZY C;  3REL A;  4ZBJ B;  3LZ0 C;  2PYO B;  2FJ7 B;  3MVD A;  5C3I C;  1N1J B;  1KX5 D;  5E5A C;  3AZI D;  2ZY3 A;  4QLC D;  1F1E A;  3WTP B;  5BO0 A;  2BYM A;  3AYW B;  5AV8 B;  3MGR D;  4KGC A;  4NE3 A;  1BFM A;  5CPJ B;  2Y2P A;  4WU8 A;  4YS3 D;  4J8X C;  2JSS A;  5DNM C;  3UTA C;  3AZF B;  4ZUX D;  3UT9 D;  5CPK A;  2FFF B;  3A6N D;  3MNN C;  2RIQ A;  1M1A C;  4JJN A;  2NQB C;  1P3M C;  3W97 A;  1Z2C B;  4CSR A;  1KX4 A;  4Z2M H;  5GT3 A;  5B2I A;  1S32 C;  3AZL C;  1KX5 B;  3AZI B;  3MGS A;  3X1U C;  3WKJ C;  4QLC B;  3REI A;  5AVB D;  3B6G D;  5B24 D;  1HQ3 C;  3MGR B;  3WA9 D;  3AN2 C;  5AV9 A;  3X1V C;  3AZG C;  1P3O C;  4YS3 B;  5DNN D;  5B1L D;  3F6T A;  1W2E A;  3AL0 C;  4H9Q B;  4ZUX B;  3UT9 B;  3LEL A;  1ZLA D;  3A6N B;  3LZ1 A;  5BNX A;  5AY8 C;  5B0Z D;  5CPI A;  2F8N A;  5GXQ C;  2YFV B;  1P3B C;  3REH A;  3NQU B;  4AWL B;  3REL D;  3EG5 B;  3AV2 C;  4XUJ A;  2VQR A;  3C1C A;  2CV5 A;  4KUD A;  3MVD D;  4WZS B;  2JE5 A;  2ZY4 A;  5AVB B;  4DRB A;  5B2J C;  5B24 B;  1M18 C;  3B6G B;  3WA9 B;  1P3L A;  5JRG C;  4KGC D;  1ID3 A;  5DNN B;  4WU8 D;  5B1L B;  5B31 G;  5B40 A;  2Y2G A;  2HIO A;  5CPK D;  1ZLA B;  3P5J B;  3UTB A;  1P34 A;  3W96 C;  3NQJ B;  5B0Z B;  4JJN D;  3AZJ C;  4Z66 D;  3W97 D;  3AV1 B;  4H9S C;  4YM6 A;  3REL B;  3KUY A;  2PYO C;  2FJ7 C;  1KX4 D;  2L5A A;  5GT3 D;  5B2I D;  3MVD B;  2Y2M A;  3AYW C;  3X1T A;  3WTP C;  4DQY B;  1TAF A;  5AV8 C;  3MGS D;  5BO0 B;  4R8P A;  3REI D;  2DQN C;  2BYM B;  4Z5T A;  4Z2M G;  5CPJ C;  2YFW A;  5AV9 D;  4KGC B;  5CP6 A;  4WU8 B;  2NZD A;  5CPK B;  3LEL D;  3W98 A;  5AV5 A;  3EPL A;  4XZQ C;  3LZ1 D;  1P3F A;  4JJN B;  5CPI D;  2F8N D;  1BH9 A;  3W97 B;  2G5H C;  3REH D;  3AZN C;  3AZM A;  3FDD A;  4H9R A;  4CSR B;  4XUJ D;  1KX4 B;  3C1B A;  3C1C D;  5GT3 B;  2CV5 D;  5B2I B;  4KUD D;  4QLC C;  5CHL B;  3MGS B;  5B1M A;  3MGR C;  3REI B;  1TZY A;  5B33 C;  4YS3 C;  5AV9 B;  1P3L D;  1P3P C;  2XD5 A;  3UT9 C;  1ID3 D;  5GT0 A;  5B40 D;  3REJ A;  3A6N C;  4J8V C;  3LEL B;  2HIO D;  5E5A A;  1WWI A;  3LZ1 B;  3UTB D;  1P34 D;  5BNX B;  5CPI B;  2BYK A;  4AWL C;  2F8N B;  3X1S C;  4X23 C;  3REH B;  1P3I D;  2Y2O A;  4YM6 D;  4EO5 B;  5DNM A;  5B0Y A;  3UTA A;  3KUY D;  4XUJ B;  3TU4 A;  3C1C B;  2ARO C;  3W99 A;  5BS7 C;  5BT1 D;  2CV5 B;  1WWS A;  4KUD B;  1EQZ A;  3X1T D;  1M1A A;  3AZE A;  2NQB A;  2BG1 A;  4R8P D;  4Z5T D;  5JA4 A;  3KXB C;  1P3L B;  5CP6 D;  4UPK A;  1ID3 B;  3MGQ A;  2ZM5 A;  1P3G A;  3MGP A;  5B40 B;  4NE5 A;  1S32 A;  5GSU C;  3AZL A;  5AV6 A;  4Z66 A;  2HIO B;  2RVQ C;  3B0D B;  5AV5 D;  3W98 D;  2NZD D;  3UTB B;  1P34 B;  1H3O A;  1HQ3 A;  3AV1 C;  1P3F D;  3KSY A;  2HUE C;  1P3O A;  4YM6 B;  3AZM D;  3KUY B;  3AFA C;  3MVD C;  2Y2I A;  4WJ3 C;  5B32 A;  5KDM A;  3C1B D;  1KX3 A;  3X1T B;  5AY8 A;  1TAF B;  5B1M D;  5AVC A;  5GXQ A;  4R8P B;  4Z5T B;  1TZY D;  3A1K A;  3WTP E;  2YFW B;  5CP6 B;  4LD9 C;  5CPK C;  5GT0 D;  3REJ D;  2NZD B;  2F8N K;  3W98 B;  5AV5 B;  5E5A D;  3AZK C;  4JJN C;  3WAA C;  4J8U C;  3W97 C;  1P3F B;  5G49 A;  4WNN A;  5JRG A;  1T3U A;  1BH9 B;  4WU9 C;  3B6F A;  3UTA D;  2Y2J A;  5F99 A;  5DNM D;  4H9R B;  5B0Y D;  3TU4 D;  5B2I C;  3LJA A;  3C1B B;  3W99 D;  4J8W A;  3O62 C;  3MGS C;  3AZH A;  3W96 A;  1EQZ D;  3REI C;  1M1A D;  5B1M B;  3AZE D;  3AZJ A;  3REK C;  2NQB D;  1TZY B;  4H9S A;  4HGA B;  1F66 C;  1P3K C;  1U35 C;  3MGQ D;  4KHA A;  1P3G D;  5GT0 B;  3MGP D;  3REJ B;  5C3I B;  1S32 D;  3AZL D;  5AV6 D;  4ZBJ C;  5E5A B;  1P3I A;  2ZY5 A;  3REH C;  1HQ3 D;  2BYK B;  4XUJ C;  1P3O D;  3UTA B;  5B0Y B;  5DNM B;  3TU4 B;  1M19 A;  4M6B A;  3W99 B;  5B32 D;  1KX3 D;  4XZQ A;  3AZF C;  1EQZ B;  1M1A B;  5AY8 D;  3H0L C;  3AZE B;  3KWQ A;  2Y2Q A;  2NQB B;  5AVC D;  5GXQ D;  2UWX A;  3VH6 T;  3AZN A;  5JA4 B;  1P3A A;  2F8N H;  5B40 C;  1JFI A;  3MGQ B;  1P3G B;  3MGP B;  2HIO C;  3B0D C;  1AOI A;  3R45 A;  1S32 B;  1KU5 A;  3AZL B;  4Z66 B;  5AV6 B;  1P34 C;  1H3O B;  5B33 A;  1HQ3 B;  5B31 A;  4YM6 C;  1KX5 C;  5JRG D;  1P3P A;  3AZI C;  1P3O B;  4H9Q A;  3B6F D;  3A1I A;  5F99 D;  3V9R A;  5BT1 C;  3B0C T;  4J8V A;  3VH6 W;  3LJA D;  5B32 B;  5KDM B;  1KX3 B;  4J8W D;  3AZH D;  3LZ0 A;  3W96 D;  5AY8 B;  4Z5T C;  4CAY A;  4ZUX C;  5AVC B;  5GXQ B;  3AZJ D;  4G91 B;  3X1S A;  4X23 A;  1A7W A;  4H9N A;  1HTA A;  2LY8 A;  2ARO A;  5BS7 A;  3W98 C;  3WTP D;  2IO5 B;  5AV8 D;  4G92 B;  4J8X A;  1Q9C A;  3B0C W;  5G49 B;  3KXB A;  4WNN B;  4H9P A;  1B67 A;  5JRG B;  1B6W A;  3B6F B;  3MNN A;  5AVB C;  5F99 B;  3B6G C;  5B24 C;  1M19 D;  5GSU A;  3LJA B;  1P3M A;  3WA9 C;  4J8W B;  4WV4 B;  5DNN C;  4XZQ D;  5B1L C;  2W8S A;  3AZH B;  3W96 B;  3KWQ D;  4HGA C;  3AZJ B;  1ZLA C;  3AZN D;  2Y2K A;  1P3A D;  3AFA A;  5GT0 C;  3X1U A;  5B0Z C;  2Y2H A;  3REJ C;  3WKJ A;  5FUG A;  4KHA B;  1AOI D;  3REL C;  3AN2 A;  4E45 A;  3AZG A;  3X1V A;  2F8N G;  1P3I B;  5B33 D;  5B31 D;  5B0Y C;  2F2A C;  3TU4 C;  1P3P D;  4LD9 A;  3W99 C;  5BNV A;  1M19 B;  1BH8 A;  4J8V D;  4E44 A;  1P3B A;  1EQZ C;  4KGC C;  3AZK A;  3AZE C;  4WU8 C;  4XZQ B;  4J8U A;  3AV2 A;  3WAA A;  3LZ0 D;  4UUZ A;  3KWQ B;  3X1S D;  4X23 D;  4WU9 A;  3AZN B;  1P3A B;  3MGQ C;  1P3G C;  4H9O A;  3MGP C;  1JFI B;  5B2J A;  5AV6 C;  2ARO D;  4Z66 C;  1M18 A;  1AOI B;  3O62 A;  3R45 B;  4DRA A;  2XD1 A;  3AZM B;  4J8X D;  3REK A;  1KX4 C;  3IP4 C;  5B33 B;  5GT3 C;  5B31 B;  1F66 A;  3KXB D;  1P3K A;  2YFV A;  1U35 A;  1P3P B;  3MNN D;  3V9R B;  5B32 C;  1KX3 C;  2JCH A;  4J8V B;  5GSU D;  1P3M D;  5AV9 C;  2G5I C;  2RVQ D;  5AVC C;  2PYO A;  3LZ0 B;  4G91 C;  3AV1 D;  4CAY B;  2FJ7 A;  1N1J A;  3LEL C;  3X1S B;  4X23 B;  3LZ1 C;  3AYW A;  3WTP A;  3AFA D;  5AV8 A;  3X1U D;  4H9N B;  5CPI C;  3WKJ D;  2ARO B;  5CPJ A;  2IO5 C;  4G92 C;  3AZF A;  3AN2 D;  4EO5 C;  3AZG D;  3X1V D;  4J8X B;  3C1C C;  2CV5 C;  3EPJ A;  3KXB B;  3B6F C;  4H9P B;  4KUD C;  5F99 C;  2DF4 C;  3MNN B;  3LJA C;  4LD9 D;  4J8W C;  5GSU B;  1P3M B;  3VH6 A;  3AZH C;  1P3B D;  1P3L C;  4NE6 A;  3AZK D;  1ID3 C;  4J8U D;  3AV2 D;  3B0B A;  3WAA D;  2ZY2 A;  2HUE B;  1KX5 A;  3AZI A;  4WU9 D;  4QLC A;  3UTB C;  2J8P A;  3AFA B;  3X1U B;  3MGR A;  3WKJ B;  3H0R C;  5FUG B;  5B2J D;  1M18 D;  1P3I C;  3O62 D;  1ULY A;  3AN2 B;  4YS3 A;  3AZG B;  3X1V B;  3KUY C;  4ZUX A;  3UT9 A;  3REK D;  3A6N A;  1F66 D;  1P3K D;  3X1T C;  1U35 D;  1PZR A;  1M19 C;  4LD9 B;  3VH5 A;  3VH5 T;  4R8P C;  5BNV B;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...