3UT9C

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9C00
3AZLA 5BNXB 5JRGB 3W98C 4G92C 3AZEB 2BYKB 3AZNB 2NQBC 3X1TA 5GT0B 4KHAA 2HIOB 5AV6A 3AZMD 5B2JB 3KSYA 4UUZA 3WKJA 5AV5A 1AOID 3MGRD 3LZ0B 3KUYC 1TZYB 4LD9D 3WA9C 5FUGB 5BNVB 3REJB 5E5AD 1HQ3C 1WWIA 1P3KC 3AZIA 3MGSD 1P3MD 4R8PA 3REKD 3RELA 1B6WA 3KXBD 4J8WB 1A7WA 3LZ1D 1P3GD 4KUDD 5AV9B 5CPJD 3REID 3X1SB 4ZBJC 1KX4C 3UTAD 4G91C 3AZMC 1P3IA 3MVDA 4WU9A 4KGCB 1AOIC 3MGRC 5B31D 4J8UB 5AV8A 3TU4B 3UT9B 4YS3C 3KWQB 4HGAB 3LELA 4LD9C 4XZQA 5GT3A 3C1BD 5E5AC 5B32D 1P3PC 2YFWB 3MGQD 3MGSC 4EO5B 1P3MC 2F8ND 4H9NA 3REKC 2YFVB 3AZJB 3KXBC 3UTBD 3AZFB 1P3BA 1M19A 4QLCA 1P3GC 2BYMA 1F66B 4KUDC 5CPJC 3REIC 5B0YA 3UTAC 3AZLD 1BH9B 3X1UA 4WNNB 3W97B 5CPKA 4CSRA 1N1JB 1Q9CA 5B31C 1U35A 4H9PA 3X1TD 2IO5C 3C1BC 4ZUXA 5AV6D 1KX3B 2NZDB 1H3OA 1P3LB 3AZHC 4G92B 1P34A 3MGQC 3WKJD 1TAFB 3AN2B 3NQJB 5B1MA 5B1LB 5BO0B 1P3AB 3UTBC 4NE5A 1B67A 3LJAA 4WU8A 4CAYA 3AZID 3B6FB 5B33D 3X1VB 3O62A 3AZLC 3KUYB 3RELD 4AWLC 2RVQD 3B6GB 1S32B 3VH5W 3X1TC 3WAAA 4X23D 5AV6C 5CP6D 1P3ID 5G49A 3MVDD 4WU9D 3WKJC 3AZKD 1M1AD 4E44A 3LELD 4JJNA 5C3IC 4Z66A 5GT3D 3REHA 1JFIA 5F99A 1KX5B 3AZIC 5KDMB 3MGRB 5B33C 3AV1A 5B2IA 5BNXA 5JRGA 3RELC 3AZEA 1P3BD 5B32G 2BYKA 2RVQC 5E5AB 3A6NB 4QLCD 3AZNA 1M19D 5GT0A 5DNNB 2HIOA 5B0YD 4X23C 3MGPB 5CP6C 3REKB 5B2JA 1P3IC 3X1UD 3KXBB 3MVDC 4WU9C 5GXQB 5CPKD 3LZ0A 3AZKC 3LZ1B 3VH6T 3B0DC 2CV5B 1M1AC 1TZYA 3LELC 3UTAB 5BNVA 3REJA 5GT3C 4ZUXD 1KX4D 4Z5TD 5AY8D 3AFAB 3W96B 5B40D 2JSSA 3MNNB 5B1MD 2AROB 3WTPD 1P3OD 4YS3D 4J8WA 3C1BB 1P3BC 3VH6A 1M19C 4QLCC 5B32B 4M6BA 1ID3D 5AV9A 3LJAD 3MGQB 3X1SA 4WU8D 4Z2MH 1P3PD 5B0YC 3O62D 5AVCB 5B24D 3X1UC 1M18B 3UTBB 4KGCA 4XUJB 5CPKC 4J8UA 3W99B 3UT9A 3KWQA 3WAAD 4ZUXC 4Z5TC 5B0ZB 5AY8C 5BS7A 5B40C 4AWLB 5DNMB 2L5AA 2YFWA 3AV2B 4YM6D 2FJ7D 5B1MC 4J8XB 3WTPC 3AZJA 2YFVA 1P3OC 3C1CB 3AZFA 4JJND 3AZGD 4Z66D 5AVBB 4H9SA 1F66A 1ID3C 3LJAC 4WU8C 3AZHD 5B2ID 3O62C 5B24C 5JRGD 1ULYA 5GSUB 1BH9A 4WNNA 3W97A 5C3IB 3AZED 1N1JA 3AZND 5B33B 5GT0D 4J8VB 2HIOD 3WAAC 1KX3A 1ZLAB 2NZDA 2PYOB 1P3LA 5B2JD 4WZSB 1TAFA 3AN2A 4YM6C 3NQJA 1EQZB 2FJ7C 3AYWB 5CPIB 5JA4B 5B1LA 5BO0A 1P3AA 4JJNC 3AZGC 4X23B 4Z66C 3REJD 5CP6B 1KU5A 3B6FA 3W98B 3AV1C 3X1VA 5B2IC 3AZKB 5AV5D 1M1AB 5JRGC 4DRBA 4H9QB 4J8WD 2NQBB 3AZEC 3B6GA 3AZNC 1S32A 5AV9D 3X1SD 3B0CT 5GT0C 2HIOC 4R8PD 5B2JC 4H9RB 4KGCD 4J8UD 3WA9B 3UT9D 1P3FA 1HQ3B 2CWEA 1P3KB 3REJC 2F8NH 1F1EA 1KX5A 5KDMA 3WTPE 4NE3A 5AV5C 3AZJD 5AV8D 4H9PB 3V9RB 3AZFD 4J8WC 1KX4B 3A6NA 4ZBJB 4Z5TB 5E5AA 5CHLB 5AY8B 1F66D 5B40B 4XZQD 5AV9C 2F8NK 4G91B 3X1SC 3AZMB 5DNNA 3MGPA 5B31G 1AOIB 5B1MB 3WTPB 3REKA 1P3OB 4R8PC 4YS3B 4KGCC 5GXQA 4J8UC 4LD9B 3LZ1A 1ID3B 3UT9C 2CV5A 4HGAC 1P3PB 2F8NG 1KX3D 5B24B 3MGSB 3AFAA 3W96A 1P3MB 2NZDD 1P3LD 5BS7C 3MNNA 4EO5C 1BH8B 3AN2D 2AROA 3AZJC 5AV8C 5B1LD 1P3GB 4KUDB 3C1BA 3AZFC 1P3AD 1U35D 5CPJB 3REIB 5FUGA 5B32A 1F66C 4XZQC 3MGQA 3B6FD 3X1VD 4H9OB 3R45B 4YM6B 1HTAA 2FJ7B 1P34D 5AVCA 4WV4B 5B31B 1M18A 1BFMA 3UTBA 3AZGB 4XUJA 3W99A 4E45A 3B6GD 2IO5B 1S32D 4Z2MG 1R4VA 3AZHB 3NQUB 1KX3C 2NZDC 5B0ZA 2F8NB 1P3LC 5DNMA 3AV2A 3AN2C 4J8XA 3TU4A 1P3FD 3C1CA 5B1LC 1P3AC 1U35C 5AVBA 3AZLB 1KX5D 3B6FC 3X1VC 4NFTA 1P34C 5GSUA 3A6ND 3X1TB 3B6GC 1S32C 4KHAB 5AV6B 3REHD 5B33A 4J8VA 5DNND 3MGPD 4UUZB 1ZLAA 5F99D 5AV5B 3WKJB 3AV1D 2PYOA 5GXQD 1EQZA 3AYWA 2CV5D 5CPIA 5JA4A 1P3FC 4X23A 5BT1D 5CP6A 3AZIB 3VH6W 3AFAD 4R8PB 3W96D 1KX5C 3W98A 3MNND 3RELB 3AZKA 3VH5T 1M1AA 2AROD 4H9QA 3LZ0D 2NQBA 1TZYD 3B0BA 2HUEC 3A6NC 3REHC 1P3IB 5DNNC 3MGPC 3MVDB 4WU9B 5F99C 5AVCD 5AV8B 4H9RA 1M18D 3KUYA 3B0DB 3VH5A 4XUJD 5GXQC 3W99D 3LELB 3WA9A 3LZ1C 4XZQB 5GT3B 2CV5C 1HQ3A 1P3KA 5BT1C 5B0ZD 3AFAC 3W96C 5DNMD 4H9NB 3AV2D 3MNNC 4J8XD 2AROC 1P3BB 3TU4D 1M19B 4QLCB 3LZ0C 3C1CD 3V9RA 2BYMB 3KWQD 1KX4A 4Z5TA 1TZYC 5AY8A 5AVBD 5B0YB 5B40A 5B32C 4DRAA 3AZMA 3X1UB 1AOIA 3MGRA 3WTPA 1P3OA 5AVCC 5CPKB 4CSRB 5GSUD 4YS3A 1M18C 1U35B 4XUJC 4LD9A 3W99C 4NE6A 1ID3A 4ZUXB 1H3OB 1P3PA 4J8VD 1P34B 5B24A 3MGSA 1P3MA 1ZLAD 5B0ZC 2PYOD 5DNMC 3AV2C 1BH8A 3KXBA 1EQZD 3W97D 3AYWD 4J8XC 3TU4C 5CPID 1P3GA 3C1CC 4KUDA 3KWQC 3LJAB 5CPJA 3REIA 4WU8B 4CAYB 5AVBC 3UTAA 3O62B 3W98D 4H9OA 3R45A 4YM6A 2FJ7A 5B31A 5GSUC 1P3FB 3AZGA 2NQBD 2LY8A 3WAAB 1WWSA 3AZHA 4H9SC 4J8VC 5G49B 3NQUA 1ZLAC 2F8NA 2PYOC 3B0CW 3KUYD 2HUEB 3WA9D 4JJNB 1EQZC 3W97C 4Z66B 3AYWC 3REHB 5CPIC 1JFIB 1HQ3D 1P3KD 5F99B 3AV1B 5B2IB
chains in the Genus database with same CATH superfamily
3AZLA 5BNXB 2ZY3A 5JRGB 3W98C 4G92C 3AZEB 2BYKB 3AZNB 2NQBC 3X1TA 5GT0B 4KHAA 2HIOB 5AV6A 3AZMD 5B2JB 3KSYA 2G5HC 4UUZA 3WKJA 5AV5A 1AOID 3MGRD 3LZ0B 3KUYC 1TZYB 4LD9D 3WA9C 5FUGB 5BNVB 3REJB 2XD1A 5E5AD 4WJ3C 1HQ3C 1WWIA 1P3KC 3AZIA 3MGSD 1P3MD 4R8PA 2UWXA 3REKD 3RELA 1B6WA 3KXBD 4J8WB 1A7WA 3LZ1D 1P3GD 4KUDD 5AV9B 5CPJD 3REID 3X1SB 4ZBJC 1KX4C 3UTAD 2Y2GA 4G91C 3AZMC 1P3IA 3MVDA 4WU9A 4KGCB 1AOIC 3MGRC 5B31D 4J8UB 5AV8A 3TU4B 3UT9B 4YS3C 3KWQB 4DQYB 4HGAB 3LELA 4LD9C 4XZQA 5GT3A 3C1BD 5E5AC 5B32D 1P3PC 2YFWB 3MGQD 2DQNC 3MGSC 4EO5B 1P3MC 2F8ND 1W2EA 4H9NA 3REKC 2YFVB 3AZJB 3KXBC 3UTBD 3AZFB 1P3BA 1M19A 3H0MC 4QLCA 1P3GC 2BYMA 1F66B 4KUDC 3A1IA 5CPJC 3REIC 5B0YA 3UTAC 3AZLD 1BH9B 3X1UA 4WNNB 3W97B 5CPKA 4CSRA 1N1JB 1Q9CA 5B31C 1U35A 4H9PA 4UPKA 3X1TD 2IO5C 3C1BC 4ZUXA 5AV6D 1KX3B 2NZDB 1H3OA 1P3LB 3AZHC 4G92B 1P34A 3MGQC 3WKJD 1TAFB 3AN2B 3NQJB 5B1MA 5B1LB 5BO0B 1P3AB 3UTBC 2Y2IA 4NE5A 1B67A 3LJAA 4WU8A 2JE5A 4CAYA 3AZID 3B6FB 5B33D 3X1VB 3O62A 3AZLC 3KUYB 2W8SA 3RELD 4AWLC 2RVQD 3B6GB 1S32B 3VH5W 3X1TC 3WAAA 4X23D 5AV6C 5CP6D 1P3ID 5G49A 3MVDD 4WU9D 3WKJC 2Y2OA 2Y2KA 3AZKD 1M1AD 4E44A 3LELD 4JJNA 5C3IC 4Z66A 5GT3D 3REHA 1JFIA 5F99A 1KX5B 3AZIC 5KDMB 3MGRB 5B33C 3AV1A 5B2IA 3A1KA 5BNXA 5JRGA 3RELC 3AZEA 1P3BD 5B32G 2BYKA 2RVQC 5E5AB 3A6NB 4QLCD 3AZNA 1M19D 5GT0A 5DNNB 2HIOA 5B0YD 4X23C 3MGPB 5CP6C 3REKB 5B2JA 1P3IC 3X1UD 3KXBB 3MVDC 4WU9C 5GXQB 5CPKD 3LZ0A 3AZKC 3LZ1B 3VH6T 3B0DC 3EG5B 2CV5B 1M1AC 1TZYA 3LELC 3UTAB 5BNVA 3REJA 5GT3C 4ZUXD 1KX4D 4Z5TD 5AY8D 3AFAB 3W96B 5B40D 2JSSA 3MNNB 2Y2HA 3EPLA 5B1MD 2AROB 3WTPD 1P3OD 4YS3D 4J8WA 3C1BB 1P3BC 3VH6A 1M19C 4QLCC 2XD5A 5B32B 4M6BA 1ID3D 5AV9A 3LJAD 3MGQB 3X1SA 4WU8D 4Z2MH 1P3PD 5B0YC 3O62D 5AVCB 5B24D 3X1UC 1M18B 3UTBB 4KGCA 4XUJB 5CPKC 4J8UA 3W99B 3UT9A 3KWQA 3WAAD 4ZUXC 4Z5TC 5B0ZB 5AY8C 5BS7A 5B40C 4AWLB 5DNMB 2L5AA 2YFWA 3AV2B 4YM6D 2FJ7D 5B1MC 4J8XB 3WTPC 3AZJA 2YFVA 1P3OC 3C1CB 3AZFA 2Y2JA 4JJND 3AZGD 4Z66D 2VQRA 5AVBB 4H9SA 1F66A 1ID3C 3LJAC 4WU8C 3AZHD 5B2ID 3O62C 5B24C 5JRGD 1ULYA 5GSUB 1BH9A 4WNNA 3W97A 5C3IB 3AZED 2Y2QA 1N1JA 3AZND 5B33B 5GT0D 4J8VB 2HIOD 3WAAC 1KX3A 1ZLAB 2NZDA 2PYOB 1P3LA 5B2JD 4WZSB 1TAFA 3AN2A 4YM6C 3NQJA 1EQZB 2FJ7C 3AYWB 5CPIB 5JA4B 5B1LA 5BO0A 1P3AA 4JJNC 3AZGC 3IP4C 4Z66C 4X23B 2ZM5A 3REJD 5CP6B 1KU5A 3B6FA 3W98B 3AV1C 3X1VA 5B2IC 3AZKB 5AV5D 1M1AB 5JRGC 4DRBA 4H9QB 4J8WD 2NQBB 3AZEC 3B6GA 3AZNC 1S32A 5AV9D 3X1SD 3B0CT 5GT0C 2HIOC 4R8PD 5B2JC 4H9RB 4KGCD 4J8UD 3WA9B 3EPJA 3UT9D 1P3FA 1HQ3B 2CWEA 1P3KB 3REJC 2F8NH 1F1EA 1KX5A 5KDMA 3FDDA 3WTPE 4NE3A 5AV5C 3AZJD 5AV8D 4H9PB 3V9RB 3AZFD 4J8WC 1KX4B 3A6NA 4ZBJB 4Z5TB 5E5AA 5CHLB 5AY8B 1F66D 5B40B 4XZQD 5AV9C 2F8NK 4G91B 3X1SC 3AZMB 5DNNA 3MGPA 5B31G 1AOIB 5B1MB 3WTPB 3REKA 1P3OB 4R8PC 4YS3B 4KGCC 5GXQA 4J8UC 4LD9B 3LZ1A 1ID3B 3UT9C 2CV5A 4HGAC 1P3PB 2F8NG 1KX3D 5B24B 3MGSB 3AFAA 3W96A 1P3MB 2NZDD 1P3LD 5BS7C 3MNNA 4EO5C 1BH8B 3AN2D 2AROA 2J8PA 2ZY2A 3AZJC 2Y2PA 5AV8C 5B1LD 1P3GB 4KUDB 3C1BA 3AZFC 1P3AD 1U35D 5CPJB 3REIB 2RIQA 5FUGA 5B32A 1F66C 4XZQC 3MGQA 2Y2MA 3B6FD 3X1VD 4H9OB 3R45B 4YM6B 1HTAA 2FJ7B 1P34D 5AVCA 4WV4B 5B31B 2DF4C 1M18A 1BFMA 3UTBA 3AZGB 4XUJA 3W99A 4E45A 3B6GD 2IO5B 1S32D 4Z2MG 1R4VA 3AZHB 2JCHA 3NQUB 1KX3C 2NZDC 5B0ZA 2F8NB 1PZRA 1P3LC 3H0LC 5DNMA 3AV2A 3AN2C 4J8XA 2G5IC 3TU4A 1P3FD 3C1CA 5B1LC 1P3AC 3F6TA 1U35C 5AVBA 3AZLB 1KX5D 3B6FC 3X1VC 4NFTA 1P34C 5GSUA 2FFFB 1Z2CB 3A6ND 3X1TB 3B6GC 1S32C 4KHAB 5AV6B 3REHD 5B33A 4J8VA 5DNND 3MGPD 4UUZB 1ZLAA 5F99D 5AV5B 3WKJB 3AV1D 2PYOA 2Y2LA 5GXQD 1EQZA 3AYWA 2CV5D 5CPIA 3P5JB 5JA4A 1P3FC 4X23A 5BT1D 5CP6A 3AZIB 3VH6W 3EPHA 3AFAD 4R8PB 3W96D 1KX5C 2F2AC 3W98A 1T3UA 3MNND 3RELB 3AZKA 3VH5T 1M1AA 2AROD 3AL0C 4H9QA 3LZ0D 2NQBA 1TZYD 3B0BA 2HUEC 3A6NC 3REHC 1P3IB 5DNNC 3MGPC 3MVDB 4WU9B 5F99C 5AVCD 5AV8B 4H9RA 1M18D 3KUYA 3B0DB 3VH5A 4XUJD 5GXQC 3W99D 3LELB 3WA9A 3LZ1C 3EPKA 4XZQB 5GT3B 2CV5C 1HQ3A 1P3KA 5BT1C 5B0ZD 3AFAC 3W96C 5DNMD 4H9NB 3AV2D 3MNNC 4J8XD 2AROC 1P3BB 3TU4D 1M19B 4QLCB 3LZ0C 3C1CD 3V9RA 2BYMB 3KWQD 1KX4A 4Z5TA 1TZYC 5AY8A 5AVBD 5B0YB 5B40A 5B32C 4DRAA 3AZMA 3KFUG 3X1UB 1AOIA 3MGRA 3WTPA 1P3OA 5AVCC 5CPKB 4CSRB 5GSUD 4YS3A 1M18C 3H0RC 1U35B 4XUJC 4LD9A 3W99C 4NE6A 1ID3A 4ZUXB 1H3OB 1P3PA 4J8VD 2ZY5A 5B24A 3MGSA 1P34B 1P3MA 1ZLAD 5B0ZC 2PYOD 5DNMC 3AV2C 1BH8A 3KXBA 1EQZD 3W97D 3AYWD 4J8XC 3TU4C 5CPID 1P3GA 3C1CC 4KUDA 3KWQC 3LJAB 5CPJA 3REIA 4WU8B 4CAYB 2ZY4A 5AVBC 3UTAA 3O62B 3W98D 4H9OA 3R45A 4YM6A 2FJ7A 5B31A 5GSUC 1P3FB 3AZGA 2NQBD 2LY8A 3WAAB 1WWSA 3AZHA 4H9SC 2BG1A 4J8VC 5G49B 3NQUA 1ZLAC 2F8NA 2PYOC 3B0CW 3KUYD 2HUEB 3WA9D 4JJNB 1EQZC 3W97C 4Z66B 3AYWC 2Y2NA 3REHB 5CPIC 1JFIB 1HQ3D 1P3KD 5F99B 3AV1B 5B2IB
chains in the Genus database with same CATH topology
3AZLA 5BNXB 2ZY3A 5JRGB 3W98C 4G92C 3AZEB 2BYKB 3AZNB 2NQBC 3X1TA 5GT0B 4KHAA 2HIOB 5AV6A 3AZMD 5B2JB 3KSYA 2G5HC 4UUZA 3WKJA 5AV5A 1AOID 3MGRD 3LZ0B 3KUYC 1TZYB 4LD9D 3WA9C 5FUGB 5BNVB 3REJB 2XD1A 5E5AD 4WJ3C 1HQ3C 1WWIA 1P3KC 3AZIA 3MGSD 1P3MD 4R8PA 2UWXA 3REKD 3RELA 1B6WA 3KXBD 4J8WB 1A7WA 3LZ1D 1P3GD 4KUDD 5AV9B 5CPJD 3REID 3X1SB 4ZBJC 1KX4C 3UTAD 2Y2GA 4G91C 3AZMC 1P3IA 3MVDA 4WU9A 4KGCB 1AOIC 3MGRC 5B31D 4J8UB 5AV8A 3TU4B 3UT9B 4YS3C 3KWQB 4DQYB 4HGAB 3LELA 4LD9C 4XZQA 5GT3A 3C1BD 5E5AC 5B32D 1P3PC 2YFWB 3MGQD 2DQNC 3MGSC 4EO5B 1P3MC 2F8ND 1W2EA 4H9NA 3REKC 2YFVB 3AZJB 3KXBC 3UTBD 3AZFB 1P3BA 1M19A 3H0MC 4QLCA 1P3GC 2BYMA 1F66B 4KUDC 3A1IA 5CPJC 3REIC 5B0YA 3UTAC 3AZLD 1BH9B 3X1UA 4WNNB 3W97B 5CPKA 4CSRA 1N1JB 1Q9CA 5B31C 1U35A 4H9PA 4UPKA 3X1TD 2IO5C 3C1BC 4ZUXA 5AV6D 1KX3B 2NZDB 1H3OA 1P3LB 3AZHC 4G92B 1P34A 3MGQC 3WKJD 1TAFB 3AN2B 3NQJB 5B1MA 5B1LB 5BO0B 1P3AB 3UTBC 2Y2IA 4NE5A 1B67A 3LJAA 4WU8A 2JE5A 4CAYA 3AZID 3B6FB 5B33D 3X1VB 3O62A 3AZLC 3KUYB 2W8SA 3RELD 4AWLC 2RVQD 3B6GB 1S32B 3VH5W 3X1TC 3WAAA 4X23D 5AV6C 5CP6D 1P3ID 5G49A 3MVDD 4WU9D 3WKJC 2Y2OA 2Y2KA 3AZKD 1M1AD 4E44A 3LELD 4JJNA 5C3IC 4Z66A 5GT3D 3REHA 1JFIA 5F99A 1KX5B 3AZIC 5KDMB 3MGRB 5B33C 3AV1A 5B2IA 3A1KA 5BNXA 5JRGA 3RELC 3AZEA 1P3BD 5B32G 2BYKA 2RVQC 5E5AB 3A6NB 4QLCD 3AZNA 1M19D 5GT0A 5DNNB 2HIOA 5B0YD 4X23C 3MGPB 5CP6C 3REKB 5B2JA 1P3IC 3X1UD 3KXBB 3MVDC 4WU9C 5GXQB 5CPKD 3LZ0A 3AZKC 3LZ1B 3VH6T 3B0DC 3EG5B 2CV5B 1M1AC 1TZYA 3LELC 3UTAB 5BNVA 3REJA 5GT3C 4ZUXD 1KX4D 4Z5TD 5AY8D 3AFAB 3W96B 5B40D 2JSSA 3MNNB 2Y2HA 3EPLA 5B1MD 2AROB 3WTPD 1P3OD 4YS3D 4J8WA 3C1BB 1P3BC 3VH6A 1M19C 4QLCC 2XD5A 5B32B 4M6BA 1ID3D 5AV9A 3LJAD 3MGQB 3X1SA 4WU8D 4Z2MH 1P3PD 5B0YC 3O62D 5AVCB 5B24D 3X1UC 1M18B 3UTBB 4KGCA 4XUJB 5CPKC 4J8UA 3W99B 3UT9A 3KWQA 3WAAD 4ZUXC 4Z5TC 5B0ZB 5AY8C 5BS7A 5B40C 4AWLB 5DNMB 2L5AA 2YFWA 3AV2B 4YM6D 2FJ7D 5B1MC 4J8XB 3WTPC 3AZJA 2YFVA 1P3OC 3C1CB 3AZFA 2Y2JA 4JJND 3AZGD 4Z66D 2VQRA 5AVBB 4H9SA 1F66A 1ID3C 3LJAC 4WU8C 3AZHD 5B2ID 3O62C 5B24C 5JRGD 1ULYA 5GSUB 1BH9A 4WNNA 3W97A 5C3IB 3AZED 2Y2QA 1N1JA 3AZND 5B33B 5GT0D 4J8VB 2HIOD 3WAAC 1KX3A 1ZLAB 2NZDA 2PYOB 1P3LA 5B2JD 4WZSB 1TAFA 3AN2A 4YM6C 3NQJA 1EQZB 2FJ7C 3AYWB 5CPIB 5JA4B 5B1LA 5BO0A 1P3AA 4JJNC 3AZGC 3IP4C 4Z66C 4X23B 2ZM5A 3REJD 5CP6B 1KU5A 3B6FA 3W98B 3AV1C 3X1VA 5B2IC 3AZKB 5AV5D 1M1AB 5JRGC 4DRBA 4H9QB 4J8WD 2NQBB 3AZEC 3B6GA 3AZNC 1S32A 5AV9D 3X1SD 3B0CT 5GT0C 2HIOC 4R8PD 5B2JC 4H9RB 4KGCD 4J8UD 3WA9B 3EPJA 3UT9D 1P3FA 1HQ3B 2CWEA 1P3KB 3REJC 2F8NH 1F1EA 1KX5A 5KDMA 3FDDA 3WTPE 4NE3A 5AV5C 3AZJD 5AV8D 4H9PB 3V9RB 3AZFD 4J8WC 1KX4B 3A6NA 4ZBJB 4Z5TB 5E5AA 5CHLB 5AY8B 1F66D 5B40B 4XZQD 5AV9C 2F8NK 4G91B 3X1SC 3AZMB 5DNNA 3MGPA 5B31G 1AOIB 5B1MB 3WTPB 3REKA 1P3OB 4R8PC 4YS3B 4KGCC 5GXQA 4J8UC 4LD9B 3LZ1A 1ID3B 3UT9C 2CV5A 4HGAC 1P3PB 2F8NG 1KX3D 5B24B 3MGSB 3AFAA 3W96A 1P3MB 2NZDD 1P3LD 5BS7C 3MNNA 4EO5C 1BH8B 3AN2D 2AROA 2J8PA 2ZY2A 3AZJC 2Y2PA 5AV8C 5B1LD 1P3GB 4KUDB 3C1BA 3AZFC 1P3AD 1U35D 5CPJB 3REIB 2RIQA 5FUGA 5B32A 1F66C 4XZQC 3MGQA 2Y2MA 3B6FD 3X1VD 4H9OB 3R45B 4YM6B 1HTAA 2FJ7B 1P34D 5AVCA 4WV4B 5B31B 2DF4C 1M18A 1BFMA 3UTBA 3AZGB 4XUJA 3W99A 4E45A 3B6GD 2IO5B 1S32D 4Z2MG 1R4VA 3AZHB 2JCHA 3NQUB 1KX3C 2NZDC 5B0ZA 2F8NB 1PZRA 1P3LC 3H0LC 5DNMA 3AV2A 3AN2C 4J8XA 2G5IC 3TU4A 1P3FD 3C1CA 5B1LC 1P3AC 3F6TA 1U35C 5AVBA 3AZLB 1KX5D 3B6FC 3X1VC 4NFTA 1P34C 5GSUA 2FFFB 1Z2CB 3A6ND 3X1TB 3B6GC 1S32C 4KHAB 5AV6B 3REHD 5B33A 4J8VA 5DNND 3MGPD 4UUZB 1ZLAA 5F99D 5AV5B 3WKJB 3AV1D 2PYOA 2Y2LA 5GXQD 1EQZA 3AYWA 2CV5D 5CPIA 3P5JB 5JA4A 1P3FC 4X23A 5BT1D 5CP6A 3AZIB 3VH6W 3EPHA 3AFAD 4R8PB 3W96D 1KX5C 2F2AC 3W98A 1T3UA 3MNND 3RELB 3AZKA 3VH5T 1M1AA 2AROD 3AL0C 4H9QA 3LZ0D 2NQBA 1TZYD 3B0BA 2HUEC 3A6NC 3REHC 1P3IB 5DNNC 3MGPC 3MVDB 4WU9B 5F99C 5AVCD 5AV8B 4H9RA 1M18D 3KUYA 3B0DB 3VH5A 4XUJD 5GXQC 3W99D 3LELB 3WA9A 3LZ1C 3EPKA 4XZQB 5GT3B 2CV5C 1HQ3A 1P3KA 5BT1C 5B0ZD 3AFAC 3W96C 5DNMD 4H9NB 3AV2D 3MNNC 4J8XD 2AROC 1P3BB 3TU4D 1M19B 4QLCB 3LZ0C 3C1CD 3V9RA 2BYMB 3KWQD 1KX4A 4Z5TA 1TZYC 5AY8A 5AVBD 5B0YB 5B40A 5B32C 4DRAA 3AZMA 3KFUG 3X1UB 1AOIA 3MGRA 3WTPA 1P3OA 5AVCC 5CPKB 4CSRB 5GSUD 4YS3A 1M18C 3H0RC 1U35B 4XUJC 4LD9A 3W99C 4NE6A 1ID3A 4ZUXB 1H3OB 1P3PA 4J8VD 2ZY5A 5B24A 3MGSA 1P34B 1P3MA 1ZLAD 5B0ZC 2PYOD 5DNMC 3AV2C 1BH8A 3KXBA 1EQZD 3W97D 3AYWD 4J8XC 3TU4C 5CPID 1P3GA 3C1CC 4KUDA 3KWQC 3LJAB 5CPJA 3REIA 4WU8B 4CAYB 2ZY4A 5AVBC 3UTAA 3O62B 3W98D 4H9OA 3R45A 4YM6A 2FJ7A 5B31A 5GSUC 1P3FB 3AZGA 2NQBD 2LY8A 3WAAB 1WWSA 3AZHA 4H9SC 2BG1A 4J8VC 5G49B 3NQUA 1ZLAC 2F8NA 2PYOC 3B0CW 3KUYD 2HUEB 3WA9D 4JJNB 1EQZC 3W97C 4Z66B 3AYWC 2Y2NA 3REHB 5CPIC 1JFIB 1HQ3D 1P3KD 5F99B 3AV1B 5B2IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  5BNX B;  5JRG B;  3W98 C;  4G92 C;  3AZE B;  2BYK B;  3AZN B;  2NQB C;  3X1T A;  5GT0 B;  4KHA A;  2HIO B;  5AV6 A;  3AZM D;  5B2J B;  3KSY A;  4UUZ A;  3WKJ A;  5AV5 A;  1AOI D;  3MGR D;  3LZ0 B;  3KUY C;  1TZY B;  4LD9 D;  3WA9 C;  5FUG B;  5BNV B;  3REJ B;  5E5A D;  1HQ3 C;  1WWI A;  1P3K C;  3AZI A;  3MGS D;  1P3M D;  4R8P A;  3REK D;  3REL A;  1B6W A;  3KXB D;  4J8W B;  1A7W A;  3LZ1 D;  1P3G D;  4KUD D;  5AV9 B;  5CPJ D;  3REI D;  3X1S B;  4ZBJ C;  1KX4 C;  3UTA D;  4G91 C;  3AZM C;  1P3I A;  3MVD A;  4WU9 A;  4KGC B;  1AOI C;  3MGR C;  5B31 D;  4J8U B;  5AV8 A;  3TU4 B;  3UT9 B;  4YS3 C;  3KWQ B;  4HGA B;  3LEL A;  4LD9 C;  4XZQ A;  5GT3 A;  3C1B D;  5E5A C;  5B32 D;  1P3P C;  2YFW B;  3MGQ D;  3MGS C;  4EO5 B;  1P3M C;  2F8N D;  4H9N A;  3REK C;  2YFV B;  3AZJ B;  3KXB C;  3UTB D;  3AZF B;  1P3B A;  1M19 A;  4QLC A;  1P3G C;  2BYM A;  1F66 B;  4KUD C;  5CPJ C;  3REI C;  5B0Y A;  3UTA C;  3AZL D;  1BH9 B;  3X1U A;  4WNN B;  3W97 B;  5CPK A;  4CSR A;  1N1J B;  1Q9C A;  5B31 C;  1U35 A;  4H9P A;  3X1T D;  2IO5 C;  3C1B C;  4ZUX A;  5AV6 D;  1KX3 B;  2NZD B;  1H3O A;  1P3L B;  3AZH C;  4G92 B;  1P34 A;  3MGQ C;  3WKJ D;  1TAF B;  3AN2 B;  3NQJ B;  5B1M A;  5B1L B;  5BO0 B;  1P3A B;  3UTB C;  4NE5 A;  1B67 A;  3LJA A;  4WU8 A;  4CAY A;  3AZI D;  3B6F B;  5B33 D;  3X1V B;  3O62 A;  3AZL C;  3KUY B;  3REL D;  4AWL C;  2RVQ D;  3B6G B;  1S32 B;  3VH5 W;  3X1T C;  3WAA A;  4X23 D;  5AV6 C;  5CP6 D;  1P3I D;  5G49 A;  3MVD D;  4WU9 D;  3WKJ C;  3AZK D;  1M1A D;  4E44 A;  3LEL D;  4JJN A;  5C3I C;  4Z66 A;  5GT3 D;  3REH A;  1JFI A;  5F99 A;  1KX5 B;  3AZI C;  5KDM B;  3MGR B;  5B33 C;  3AV1 A;  5B2I A;  5BNX A;  5JRG A;  3REL C;  3AZE A;  1P3B D;  5B32 G;  2BYK A;  2RVQ C;  5E5A B;  3A6N B;  4QLC D;  3AZN A;  1M19 D;  5GT0 A;  5DNN B;  2HIO A;  5B0Y D;  4X23 C;  3MGP B;  5CP6 C;  3REK B;  5B2J A;  1P3I C;  3X1U D;  3KXB B;  3MVD C;  4WU9 C;  5GXQ B;  5CPK D;  3LZ0 A;  3AZK C;  3LZ1 B;  3VH6 T;  3B0D C;  2CV5 B;  1M1A C;  1TZY A;  3LEL C;  3UTA B;  5BNV A;  3REJ A;  5GT3 C;  4ZUX D;  1KX4 D;  4Z5T D;  5AY8 D;  3AFA B;  3W96 B;  5B40 D;  2JSS A;  3MNN B;  5B1M D;  2ARO B;  3WTP D;  1P3O D;  4YS3 D;  4J8W A;  3C1B B;  1P3B C;  3VH6 A;  1M19 C;  4QLC C;  5B32 B;  4M6B A;  1ID3 D;  5AV9 A;  3LJA D;  3MGQ B;  3X1S A;  4WU8 D;  4Z2M H;  1P3P D;  5B0Y C;  3O62 D;  5AVC B;  5B24 D;  3X1U C;  1M18 B;  3UTB B;  4KGC A;  4XUJ B;  5CPK C;  4J8U A;  3W99 B;  3UT9 A;  3KWQ A;  3WAA D;  4ZUX C;  4Z5T C;  5B0Z B;  5AY8 C;  5BS7 A;  5B40 C;  4AWL B;  5DNM B;  2L5A A;  2YFW A;  3AV2 B;  4YM6 D;  2FJ7 D;  5B1M C;  4J8X B;  3WTP C;  3AZJ A;  2YFV A;  1P3O C;  3C1C B;  3AZF A;  4JJN D;  3AZG D;  4Z66 D;  5AVB B;  4H9S A;  1F66 A;  1ID3 C;  3LJA C;  4WU8 C;  3AZH D;  5B2I D;  3O62 C;  5B24 C;  5JRG D;  1ULY A;  5GSU B;  1BH9 A;  4WNN A;  3W97 A;  5C3I B;  3AZE D;  1N1J A;  3AZN D;  5B33 B;  5GT0 D;  4J8V B;  2HIO D;  3WAA C;  1KX3 A;  1ZLA B;  2NZD A;  2PYO B;  1P3L A;  5B2J D;  4WZS B;  1TAF A;  3AN2 A;  4YM6 C;  3NQJ A;  1EQZ B;  2FJ7 C;  3AYW B;  5CPI B;  5JA4 B;  5B1L A;  5BO0 A;  1P3A A;  4JJN C;  3AZG C;  4X23 B;  4Z66 C;  3REJ D;  5CP6 B;  1KU5 A;  3B6F A;  3W98 B;  3AV1 C;  3X1V A;  5B2I C;  3AZK B;  5AV5 D;  1M1A B;  5JRG C;  4DRB A;  4H9Q B;  4J8W D;  2NQB B;  3AZE C;  3B6G A;  3AZN C;  1S32 A;  5AV9 D;  3X1S D;  3B0C T;  5GT0 C;  2HIO C;  4R8P D;  5B2J C;  4H9R B;  4KGC D;  4J8U D;  3WA9 B;  3UT9 D;  1P3F A;  1HQ3 B;  2CWE A;  1P3K B;  3REJ C;  2F8N H;  1F1E A;  1KX5 A;  5KDM A;  3WTP E;  4NE3 A;  5AV5 C;  3AZJ D;  5AV8 D;  4H9P B;  3V9R B;  3AZF D;  4J8W C;  1KX4 B;  3A6N A;  4ZBJ B;  4Z5T B;  5E5A A;  5CHL B;  5AY8 B;  1F66 D;  5B40 B;  4XZQ D;  5AV9 C;  2F8N K;  4G91 B;  3X1S C;  3AZM B;  5DNN A;  3MGP A;  5B31 G;  1AOI B;  5B1M B;  3WTP B;  3REK A;  1P3O B;  4R8P C;  4YS3 B;  4KGC C;  5GXQ A;  4J8U C;  4LD9 B;  3LZ1 A;  1ID3 B;  3UT9 C;  2CV5 A;  4HGA C;  1P3P B;  2F8N G;  1KX3 D;  5B24 B;  3MGS B;  3AFA A;  3W96 A;  1P3M B;  2NZD D;  1P3L D;  5BS7 C;  3MNN A;  4EO5 C;  1BH8 B;  3AN2 D;  2ARO A;  3AZJ C;  5AV8 C;  5B1L D;  1P3G B;  4KUD B;  3C1B A;  3AZF C;  1P3A D;  1U35 D;  5CPJ B;  3REI B;  5FUG A;  5B32 A;  1F66 C;  4XZQ C;  3MGQ A;  3B6F D;  3X1V D;  4H9O B;  3R45 B;  4YM6 B;  1HTA A;  2FJ7 B;  1P34 D;  5AVC A;  4WV4 B;  5B31 B;  1M18 A;  1BFM A;  3UTB A;  3AZG B;  4XUJ A;  3W99 A;  4E45 A;  3B6G D;  2IO5 B;  1S32 D;  4Z2M G;  1R4V A;  3AZH B;  3NQU B;  1KX3 C;  2NZD C;  5B0Z A;  2F8N B;  1P3L C;  5DNM A;  3AV2 A;  3AN2 C;  4J8X A;  3TU4 A;  1P3F D;  3C1C A;  5B1L C;  1P3A C;  1U35 C;  5AVB A;  3AZL B;  1KX5 D;  3B6F C;  3X1V C;  4NFT A;  1P34 C;  5GSU A;  3A6N D;  3X1T B;  3B6G C;  1S32 C;  4KHA B;  5AV6 B;  3REH D;  5B33 A;  4J8V A;  5DNN D;  3MGP D;  4UUZ B;  1ZLA A;  5F99 D;  5AV5 B;  3WKJ B;  3AV1 D;  2PYO A;  5GXQ D;  1EQZ A;  3AYW A;  2CV5 D;  5CPI A;  5JA4 A;  1P3F C;  4X23 A;  5BT1 D;  5CP6 A;  3AZI B;  3VH6 W;  3AFA D;  4R8P B;  3W96 D;  1KX5 C;  3W98 A;  3MNN D;  3REL B;  3AZK A;  3VH5 T;  1M1A A;  2ARO D;  4H9Q A;  3LZ0 D;  2NQB A;  1TZY D;  3B0B A;  2HUE C;  3A6N C;  3REH C;  1P3I B;  5DNN C;  3MGP C;  3MVD B;  4WU9 B;  5F99 C;  5AVC D;  5AV8 B;  4H9R A;  1M18 D;  3KUY A;  3B0D B;  3VH5 A;  4XUJ D;  5GXQ C;  3W99 D;  3LEL B;  3WA9 A;  3LZ1 C;  4XZQ B;  5GT3 B;  2CV5 C;  1HQ3 A;  1P3K A;  5BT1 C;  5B0Z D;  3AFA C;  3W96 C;  5DNM D;  4H9N B;  3AV2 D;  3MNN C;  4J8X D;  2ARO C;  1P3B B;  3TU4 D;  1M19 B;  4QLC B;  3LZ0 C;  3C1C D;  3V9R A;  2BYM B;  3KWQ D;  1KX4 A;  4Z5T A;  1TZY C;  5AY8 A;  5AVB D;  5B0Y B;  5B40 A;  5B32 C;  4DRA A;  3AZM A;  3X1U B;  1AOI A;  3MGR A;  3WTP A;  1P3O A;  5AVC C;  5CPK B;  4CSR B;  5GSU D;  4YS3 A;  1M18 C;  1U35 B;  4XUJ C;  4LD9 A;  3W99 C;  4NE6 A;  1ID3 A;  4ZUX B;  1H3O B;  1P3P A;  4J8V D;  1P34 B;  5B24 A;  3MGS A;  1P3M A;  1ZLA D;  5B0Z C;  2PYO D;  5DNM C;  3AV2 C;  1BH8 A;  3KXB A;  1EQZ D;  3W97 D;  3AYW D;  4J8X C;  3TU4 C;  5CPI D;  1P3G A;  3C1C C;  4KUD A;  3KWQ C;  3LJA B;  5CPJ A;  3REI A;  4WU8 B;  4CAY B;  5AVB C;  3UTA A;  3O62 B;  3W98 D;  4H9O A;  3R45 A;  4YM6 A;  2FJ7 A;  5B31 A;  5GSU C;  1P3F B;  3AZG A;  2NQB D;  2LY8 A;  3WAA B;  1WWS A;  3AZH A;  4H9S C;  4J8V C;  5G49 B;  3NQU A;  1ZLA C;  2F8N A;  2PYO C;  3B0C W;  3KUY D;  2HUE B;  3WA9 D;  4JJN B;  1EQZ C;  3W97 C;  4Z66 B;  3AYW C;  3REH B;  5CPI C;  1JFI B;  1HQ3 D;  1P3K D;  5F99 B;  3AV1 B;  5B2I B; 
#chains in the Genus database with same CATH topology
 3AZL A;  5BNX B;  2ZY3 A;  5JRG B;  3W98 C;  4G92 C;  3AZE B;  2BYK B;  3AZN B;  2NQB C;  3X1T A;  5GT0 B;  4KHA A;  2HIO B;  5AV6 A;  3AZM D;  5B2J B;  3KSY A;  2G5H C;  4UUZ A;  3WKJ A;  5AV5 A;  1AOI D;  3MGR D;  3LZ0 B;  3KUY C;  1TZY B;  4LD9 D;  3WA9 C;  5FUG B;  5BNV B;  3REJ B;  2XD1 A;  5E5A D;  4WJ3 C;  1HQ3 C;  1WWI A;  1P3K C;  3AZI A;  3MGS D;  1P3M D;  4R8P A;  2UWX A;  3REK D;  3REL A;  1B6W A;  3KXB D;  4J8W B;  1A7W A;  3LZ1 D;  1P3G D;  4KUD D;  5AV9 B;  5CPJ D;  3REI D;  3X1S B;  4ZBJ C;  1KX4 C;  3UTA D;  2Y2G A;  4G91 C;  3AZM C;  1P3I A;  3MVD A;  4WU9 A;  4KGC B;  1AOI C;  3MGR C;  5B31 D;  4J8U B;  5AV8 A;  3TU4 B;  3UT9 B;  4YS3 C;  3KWQ B;  4DQY B;  4HGA B;  3LEL A;  4LD9 C;  4XZQ A;  5GT3 A;  3C1B D;  5E5A C;  5B32 D;  1P3P C;  2YFW B;  3MGQ D;  2DQN C;  3MGS C;  4EO5 B;  1P3M C;  2F8N D;  1W2E A;  4H9N A;  3REK C;  2YFV B;  3AZJ B;  3KXB C;  3UTB D;  3AZF B;  1P3B A;  1M19 A;  3H0M C;  4QLC A;  1P3G C;  2BYM A;  1F66 B;  4KUD C;  3A1I A;  5CPJ C;  3REI C;  5B0Y A;  3UTA C;  3AZL D;  1BH9 B;  3X1U A;  4WNN B;  3W97 B;  5CPK A;  4CSR A;  1N1J B;  1Q9C A;  5B31 C;  1U35 A;  4H9P A;  4UPK A;  3X1T D;  2IO5 C;  3C1B C;  4ZUX A;  5AV6 D;  1KX3 B;  2NZD B;  1H3O A;  1P3L B;  3AZH C;  4G92 B;  1P34 A;  3MGQ C;  3WKJ D;  1TAF B;  3AN2 B;  3NQJ B;  5B1M A;  5B1L B;  5BO0 B;  1P3A B;  3UTB C;  2Y2I A;  4NE5 A;  1B67 A;  3LJA A;  4WU8 A;  2JE5 A;  4CAY A;  3AZI D;  3B6F B;  5B33 D;  3X1V B;  3O62 A;  3AZL C;  3KUY B;  2W8S A;  3REL D;  4AWL C;  2RVQ D;  3B6G B;  1S32 B;  3VH5 W;  3X1T C;  3WAA A;  4X23 D;  5AV6 C;  5CP6 D;  1P3I D;  5G49 A;  3MVD D;  4WU9 D;  3WKJ C;  2Y2O A;  2Y2K A;  3AZK D;  1M1A D;  4E44 A;  3LEL D;  4JJN A;  5C3I C;  4Z66 A;  5GT3 D;  3REH A;  1JFI A;  5F99 A;  1KX5 B;  3AZI C;  5KDM B;  3MGR B;  5B33 C;  3AV1 A;  5B2I A;  3A1K A;  5BNX A;  5JRG A;  3REL C;  3AZE A;  1P3B D;  5B32 G;  2BYK A;  2RVQ C;  5E5A B;  3A6N B;  4QLC D;  3AZN A;  1M19 D;  5GT0 A;  5DNN B;  2HIO A;  5B0Y D;  4X23 C;  3MGP B;  5CP6 C;  3REK B;  5B2J A;  1P3I C;  3X1U D;  3KXB B;  3MVD C;  4WU9 C;  5GXQ B;  5CPK D;  3LZ0 A;  3AZK C;  3LZ1 B;  3VH6 T;  3B0D C;  3EG5 B;  2CV5 B;  1M1A C;  1TZY A;  3LEL C;  3UTA B;  5BNV A;  3REJ A;  5GT3 C;  4ZUX D;  1KX4 D;  4Z5T D;  5AY8 D;  3AFA B;  3W96 B;  5B40 D;  2JSS A;  3MNN B;  2Y2H A;  3EPL A;  5B1M D;  2ARO B;  3WTP D;  1P3O D;  4YS3 D;  4J8W A;  3C1B B;  1P3B C;  3VH6 A;  1M19 C;  4QLC C;  2XD5 A;  5B32 B;  4M6B A;  1ID3 D;  5AV9 A;  3LJA D;  3MGQ B;  3X1S A;  4WU8 D;  4Z2M H;  1P3P D;  5B0Y C;  3O62 D;  5AVC B;  5B24 D;  3X1U C;  1M18 B;  3UTB B;  4KGC A;  4XUJ B;  5CPK C;  4J8U A;  3W99 B;  3UT9 A;  3KWQ A;  3WAA D;  4ZUX C;  4Z5T C;  5B0Z B;  5AY8 C;  5BS7 A;  5B40 C;  4AWL B;  5DNM B;  2L5A A;  2YFW A;  3AV2 B;  4YM6 D;  2FJ7 D;  5B1M C;  4J8X B;  3WTP C;  3AZJ A;  2YFV A;  1P3O C;  3C1C B;  3AZF A;  2Y2J A;  4JJN D;  3AZG D;  4Z66 D;  2VQR A;  5AVB B;  4H9S A;  1F66 A;  1ID3 C;  3LJA C;  4WU8 C;  3AZH D;  5B2I D;  3O62 C;  5B24 C;  5JRG D;  1ULY A;  5GSU B;  1BH9 A;  4WNN A;  3W97 A;  5C3I B;  3AZE D;  2Y2Q A;  1N1J A;  3AZN D;  5B33 B;  5GT0 D;  4J8V B;  2HIO D;  3WAA C;  1KX3 A;  1ZLA B;  2NZD A;  2PYO B;  1P3L A;  5B2J D;  4WZS B;  1TAF A;  3AN2 A;  4YM6 C;  3NQJ A;  1EQZ B;  2FJ7 C;  3AYW B;  5CPI B;  5JA4 B;  5B1L A;  5BO0 A;  1P3A A;  4JJN C;  3AZG C;  3IP4 C;  4Z66 C;  4X23 B;  2ZM5 A;  3REJ D;  5CP6 B;  1KU5 A;  3B6F A;  3W98 B;  3AV1 C;  3X1V A;  5B2I C;  3AZK B;  5AV5 D;  1M1A B;  5JRG C;  4DRB A;  4H9Q B;  4J8W D;  2NQB B;  3AZE C;  3B6G A;  3AZN C;  1S32 A;  5AV9 D;  3X1S D;  3B0C T;  5GT0 C;  2HIO C;  4R8P D;  5B2J C;  4H9R B;  4KGC D;  4J8U D;  3WA9 B;  3EPJ A;  3UT9 D;  1P3F A;  1HQ3 B;  2CWE A;  1P3K B;  3REJ C;  2F8N H;  1F1E A;  1KX5 A;  5KDM A;  3FDD A;  3WTP E;  4NE3 A;  5AV5 C;  3AZJ D;  5AV8 D;  4H9P B;  3V9R B;  3AZF D;  4J8W C;  1KX4 B;  3A6N A;  4ZBJ B;  4Z5T B;  5E5A A;  5CHL B;  5AY8 B;  1F66 D;  5B40 B;  4XZQ D;  5AV9 C;  2F8N K;  4G91 B;  3X1S C;  3AZM B;  5DNN A;  3MGP A;  5B31 G;  1AOI B;  5B1M B;  3WTP B;  3REK A;  1P3O B;  4R8P C;  4YS3 B;  4KGC C;  5GXQ A;  4J8U C;  4LD9 B;  3LZ1 A;  1ID3 B;  3UT9 C;  2CV5 A;  4HGA C;  1P3P B;  2F8N G;  1KX3 D;  5B24 B;  3MGS B;  3AFA A;  3W96 A;  1P3M B;  2NZD D;  1P3L D;  5BS7 C;  3MNN A;  4EO5 C;  1BH8 B;  3AN2 D;  2ARO A;  2J8P A;  2ZY2 A;  3AZJ C;  2Y2P A;  5AV8 C;  5B1L D;  1P3G B;  4KUD B;  3C1B A;  3AZF C;  1P3A D;  1U35 D;  5CPJ B;  3REI B;  2RIQ A;  5FUG A;  5B32 A;  1F66 C;  4XZQ C;  3MGQ A;  2Y2M A;  3B6F D;  3X1V D;  4H9O B;  3R45 B;  4YM6 B;  1HTA A;  2FJ7 B;  1P34 D;  5AVC A;  4WV4 B;  5B31 B;  2DF4 C;  1M18 A;  1BFM A;  3UTB A;  3AZG B;  4XUJ A;  3W99 A;  4E45 A;  3B6G D;  2IO5 B;  1S32 D;  4Z2M G;  1R4V A;  3AZH B;  2JCH A;  3NQU B;  1KX3 C;  2NZD C;  5B0Z A;  2F8N B;  1PZR A;  1P3L C;  3H0L C;  5DNM A;  3AV2 A;  3AN2 C;  4J8X A;  2G5I C;  3TU4 A;  1P3F D;  3C1C A;  5B1L C;  1P3A C;  3F6T A;  1U35 C;  5AVB A;  3AZL B;  1KX5 D;  3B6F C;  3X1V C;  4NFT A;  1P34 C;  5GSU A;  2FFF B;  1Z2C B;  3A6N D;  3X1T B;  3B6G C;  1S32 C;  4KHA B;  5AV6 B;  3REH D;  5B33 A;  4J8V A;  5DNN D;  3MGP D;  4UUZ B;  1ZLA A;  5F99 D;  5AV5 B;  3WKJ B;  3AV1 D;  2PYO A;  2Y2L A;  5GXQ D;  1EQZ A;  3AYW A;  2CV5 D;  5CPI A;  3P5J B;  5JA4 A;  1P3F C;  4X23 A;  5BT1 D;  5CP6 A;  3AZI B;  3VH6 W;  3EPH A;  3AFA D;  4R8P B;  3W96 D;  1KX5 C;  2F2A C;  3W98 A;  1T3U A;  3MNN D;  3REL B;  3AZK A;  3VH5 T;  1M1A A;  2ARO D;  3AL0 C;  4H9Q A;  3LZ0 D;  2NQB A;  1TZY D;  3B0B A;  2HUE C;  3A6N C;  3REH C;  1P3I B;  5DNN C;  3MGP C;  3MVD B;  4WU9 B;  5F99 C;  5AVC D;  5AV8 B;  4H9R A;  1M18 D;  3KUY A;  3B0D B;  3VH5 A;  4XUJ D;  5GXQ C;  3W99 D;  3LEL B;  3WA9 A;  3LZ1 C;  3EPK A;  4XZQ B;  5GT3 B;  2CV5 C;  1HQ3 A;  1P3K A;  5BT1 C;  5B0Z D;  3AFA C;  3W96 C;  5DNM D;  4H9N B;  3AV2 D;  3MNN C;  4J8X D;  2ARO C;  1P3B B;  3TU4 D;  1M19 B;  4QLC B;  3LZ0 C;  3C1C D;  3V9R A;  2BYM B;  3KWQ D;  1KX4 A;  4Z5T A;  1TZY C;  5AY8 A;  5AVB D;  5B0Y B;  5B40 A;  5B32 C;  4DRA A;  3AZM A;  3KFU G;  3X1U B;  1AOI A;  3MGR A;  3WTP A;  1P3O A;  5AVC C;  5CPK B;  4CSR B;  5GSU D;  4YS3 A;  1M18 C;  3H0R C;  1U35 B;  4XUJ C;  4LD9 A;  3W99 C;  4NE6 A;  1ID3 A;  4ZUX B;  1H3O B;  1P3P A;  4J8V D;  2ZY5 A;  5B24 A;  3MGS A;  1P34 B;  1P3M A;  1ZLA D;  5B0Z C;  2PYO D;  5DNM C;  3AV2 C;  1BH8 A;  3KXB A;  1EQZ D;  3W97 D;  3AYW D;  4J8X C;  3TU4 C;  5CPI D;  1P3G A;  3C1C C;  4KUD A;  3KWQ C;  3LJA B;  5CPJ A;  3REI A;  4WU8 B;  4CAY B;  2ZY4 A;  5AVB C;  3UTA A;  3O62 B;  3W98 D;  4H9O A;  3R45 A;  4YM6 A;  2FJ7 A;  5B31 A;  5GSU C;  1P3F B;  3AZG A;  2NQB D;  2LY8 A;  3WAA B;  1WWS A;  3AZH A;  4H9S C;  2BG1 A;  4J8V C;  5G49 B;  3NQU A;  1ZLA C;  2F8N A;  2PYO C;  3B0C W;  3KUY D;  2HUE B;  3WA9 D;  4JJN B;  1EQZ C;  3W97 C;  4Z66 B;  3AYW C;  2Y2N A;  3REH B;  5CPI C;  1JFI B;  1HQ3 D;  1P3K D;  5F99 B;  3AV1 B;  5B2I B; 
#chains in the Genus database with same CATH homology
 3AZL A;  5BNX B;  2ZY3 A;  5JRG B;  3W98 C;  4G92 C;  3AZE B;  2BYK B;  3AZN B;  2NQB C;  3X1T A;  5GT0 B;  4KHA A;  2HIO B;  5AV6 A;  3AZM D;  5B2J B;  3KSY A;  2G5H C;  4UUZ A;  3WKJ A;  5AV5 A;  1AOI D;  3MGR D;  3LZ0 B;  3KUY C;  1TZY B;  4LD9 D;  3WA9 C;  5FUG B;  5BNV B;  3REJ B;  2XD1 A;  5E5A D;  4WJ3 C;  1HQ3 C;  1WWI A;  1P3K C;  3AZI A;  3MGS D;  1P3M D;  4R8P A;  2UWX A;  3REK D;  3REL A;  1B6W A;  3KXB D;  4J8W B;  1A7W A;  3LZ1 D;  1P3G D;  4KUD D;  5AV9 B;  5CPJ D;  3REI D;  3X1S B;  4ZBJ C;  1KX4 C;  3UTA D;  2Y2G A;  4G91 C;  3AZM C;  1P3I A;  3MVD A;  4WU9 A;  4KGC B;  1AOI C;  3MGR C;  5B31 D;  4J8U B;  5AV8 A;  3TU4 B;  3UT9 B;  4YS3 C;  3KWQ B;  4DQY B;  4HGA B;  3LEL A;  4LD9 C;  4XZQ A;  5GT3 A;  3C1B D;  5E5A C;  5B32 D;  1P3P C;  2YFW B;  3MGQ D;  2DQN C;  3MGS C;  4EO5 B;  1P3M C;  2F8N D;  1W2E A;  4H9N A;  3REK C;  2YFV B;  3AZJ B;  3KXB C;  3UTB D;  3AZF B;  1P3B A;  1M19 A;  3H0M C;  4QLC A;  1P3G C;  2BYM A;  1F66 B;  4KUD C;  3A1I A;  5CPJ C;  3REI C;  5B0Y A;  3UTA C;  3AZL D;  1BH9 B;  3X1U A;  4WNN B;  3W97 B;  5CPK A;  4CSR A;  1N1J B;  1Q9C A;  5B31 C;  1U35 A;  4H9P A;  4UPK A;  3X1T D;  2IO5 C;  3C1B C;  4ZUX A;  5AV6 D;  1KX3 B;  2NZD B;  1H3O A;  1P3L B;  3AZH C;  4G92 B;  1P34 A;  3MGQ C;  3WKJ D;  1TAF B;  3AN2 B;  3NQJ B;  5B1M A;  5B1L B;  5BO0 B;  1P3A B;  3UTB C;  2Y2I A;  4NE5 A;  1B67 A;  3LJA A;  4WU8 A;  2JE5 A;  4CAY A;  3AZI D;  3B6F B;  5B33 D;  3X1V B;  3O62 A;  3AZL C;  3KUY B;  2W8S A;  3REL D;  4AWL C;  2RVQ D;  3B6G B;  1S32 B;  3VH5 W;  3X1T C;  3WAA A;  4X23 D;  5AV6 C;  5CP6 D;  1P3I D;  5G49 A;  3MVD D;  4WU9 D;  3WKJ C;  2Y2O A;  2Y2K A;  3AZK D;  1M1A D;  4E44 A;  3LEL D;  4JJN A;  5C3I C;  4Z66 A;  5GT3 D;  3REH A;  1JFI A;  5F99 A;  1KX5 B;  3AZI C;  5KDM B;  3MGR B;  5B33 C;  3AV1 A;  5B2I A;  3A1K A;  5BNX A;  5JRG A;  3REL C;  3AZE A;  1P3B D;  5B32 G;  2BYK A;  2RVQ C;  5E5A B;  3A6N B;  4QLC D;  3AZN A;  1M19 D;  5GT0 A;  5DNN B;  2HIO A;  5B0Y D;  4X23 C;  3MGP B;  5CP6 C;  3REK B;  5B2J A;  1P3I C;  3X1U D;  3KXB B;  3MVD C;  4WU9 C;  5GXQ B;  5CPK D;  3LZ0 A;  3AZK C;  3LZ1 B;  3VH6 T;  3B0D C;  3EG5 B;  2CV5 B;  1M1A C;  1TZY A;  3LEL C;  3UTA B;  5BNV A;  3REJ A;  5GT3 C;  4ZUX D;  1KX4 D;  4Z5T D;  5AY8 D;  3AFA B;  3W96 B;  5B40 D;  2JSS A;  3MNN B;  2Y2H A;  3EPL A;  5B1M D;  2ARO B;  3WTP D;  1P3O D;  4YS3 D;  4J8W A;  3C1B B;  1P3B C;  3VH6 A;  1M19 C;  4QLC C;  2XD5 A;  5B32 B;  4M6B A;  1ID3 D;  5AV9 A;  3LJA D;  3MGQ B;  3X1S A;  4WU8 D;  4Z2M H;  1P3P D;  5B0Y C;  3O62 D;  5AVC B;  5B24 D;  3X1U C;  1M18 B;  3UTB B;  4KGC A;  4XUJ B;  5CPK C;  4J8U A;  3W99 B;  3UT9 A;  3KWQ A;  3WAA D;  4ZUX C;  4Z5T C;  5B0Z B;  5AY8 C;  5BS7 A;  5B40 C;  4AWL B;  5DNM B;  2L5A A;  2YFW A;  3AV2 B;  4YM6 D;  2FJ7 D;  5B1M C;  4J8X B;  3WTP C;  3AZJ A;  2YFV A;  1P3O C;  3C1C B;  3AZF A;  2Y2J A;  4JJN D;  3AZG D;  4Z66 D;  2VQR A;  5AVB B;  4H9S A;  1F66 A;  1ID3 C;  3LJA C;  4WU8 C;  3AZH D;  5B2I D;  3O62 C;  5B24 C;  5JRG D;  1ULY A;  5GSU B;  1BH9 A;  4WNN A;  3W97 A;  5C3I B;  3AZE D;  2Y2Q A;  1N1J A;  3AZN D;  5B33 B;  5GT0 D;  4J8V B;  2HIO D;  3WAA C;  1KX3 A;  1ZLA B;  2NZD A;  2PYO B;  1P3L A;  5B2J D;  4WZS B;  1TAF A;  3AN2 A;  4YM6 C;  3NQJ A;  1EQZ B;  2FJ7 C;  3AYW B;  5CPI B;  5JA4 B;  5B1L A;  5BO0 A;  1P3A A;  4JJN C;  3AZG C;  3IP4 C;  4Z66 C;  4X23 B;  2ZM5 A;  3REJ D;  5CP6 B;  1KU5 A;  3B6F A;  3W98 B;  3AV1 C;  3X1V A;  5B2I C;  3AZK B;  5AV5 D;  1M1A B;  5JRG C;  4DRB A;  4H9Q B;  4J8W D;  2NQB B;  3AZE C;  3B6G A;  3AZN C;  1S32 A;  5AV9 D;  3X1S D;  3B0C T;  5GT0 C;  2HIO C;  4R8P D;  5B2J C;  4H9R B;  4KGC D;  4J8U D;  3WA9 B;  3EPJ A;  3UT9 D;  1P3F A;  1HQ3 B;  2CWE A;  1P3K B;  3REJ C;  2F8N H;  1F1E A;  1KX5 A;  5KDM A;  3FDD A;  3WTP E;  4NE3 A;  5AV5 C;  3AZJ D;  5AV8 D;  4H9P B;  3V9R B;  3AZF D;  4J8W C;  1KX4 B;  3A6N A;  4ZBJ B;  4Z5T B;  5E5A A;  5CHL B;  5AY8 B;  1F66 D;  5B40 B;  4XZQ D;  5AV9 C;  2F8N K;  4G91 B;  3X1S C;  3AZM B;  5DNN A;  3MGP A;  5B31 G;  1AOI B;  5B1M B;  3WTP B;  3REK A;  1P3O B;  4R8P C;  4YS3 B;  4KGC C;  5GXQ A;  4J8U C;  4LD9 B;  3LZ1 A;  1ID3 B;  3UT9 C;  2CV5 A;  4HGA C;  1P3P B;  2F8N G;  1KX3 D;  5B24 B;  3MGS B;  3AFA A;  3W96 A;  1P3M B;  2NZD D;  1P3L D;  5BS7 C;  3MNN A;  4EO5 C;  1BH8 B;  3AN2 D;  2ARO A;  2J8P A;  2ZY2 A;  3AZJ C;  2Y2P A;  5AV8 C;  5B1L D;  1P3G B;  4KUD B;  3C1B A;  3AZF C;  1P3A D;  1U35 D;  5CPJ B;  3REI B;  2RIQ A;  5FUG A;  5B32 A;  1F66 C;  4XZQ C;  3MGQ A;  2Y2M A;  3B6F D;  3X1V D;  4H9O B;  3R45 B;  4YM6 B;  1HTA A;  2FJ7 B;  1P34 D;  5AVC A;  4WV4 B;  5B31 B;  2DF4 C;  1M18 A;  1BFM A;  3UTB A;  3AZG B;  4XUJ A;  3W99 A;  4E45 A;  3B6G D;  2IO5 B;  1S32 D;  4Z2M G;  1R4V A;  3AZH B;  2JCH A;  3NQU B;  1KX3 C;  2NZD C;  5B0Z A;  2F8N B;  1PZR A;  1P3L C;  3H0L C;  5DNM A;  3AV2 A;  3AN2 C;  4J8X A;  2G5I C;  3TU4 A;  1P3F D;  3C1C A;  5B1L C;  1P3A C;  3F6T A;  1U35 C;  5AVB A;  3AZL B;  1KX5 D;  3B6F C;  3X1V C;  4NFT A;  1P34 C;  5GSU A;  2FFF B;  1Z2C B;  3A6N D;  3X1T B;  3B6G C;  1S32 C;  4KHA B;  5AV6 B;  3REH D;  5B33 A;  4J8V A;  5DNN D;  3MGP D;  4UUZ B;  1ZLA A;  5F99 D;  5AV5 B;  3WKJ B;  3AV1 D;  2PYO A;  2Y2L A;  5GXQ D;  1EQZ A;  3AYW A;  2CV5 D;  5CPI A;  3P5J B;  5JA4 A;  1P3F C;  4X23 A;  5BT1 D;  5CP6 A;  3AZI B;  3VH6 W;  3EPH A;  3AFA D;  4R8P B;  3W96 D;  1KX5 C;  2F2A C;  3W98 A;  1T3U A;  3MNN D;  3REL B;  3AZK A;  3VH5 T;  1M1A A;  2ARO D;  3AL0 C;  4H9Q A;  3LZ0 D;  2NQB A;  1TZY D;  3B0B A;  2HUE C;  3A6N C;  3REH C;  1P3I B;  5DNN C;  3MGP C;  3MVD B;  4WU9 B;  5F99 C;  5AVC D;  5AV8 B;  4H9R A;  1M18 D;  3KUY A;  3B0D B;  3VH5 A;  4XUJ D;  5GXQ C;  3W99 D;  3LEL B;  3WA9 A;  3LZ1 C;  3EPK A;  4XZQ B;  5GT3 B;  2CV5 C;  1HQ3 A;  1P3K A;  5BT1 C;  5B0Z D;  3AFA C;  3W96 C;  5DNM D;  4H9N B;  3AV2 D;  3MNN C;  4J8X D;  2ARO C;  1P3B B;  3TU4 D;  1M19 B;  4QLC B;  3LZ0 C;  3C1C D;  3V9R A;  2BYM B;  3KWQ D;  1KX4 A;  4Z5T A;  1TZY C;  5AY8 A;  5AVB D;  5B0Y B;  5B40 A;  5B32 C;  4DRA A;  3AZM A;  3KFU G;  3X1U B;  1AOI A;  3MGR A;  3WTP A;  1P3O A;  5AVC C;  5CPK B;  4CSR B;  5GSU D;  4YS3 A;  1M18 C;  3H0R C;  1U35 B;  4XUJ C;  4LD9 A;  3W99 C;  4NE6 A;  1ID3 A;  4ZUX B;  1H3O B;  1P3P A;  4J8V D;  2ZY5 A;  5B24 A;  3MGS A;  1P34 B;  1P3M A;  1ZLA D;  5B0Z C;  2PYO D;  5DNM C;  3AV2 C;  1BH8 A;  3KXB A;  1EQZ D;  3W97 D;  3AYW D;  4J8X C;  3TU4 C;  5CPI D;  1P3G A;  3C1C C;  4KUD A;  3KWQ C;  3LJA B;  5CPJ A;  3REI A;  4WU8 B;  4CAY B;  2ZY4 A;  5AVB C;  3UTA A;  3O62 B;  3W98 D;  4H9O A;  3R45 A;  4YM6 A;  2FJ7 A;  5B31 A;  5GSU C;  1P3F B;  3AZG A;  2NQB D;  2LY8 A;  3WAA B;  1WWS A;  3AZH A;  4H9S C;  2BG1 A;  4J8V C;  5G49 B;  3NQU A;  1ZLA C;  2F8N A;  2PYO C;  3B0C W;  3KUY D;  2HUE B;  3WA9 D;  4JJN B;  1EQZ C;  3W97 C;  4Z66 B;  3AYW C;  2Y2N A;  3REH B;  5CPI C;  1JFI B;  1HQ3 D;  1P3K D;  5F99 B;  3AV1 B;  5B2I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...