3UT9C

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9C00
1F66A 3AZHA 1P3AC 5E5AC 4YM6D 2FJ7D 3W98D 2NZDA 5AV9D 3B6GD 3WA9A 3TU4B 3UT9A 4YM6C 3X1VB 2FJ7C 1KX4C 5B31G 3W98C 5AV9C 1P3KD 3W99B 1AOIA 5B1MD 2AROB 3NQJA 3REIA 1P3KC 4HGAC 5CHLB 5B1MC 5B1LA 5BNXB 3AFAD 2F8NH 4NE6A 3A6NB 1M18A 3X1SB 3AFAC 5CPID 3C1BB 3AZJA 1P3PA 5B32A 5GT3B 3WKJC 5CPIC 3W96A 5F99A 4H9QB 3MVDD 3C1CB 4UUZA 3AZND 4H9PB 3LZ1A 3MVDC 1TAFA 5KDMA 2HIOB 3LZ0B 3AZNC 2CV5A 3AZIA 4KUDA 1P3OA 3REHB 4AWLB 3AZMD 3X1UD 3RELA 5AV6A 4WNNB 2YFWB 5C3IC 3AZMC 3X1UC 1ID3D 5B0YD 5CPKD 1B67A 5DNNB 1N1JB 4WU8A 5B40D 2PYOA 4G91B 1ID3C 5B0YC 1M19A 3AZEA 5CPKC 3B6FA 1P3AA 5E5AA 1P3MD 5B40C 4G92C 5B0ZB 5JA4B 3UTAB 3X1TD 3R45B 4WZSB 3LJAD 3KUYD 4Z5TB 1P3MC 4YM6A 2FJ7A 4J8VB 1KX4A 3W98A 5AV9A 5DNMB 3X1TC 3B0DB 3LJAC 3KUYC 1M1AD 1H3OA 3UTBB 1F66D 5AV5B 1P3KA 2BYMA 1U35D 3AV2D 3KXBB 1JFIA 5B1MA 4WU9D 1M1AC 4NE5A 3VH6A 5B31B 1U35C 3AV2C 4WU9C 1AOIB 4KHAA 3O62B 5BO0B 1R4VA 4H9SC 5CP6D 4JJNB 4DRBA 3WKJA 5CP6C 5CPIA 1P3FB 5AVBD 4CSRB 2F8NB 4Z2MH 5AVCB 4H9NB 3MGPB 4H9OB 5AVBC 3MGSB 3MVDA 3AZLB 5B24B 1P3GB 3AZNA 3AN2B 4J8WD 1BH9B 3AYWD 4J8WC 1S32B 3LELD 3AYWC 1P3IB 3VH6T 3AZMA 3X1UA 3AV1B 3REJD 3LELC 3AZKD 2CWEA 3W97B 1ID3A 5B0YA 1P3LB 5CPKA 4Z66B 3REJC 3AZKC 1KX5D 4XUJB 5B40A 1KX5C 1P3MA 1KX3D 3KWQD 4J8XB 2PYOD 3X1TA 1M19D 3KUYA 4YS3D 1KX3C 3B6FD 3KWQC 3AZGD 1P3BD 2PYOC 2YFVA 1M19C 4M6BA 1B6WA 1M1AA 2IO5B 4YS3C 3AZGC 1P3BC 5GT0B 3B6GB 1U35A 3AV2A 5GSUB 1KX4D 4WU9A 3NQUB 5AV8B 2HUEB 3REKD 4HGAB 4H9SA 1ZLAD 5B33B 3AZFD 3MGQD 4J8UD 3REKC 5CP6A 5BNVA 1ZLAC 5GXQB 3AZFC 3MGQC 5G49A 2NQBD 3AFAB 4J8UC 4CAYA 5B2ID 4ZUXD 5FUGB 5AVBA 2NQBC 2BYKA 5B2IC 4ZUXC 2F8NG 4KGCD 3WKJD 1WWSA 2LY8A 4XZQA 2L5AA 4KGCC 1TZYB 5B32G 4J8WA 3X1VD 3W99D 3AYWA 3WAAA 3TU4C 3X1VC 3W99C 4X23B 3LELA 3REJA 3AZKA 1EQZB 3A6ND 3X1SD 5CPJA 1KX5A 4LD9B 3C1BD 3A6NC 3X1SC 1P34B 5GT3D 5AY8A 3MGRB 3C1BC 1KX3A 3KWQA 5JRGA 1WWIA 4H9RB 5GT3C 5B2JD 4QLCB 4YS3A 3C1CD 1HQ3A 3AZGA 1P3BA 5B2JC 3LJAB 3C1CC 3VH5W 3LZ0D 1KU5A 3REHD 1M1AB 3WTPB 1F66B 3LZ0C 3AZHB 3REKA 1ZLAA 2NZDB 3REHC 3WA9B 4AWLC 3AZFA 3MGQA 3UT9B 4J8UA 4E44A 5DNND 4EO5B 3B0CW 2NQBA 3NQJB 5B2IA 4ZUXA 3REIB 5DNNC 4G91C 5B1LB 5B0ZD 1BH8A 3UTAD 4KGCA 4Z5TD 3VH6W 1M18B 2JSSA 5B0ZC 4J8VD 3UTAC 5DNMD 5BT1D 3TU4A 3UTBD 4Z5TC 3X1VA 5AV5D 4J8VC 3AZJB 3V9RA 1P3PB 3W99A 5DNMC 3B0DC 5BT1C 5B32B 4XZQD 3KXBD 2AROA 4E45A 3UTBC 5B31D 3W96B 5AV5C 4XZQC 3KXBC 3B6FC 5F99B 3O62D 3WAAD 5BNXA 5B31C 4UUZB 3LZ1B 3A6NA 4JJND 1TAFB 3X1SA 3WAAC 5KDMB 3O62C 2CV5B 3AZIB 4KUDB 3C1BA 1P3OB 1P3FD 3MNND 4JJNC 3RELB 5GT3A 5AV6B 5CPJD 3MGPD 1P3FC 3MNNC 5B2JA 3MGSD 5CPJC 4H9QA 3MGPC 5B24D 3C1CA 5AY8D 4NFTA 1P3GD 4H9PA 4WU8B 3AN2D 2PYOB 5JRGD 1M19B 3MGSC 3AZEB 5B24C 3B6FB 5AY8C 2HIOA 1P3GC 3LZ0A 1P3AB 5E5AB 3AN2C 1HQ3D 5JRGC 1S32D 3REHA 1P3ID 4R8PD 1HQ3C 4YM6B 3AV1D 3WTPE 4WNNA 1S32C 1KX4B 5AV9B 1P3IC 2FJ7B 3W98B 2YFWA 4R8PC 3W97D 1H3OB 1P3LD 4ZBJC 4Z66D 3AV1C 5DNNA 1P3KB 1N1JA 2BYMB 4XUJD 1JFIB 3W97C 5B1MB 3B0BA 1P3LC 4Z66C 4XUJC 5B0ZA 4KHAB 5JA4A 3UTAA 4J8XD 3R45A 5B2IB 4Z5TA 4J8VA 4J8XC 5DNMA 3WKJB 3UTBA 5CPIB 5AV5A 5GT0D 5GSUD 3KXBA 2IO5C 5B31A 5AV8D 3TU4D 3V9RB 5GT0C 3B6GC 5GSUC 3MVDB 5B33D 3O62A 5AV8C 2AROD 2HUEC 5BO0A 3AZNB 1F1EA 5GXQD 4JJNA 5B33C 2AROC 1P3FA 3MNNA 5GXQC 4CSRA 5C3IB 3X1UB 3AZMB 2F8NA 5AVCA 4H9NA 1HTAA 3MGPA 4H9OA 1ID3B 5B0YB 3MGSA 3AZLA 5CPKB 5B24A 1TZYD 1P3GA 3AN2A 5B40B 4G92B 1BH9A 5B2JB 1A7WA 1TZYC 1P3MB 1S32A 4X23D 2RVQD 4WV4B 1P3IA 3X1TB 4R8PA 3KUYB 2HIOD 3AV1A 4X23C 2RVQC 3KSYA 1EQZD 2YFVB 3W97A 4DRAA 1P3LA 2HIOC 4Z66A 4LD9D 1EQZC 4XUJA 3AV2B 1U35B 3VH5A 4WU9B 5BS7C 1P34D 4LD9C 3MGRD 4J8XA 1P34C 4QLCD 2F8NK 5CP6B 5BNVB 3MGRC 5G49B 4QLCC 4CAYB 4NE3A 5AVBB 5GT0A 3B6GA 5GSUA 2BYKB 3NQUA 3WTPD 5AV8A 3AZHD 4XZQB 2NZDD 4Z2MG 3WA9D 5B33A 3WTPC 1F66C 3AZHC 3UT9D 4J8WB 2NZDC 3AYWB 5GXQA 3WA9C 3WAAB 1AOID 3UT9C 3AFAA 3VH5T 3LELB 5FUGA 1ULYA 3REID 1AOIC 4EO5C 5B1LD 3REJB 3REIC 3AZKB 3MNNB 5B1LC 1M18D 2F8ND 5CPJB 5AVCD 1TZYA 1KX5B 1M18C 3AZJD 1P3PD 5AVCC 5B32D 3B0CT 5AY8B 3AZLD 1KX3B 3W96D 3KWQB 5JRGB 3AZJC 4X23A 1P3PC 5B32C 5F99D 3AZLC 4YS3B 3W96C 1HQ3B 3AZGB 1P3BB 1EQZA 5F99C 4R8PB 3LZ1D 5BS7A 4ZBJB 2CV5D 4LD9A 3AZID 4KUDD 1P3OD 3LZ1C 3RELD 1P34A 2CV5C 5AV6D 3REKB 3AZIC 4KUDC 3MGRA 1P3OC 1ZLAB 3AZFB 3RELC 3MGQB 4H9RA 4QLCA 5AV6C 4J8UB 4WU8D 2NQBB 3LJAA 3AZED 4ZUXB 1Q9CA 1P3AD 5E5AD 4WU8C 1BH8B 3AZEC 1BFMA 3WTPA 4KGCB
chains in the Genus database with same CATH superfamily
1F66A 3AZHA 1P3AC 1Z2CB 5E5AC 4YM6D 2FJ7D 2VQRA 3W98D 2NZDA 5AV9D 3B6GD 3WA9A 2JE5A 3TU4B 3UT9A 4YM6C 3X1VB 2FJ7C 1KX4C 5B31G 3W98C 5AV9C 1P3KD 3W99B 1AOIA 5B1MD 2AROB 3IP4C 3NQJA 3REIA 1P3KC 4HGAC 5CHLB 5B1MC 5B1LA 5BNXB 3AFAD 2F8NH 4NE6A 3A1KA 3A6NB 1M18A 2ZM5A 3X1SB 3AFAC 5CPID 3C1BB 3AZJA 2XD1A 3H0RC 1P3PA 5B32A 5GT3B 3WKJC 5CPIC 3W96A 5F99A 4H9QB 3MVDD 3C1CB 4UUZA 3AZND 4H9PB 3LZ1A 3MVDC 1TAFA 5KDMA 2Y2PA 2HIOB 3EPKA 3LZ0B 3AZNC 2CV5A 3AZIA 4KUDA 1P3OA 3REHB 4AWLB 3AZMD 3X1UD 3RELA 5AV6A 4WNNB 2YFWB 5C3IC 3AZMC 3X1UC 1ID3D 5B0YD 5CPKD 1B67A 5DNNB 1N1JB 4WU8A 5B40D 2PYOA 4G91B 1ID3C 5B0YC 1M19A 3AZEA 5CPKC 3B6FA 1P3AA 5E5AA 1P3MD 5B40C 4G92C 5B0ZB 5JA4B 3UTAB 3X1TD 3R45B 4WZSB 3LJAD 3KUYD 3H0MC 4Z5TB 1P3MC 4YM6A 2FJ7A 4J8VB 1KX4A 3W98A 5AV9A 5DNMB 3X1TC 3B0DB 3LJAC 3KUYC 1M1AD 1H3OA 3UTBB 1F66D 5AV5B 1P3KA 2BYMA 1U35D 3F6TA 3AV2D 3KXBB 1JFIA 5B1MA 4WU9D 1M1AC 4NE5A 3VH6A 5B31B 1U35C 3AV2C 4WU9C 1AOIB 4KHAA 3O62B 5BO0B 1R4VA 4H9SC 5CP6D 4JJNB 4WJ3C 4DRBA 3WKJA 5CP6C 5CPIA 1P3FB 5AVBD 4CSRB 2F8NB 4Z2MH 5AVCB 4H9NB 3MGPB 4H9OB 5AVBC 3MGSB 3MVDA 3AZLB 5B24B 2BG1A 1P3GB 3AZNA 3AN2B 4J8WD 1BH9B 3AYWD 4J8WC 2JCHA 1S32B 3LELD 3AYWC 1P3IB 3VH6T 3AZMA 3X1UA 3AV1B 3EPJA 3REJD 3LELC 3AZKD 2CWEA 3W97B 1ID3A 5B0YA 1P3LB 5CPKA 4Z66B 3REJC 3AZKC 1KX5D 2RIQA 4XUJB 5B40A 1KX5C 1P3MA 1KX3D 3KWQD 4J8XB 2PYOD 3X1TA 1M19D 3KUYA 4YS3D 1KX3C 3B6FD 3KWQC 3AZGD 1P3BD 2PYOC 2YFVA 1M19C 4M6BA 1B6WA 1M1AA 2IO5B 4YS3C 3AZGC 1P3BC 5GT0B 3B6GB 1U35A 3AV2A 5GSUB 1KX4D 4WU9A 3NQUB 5AV8B 2HUEB 3REKD 4HGAB 4H9SA 1ZLAD 5B33B 3AZFD 3MGQD 4J8UD 3REKC 5CP6A 5BNVA 2G5IC 3A1IA 2F2AC 3FDDA 1ZLAC 5GXQB 3AZFC 3MGQC 5G49A 2NQBD 3AFAB 4J8UC 4CAYA 5B2ID 4ZUXD 5FUGB 5AVBA 2NQBC 2BYKA 5B2IC 4ZUXC 2F8NG 4KGCD 3WKJD 1WWSA 2LY8A 3KFUG 4XZQA 2L5AA 4KGCC 1TZYB 5B32G 4J8WA 3X1VD 3W99D 3AYWA 3WAAA 3TU4C 3X1VC 3W99C 4X23B 3LELA 3REJA 3AZKA 1EQZB 3A6ND 3X1SD 5CPJA 2DQNC 1KX5A 4LD9B 3C1BD 3A6NC 3X1SC 1P34B 1W2EA 5GT3D 5AY8A 3MGRB 3C1BC 1KX3A 3KWQA 5JRGA 1WWIA 4H9RB 5GT3C 5B2JD 4QLCB 4YS3A 3C1CD 1HQ3A 3AZGA 1P3BA 5B2JC 3LJAB 3C1CC 3VH5W 3LZ0D 1KU5A 3REHD 1M1AB 3WTPB 1F66B 3LZ0C 3AZHB 3REKA 2G5HC 1ZLAA 2NZDB 3REHC 3WA9B 4AWLC 3AZFA 3MGQA 3UT9B 4J8UA 4E44A 5DNND 4EO5B 3B0CW 2NQBA 3NQJB 5B2IA 4ZUXA 3EPLA 3REIB 5DNNC 4G91C 5B1LB 5B0ZD 1BH8A 3UTAD 3AL0C 4KGCA 4Z5TD 3VH6W 1M18B 2JSSA 5B0ZC 4J8VD 3UTAC 5DNMD 5BT1D 3TU4A 3UTBD 4Z5TC 3X1VA 5AV5D 4J8VC 3AZJB 3V9RA 1P3PB 3W99A 5DNMC 3B0DC 5BT1C 5B32B 4XZQD 3KXBD 2AROA 4E45A 3UTBC 5B31D 3W96B 5AV5C 2ZY4A 4XZQC 3KXBC 3B6FC 5F99B 3O62D 3WAAD 5B31C 2Y2OA 5BNXA 2Y2IA 4UUZB 3LZ1B 3A6NA 4JJND 1TAFB 3X1SA 3WAAC 5KDMB 3O62C 2CV5B 3AZIB 4KUDB 3C1BA 1P3OB 1P3FD 3MNND 4JJNC 3RELB 5GT3A 5AV6B 2ZY2A 5CPJD 3MGPD 1P3FC 3MNNC 3EG5B 5B2JA 2XD5A 3MGSD 4H9QA 5CPJC 3MGPC 2Y2QA 5B24D 5AY8D 3C1CA 4NFTA 1P3GD 4H9PA 4WU8B 3AN2D 2PYOB 5JRGD 1M19B 3MGSC 3AZEB 5B24C 3B6FB 5AY8C 2HIOA 1P3GC 3LZ0A 1P3AB 5E5AB 3AN2C 1HQ3D 5JRGC 1S32D 3REHA 1P3ID 4R8PD 1HQ3C 4YM6B 3AV1D 3WTPE 4WNNA 1S32C 1KX4B 5AV9B 1P3IC 2FJ7B 3W98B 2YFWA 4R8PC 3W97D 1H3OB 1P3LD 4ZBJC 4Z66D 3AV1C 5DNNA 2ZY5A 1N1JA 2BYMB 1P3KB 4XUJD 1JFIB 3W97C 5B1MB 3B0BA 1P3LC 4Z66C 4XUJC 5B0ZA 4KHAB 5JA4A 3UTAA 2FFFB 4J8XD 3R45A 5B2IB 4Z5TA 4J8VA 4J8XC 5DNMA 3WKJB 3UTBA 5CPIB 2Y2NA 5AV5A 5GT0D 5GSUD 3KXBA 2Y2LA 2IO5C 5B31A 5AV8D 3H0LC 3TU4D 3V9RB 5GT0C 3B6GC 5GSUC 3MVDB 5B33D 3O62A 5AV8C 2AROD 2HUEC 5BO0A 3AZNB 1F1EA 5GXQD 4JJNA 5B33C 2AROC 1P3FA 3MNNA 5GXQC 4CSRA 5C3IB 3X1UB 3AZMB 2F8NA 5AVCA 4H9NA 1HTAA 3MGPA 4H9OA 1ID3B 2Y2HA 5B0YB 3MGSA 3AZLA 5CPKB 5B24A 1TZYD 1P3GA 3AN2A 5B40B 4G92B 1BH9A 5B2JB 1A7WA 1TZYC 1P3MB 1S32A 4X23D 2RVQD 4WV4B 1P3IA 3X1TB 3EPHA 4R8PA 3KUYB 2HIOD 2Y2GA 3AV1A 4X23C 2RVQC 3KSYA 1EQZD 2YFVB 3W97A 4DRAA 2UWXA 1P3LA 2HIOC 4Z66A 4LD9D 1EQZC 4XUJA 3AV2B 1U35B 2J8PA 3VH5A 4WU9B 5BS7C 1P34D 4LD9C 3MGRD 4J8XA 1P34C 2ZY3A 4QLCD 2F8NK 5CP6B 5BNVB 3MGRC 5G49B 4QLCC 2Y2KA 4CAYB 4NE3A 5AVBB 5GT0A 3B6GA 5GSUA 2BYKB 3NQUA 3WTPD 5AV8A 3AZHD 4XZQB 2NZDD 1PZRA 4Z2MG 3WA9D 5B33A 3WTPC 1F66C 3AZHC 3UT9D 4J8WB 2NZDC 3AYWB 5GXQA 3WA9C 3WAAB 1AOID 3UT9C 3AFAA 3VH5T 3LELB 5FUGA 1ULYA 3REID 1AOIC 4EO5C 5B1LD 2Y2JA 2W8SA 3REJB 3REIC 3AZKB 3MNNB 5B1LC 1M18D 2F8ND 5CPJB 5AVCD 2DF4C 1TZYA 1KX5B 1M18C 4DQYB 3AZJD 4UPKA 1P3PD 5AVCC 5B32D 3B0CT 5AY8B 3AZLD 1KX3B 3W96D 3KWQB 5JRGB 3AZJC 4X23A 1P3PC 5B32C 5F99D 3AZLC 4YS3B 3W96C 1HQ3B 3AZGB 1P3BB 1EQZA 5F99C 4R8PB 3LZ1D 1T3UA 5BS7A 4ZBJB 2CV5D 4LD9A 3AZID 4KUDD 1P3OD 3LZ1C 3RELD 1P34A 2CV5C 5AV6D 3REKB 3AZIC 4KUDC 3MGRA 1P3OC 1ZLAB 3AZFB 3RELC 3MGQB 4H9RA 2Y2MA 4QLCA 5AV6C 4J8UB 3P5JB 4WU8D 2NQBB 3LJAA 3AZED 4ZUXB 1Q9CA 1P3AD 5E5AD 4WU8C 1BH8B 3AZEC 1BFMA 3WTPA 4KGCB
chains in the Genus database with same CATH topology
1F66A 3AZHA 1P3AC 1Z2CB 5E5AC 4YM6D 2FJ7D 2VQRA 3W98D 2NZDA 5AV9D 3B6GD 3WA9A 2JE5A 3TU4B 3UT9A 4YM6C 3X1VB 2FJ7C 1KX4C 5B31G 3W98C 5AV9C 1P3KD 3W99B 1AOIA 5B1MD 2AROB 3IP4C 3NQJA 3REIA 1P3KC 4HGAC 5CHLB 5B1MC 5B1LA 5BNXB 3AFAD 2F8NH 4NE6A 3A1KA 3A6NB 1M18A 2ZM5A 3X1SB 3AFAC 5CPID 3C1BB 3AZJA 2XD1A 3H0RC 1P3PA 5B32A 5GT3B 3WKJC 5CPIC 3W96A 5F99A 4H9QB 3MVDD 3C1CB 4UUZA 3AZND 4H9PB 3LZ1A 3MVDC 1TAFA 5KDMA 2Y2PA 2HIOB 3EPKA 3LZ0B 3AZNC 2CV5A 3AZIA 4KUDA 1P3OA 3REHB 4AWLB 3AZMD 3X1UD 3RELA 5AV6A 4WNNB 2YFWB 5C3IC 3AZMC 3X1UC 1ID3D 5B0YD 5CPKD 1B67A 5DNNB 1N1JB 4WU8A 5B40D 2PYOA 4G91B 1ID3C 5B0YC 1M19A 3AZEA 5CPKC 3B6FA 1P3AA 5E5AA 1P3MD 5B40C 4G92C 5B0ZB 5JA4B 3UTAB 3X1TD 3R45B 4WZSB 3LJAD 3KUYD 3H0MC 4Z5TB 1P3MC 4YM6A 2FJ7A 4J8VB 1KX4A 3W98A 5AV9A 5DNMB 3X1TC 3B0DB 3LJAC 3KUYC 1M1AD 1H3OA 3UTBB 1F66D 5AV5B 1P3KA 2BYMA 1U35D 3F6TA 3AV2D 3KXBB 1JFIA 5B1MA 4WU9D 1M1AC 4NE5A 3VH6A 5B31B 1U35C 3AV2C 4WU9C 1AOIB 4KHAA 3O62B 5BO0B 1R4VA 4H9SC 5CP6D 4JJNB 4WJ3C 4DRBA 3WKJA 5CP6C 5CPIA 1P3FB 5AVBD 4CSRB 2F8NB 4Z2MH 5AVCB 4H9NB 3MGPB 4H9OB 5AVBC 3MGSB 3MVDA 3AZLB 5B24B 2BG1A 1P3GB 3AZNA 3AN2B 4J8WD 1BH9B 3AYWD 4J8WC 2JCHA 1S32B 3LELD 3AYWC 1P3IB 3VH6T 3AZMA 3X1UA 3AV1B 3EPJA 3REJD 3LELC 3AZKD 2CWEA 3W97B 1ID3A 5B0YA 1P3LB 5CPKA 4Z66B 3REJC 3AZKC 1KX5D 2RIQA 4XUJB 5B40A 1KX5C 1P3MA 1KX3D 3KWQD 4J8XB 2PYOD 3X1TA 1M19D 3KUYA 4YS3D 1KX3C 3B6FD 3KWQC 3AZGD 1P3BD 2PYOC 2YFVA 1M19C 4M6BA 1B6WA 1M1AA 2IO5B 4YS3C 3AZGC 1P3BC 5GT0B 3B6GB 1U35A 3AV2A 5GSUB 1KX4D 4WU9A 3NQUB 5AV8B 2HUEB 3REKD 4HGAB 4H9SA 1ZLAD 5B33B 3AZFD 3MGQD 4J8UD 3REKC 5CP6A 5BNVA 2G5IC 3A1IA 2F2AC 3FDDA 1ZLAC 5GXQB 3AZFC 3MGQC 5G49A 2NQBD 3AFAB 4J8UC 4CAYA 5B2ID 4ZUXD 5FUGB 5AVBA 2NQBC 2BYKA 5B2IC 4ZUXC 2F8NG 4KGCD 3WKJD 1WWSA 2LY8A 3KFUG 4XZQA 2L5AA 4KGCC 1TZYB 5B32G 4J8WA 3X1VD 3W99D 3AYWA 3WAAA 3TU4C 3X1VC 3W99C 4X23B 3LELA 3REJA 3AZKA 1EQZB 3A6ND 3X1SD 5CPJA 2DQNC 1KX5A 4LD9B 3C1BD 3A6NC 3X1SC 1P34B 1W2EA 5GT3D 5AY8A 3MGRB 3C1BC 1KX3A 3KWQA 5JRGA 1WWIA 4H9RB 5GT3C 5B2JD 4QLCB 4YS3A 3C1CD 1HQ3A 3AZGA 1P3BA 5B2JC 3LJAB 3C1CC 3VH5W 3LZ0D 1KU5A 3REHD 1M1AB 3WTPB 1F66B 3LZ0C 3AZHB 3REKA 2G5HC 1ZLAA 2NZDB 3REHC 3WA9B 4AWLC 3AZFA 3MGQA 3UT9B 4J8UA 4E44A 5DNND 4EO5B 3B0CW 2NQBA 3NQJB 5B2IA 4ZUXA 3EPLA 3REIB 5DNNC 4G91C 5B1LB 5B0ZD 1BH8A 3UTAD 3AL0C 4KGCA 4Z5TD 3VH6W 1M18B 2JSSA 5B0ZC 4J8VD 3UTAC 5DNMD 5BT1D 3TU4A 3UTBD 4Z5TC 3X1VA 5AV5D 4J8VC 3AZJB 3V9RA 1P3PB 3W99A 5DNMC 3B0DC 5BT1C 5B32B 4XZQD 3KXBD 2AROA 4E45A 3UTBC 5B31D 3W96B 5AV5C 2ZY4A 4XZQC 3KXBC 3B6FC 5F99B 3O62D 3WAAD 5B31C 2Y2OA 5BNXA 2Y2IA 4UUZB 3LZ1B 3A6NA 4JJND 1TAFB 3X1SA 3WAAC 5KDMB 3O62C 2CV5B 3AZIB 4KUDB 3C1BA 1P3OB 1P3FD 3MNND 4JJNC 3RELB 5GT3A 5AV6B 2ZY2A 5CPJD 3MGPD 1P3FC 3MNNC 3EG5B 5B2JA 2XD5A 3MGSD 4H9QA 5CPJC 3MGPC 2Y2QA 5B24D 5AY8D 3C1CA 4NFTA 1P3GD 4H9PA 4WU8B 3AN2D 2PYOB 5JRGD 1M19B 3MGSC 3AZEB 5B24C 3B6FB 5AY8C 2HIOA 1P3GC 3LZ0A 1P3AB 5E5AB 3AN2C 1HQ3D 5JRGC 1S32D 3REHA 1P3ID 4R8PD 1HQ3C 4YM6B 3AV1D 3WTPE 4WNNA 1S32C 1KX4B 5AV9B 1P3IC 2FJ7B 3W98B 2YFWA 4R8PC 3W97D 1H3OB 1P3LD 4ZBJC 4Z66D 3AV1C 5DNNA 2ZY5A 1N1JA 2BYMB 1P3KB 4XUJD 1JFIB 3W97C 5B1MB 3B0BA 1P3LC 4Z66C 4XUJC 5B0ZA 4KHAB 5JA4A 3UTAA 2FFFB 4J8XD 3R45A 5B2IB 4Z5TA 4J8VA 4J8XC 5DNMA 3WKJB 3UTBA 5CPIB 2Y2NA 5AV5A 5GT0D 5GSUD 3KXBA 2Y2LA 2IO5C 5B31A 5AV8D 3H0LC 3TU4D 3V9RB 5GT0C 3B6GC 5GSUC 3MVDB 5B33D 3O62A 5AV8C 2AROD 2HUEC 5BO0A 3AZNB 1F1EA 5GXQD 4JJNA 5B33C 2AROC 1P3FA 3MNNA 5GXQC 4CSRA 5C3IB 3X1UB 3AZMB 2F8NA 5AVCA 4H9NA 1HTAA 3MGPA 4H9OA 1ID3B 2Y2HA 5B0YB 3MGSA 3AZLA 5CPKB 5B24A 1TZYD 1P3GA 3AN2A 5B40B 4G92B 1BH9A 5B2JB 1A7WA 1TZYC 1P3MB 1S32A 4X23D 2RVQD 4WV4B 1P3IA 3X1TB 3EPHA 4R8PA 3KUYB 2HIOD 2Y2GA 3AV1A 4X23C 2RVQC 3KSYA 1EQZD 2YFVB 3W97A 4DRAA 2UWXA 1P3LA 2HIOC 4Z66A 4LD9D 1EQZC 4XUJA 3AV2B 1U35B 2J8PA 3VH5A 4WU9B 5BS7C 1P34D 4LD9C 3MGRD 4J8XA 1P34C 2ZY3A 4QLCD 2F8NK 5CP6B 5BNVB 3MGRC 5G49B 4QLCC 2Y2KA 4CAYB 4NE3A 5AVBB 5GT0A 3B6GA 5GSUA 2BYKB 3NQUA 3WTPD 5AV8A 3AZHD 4XZQB 2NZDD 1PZRA 4Z2MG 3WA9D 5B33A 3WTPC 1F66C 3AZHC 3UT9D 4J8WB 2NZDC 3AYWB 5GXQA 3WA9C 3WAAB 1AOID 3UT9C 3AFAA 3VH5T 3LELB 5FUGA 1ULYA 3REID 1AOIC 4EO5C 5B1LD 2Y2JA 2W8SA 3REJB 3REIC 3AZKB 3MNNB 5B1LC 1M18D 2F8ND 5CPJB 5AVCD 2DF4C 1TZYA 1KX5B 1M18C 4DQYB 3AZJD 4UPKA 1P3PD 5AVCC 5B32D 3B0CT 5AY8B 3AZLD 1KX3B 3W96D 3KWQB 5JRGB 3AZJC 4X23A 1P3PC 5B32C 5F99D 3AZLC 4YS3B 3W96C 1HQ3B 3AZGB 1P3BB 1EQZA 5F99C 4R8PB 3LZ1D 1T3UA 5BS7A 4ZBJB 2CV5D 4LD9A 3AZID 4KUDD 1P3OD 3LZ1C 3RELD 1P34A 2CV5C 5AV6D 3REKB 3AZIC 4KUDC 3MGRA 1P3OC 1ZLAB 3AZFB 3RELC 3MGQB 4H9RA 2Y2MA 4QLCA 5AV6C 4J8UB 3P5JB 4WU8D 2NQBB 3LJAA 3AZED 4ZUXB 1Q9CA 1P3AD 5E5AD 4WU8C 1BH8B 3AZEC 1BFMA 3WTPA 4KGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 A;  3AZH A;  1P3A C;  5E5A C;  4YM6 D;  2FJ7 D;  3W98 D;  2NZD A;  5AV9 D;  3B6G D;  3WA9 A;  3TU4 B;  3UT9 A;  4YM6 C;  3X1V B;  2FJ7 C;  1KX4 C;  5B31 G;  3W98 C;  5AV9 C;  1P3K D;  3W99 B;  1AOI A;  5B1M D;  2ARO B;  3NQJ A;  3REI A;  1P3K C;  4HGA C;  5CHL B;  5B1M C;  5B1L A;  5BNX B;  3AFA D;  2F8N H;  4NE6 A;  3A6N B;  1M18 A;  3X1S B;  3AFA C;  5CPI D;  3C1B B;  3AZJ A;  1P3P A;  5B32 A;  5GT3 B;  3WKJ C;  5CPI C;  3W96 A;  5F99 A;  4H9Q B;  3MVD D;  3C1C B;  4UUZ A;  3AZN D;  4H9P B;  3LZ1 A;  3MVD C;  1TAF A;  5KDM A;  2HIO B;  3LZ0 B;  3AZN C;  2CV5 A;  3AZI A;  4KUD A;  1P3O A;  3REH B;  4AWL B;  3AZM D;  3X1U D;  3REL A;  5AV6 A;  4WNN B;  2YFW B;  5C3I C;  3AZM C;  3X1U C;  1ID3 D;  5B0Y D;  5CPK D;  1B67 A;  5DNN B;  1N1J B;  4WU8 A;  5B40 D;  2PYO A;  4G91 B;  1ID3 C;  5B0Y C;  1M19 A;  3AZE A;  5CPK C;  3B6F A;  1P3A A;  5E5A A;  1P3M D;  5B40 C;  4G92 C;  5B0Z B;  5JA4 B;  3UTA B;  3X1T D;  3R45 B;  4WZS B;  3LJA D;  3KUY D;  4Z5T B;  1P3M C;  4YM6 A;  2FJ7 A;  4J8V B;  1KX4 A;  3W98 A;  5AV9 A;  5DNM B;  3X1T C;  3B0D B;  3LJA C;  3KUY C;  1M1A D;  1H3O A;  3UTB B;  1F66 D;  5AV5 B;  1P3K A;  2BYM A;  1U35 D;  3AV2 D;  3KXB B;  1JFI A;  5B1M A;  4WU9 D;  1M1A C;  4NE5 A;  3VH6 A;  5B31 B;  1U35 C;  3AV2 C;  4WU9 C;  1AOI B;  4KHA A;  3O62 B;  5BO0 B;  1R4V A;  4H9S C;  5CP6 D;  4JJN B;  4DRB A;  3WKJ A;  5CP6 C;  5CPI A;  1P3F B;  5AVB D;  4CSR B;  2F8N B;  4Z2M H;  5AVC B;  4H9N B;  3MGP B;  4H9O B;  5AVB C;  3MGS B;  3MVD A;  3AZL B;  5B24 B;  1P3G B;  3AZN A;  3AN2 B;  4J8W D;  1BH9 B;  3AYW D;  4J8W C;  1S32 B;  3LEL D;  3AYW C;  1P3I B;  3VH6 T;  3AZM A;  3X1U A;  3AV1 B;  3REJ D;  3LEL C;  3AZK D;  2CWE A;  3W97 B;  1ID3 A;  5B0Y A;  1P3L B;  5CPK A;  4Z66 B;  3REJ C;  3AZK C;  1KX5 D;  4XUJ B;  5B40 A;  1KX5 C;  1P3M A;  1KX3 D;  3KWQ D;  4J8X B;  2PYO D;  3X1T A;  1M19 D;  3KUY A;  4YS3 D;  1KX3 C;  3B6F D;  3KWQ C;  3AZG D;  1P3B D;  2PYO C;  2YFV A;  1M19 C;  4M6B A;  1B6W A;  1M1A A;  2IO5 B;  4YS3 C;  3AZG C;  1P3B C;  5GT0 B;  3B6G B;  1U35 A;  3AV2 A;  5GSU B;  1KX4 D;  4WU9 A;  3NQU B;  5AV8 B;  2HUE B;  3REK D;  4HGA B;  4H9S A;  1ZLA D;  5B33 B;  3AZF D;  3MGQ D;  4J8U D;  3REK C;  5CP6 A;  5BNV A;  1ZLA C;  5GXQ B;  3AZF C;  3MGQ C;  5G49 A;  2NQB D;  3AFA B;  4J8U C;  4CAY A;  5B2I D;  4ZUX D;  5FUG B;  5AVB A;  2NQB C;  2BYK A;  5B2I C;  4ZUX C;  2F8N G;  4KGC D;  3WKJ D;  1WWS A;  2LY8 A;  4XZQ A;  2L5A A;  4KGC C;  1TZY B;  5B32 G;  4J8W A;  3X1V D;  3W99 D;  3AYW A;  3WAA A;  3TU4 C;  3X1V C;  3W99 C;  4X23 B;  3LEL A;  3REJ A;  3AZK A;  1EQZ B;  3A6N D;  3X1S D;  5CPJ A;  1KX5 A;  4LD9 B;  3C1B D;  3A6N C;  3X1S C;  1P34 B;  5GT3 D;  5AY8 A;  3MGR B;  3C1B C;  1KX3 A;  3KWQ A;  5JRG A;  1WWI A;  4H9R B;  5GT3 C;  5B2J D;  4QLC B;  4YS3 A;  3C1C D;  1HQ3 A;  3AZG A;  1P3B A;  5B2J C;  3LJA B;  3C1C C;  3VH5 W;  3LZ0 D;  1KU5 A;  3REH D;  1M1A B;  3WTP B;  1F66 B;  3LZ0 C;  3AZH B;  3REK A;  1ZLA A;  2NZD B;  3REH C;  3WA9 B;  4AWL C;  3AZF A;  3MGQ A;  3UT9 B;  4J8U A;  4E44 A;  5DNN D;  4EO5 B;  3B0C W;  2NQB A;  3NQJ B;  5B2I A;  4ZUX A;  3REI B;  5DNN C;  4G91 C;  5B1L B;  5B0Z D;  1BH8 A;  3UTA D;  4KGC A;  4Z5T D;  3VH6 W;  1M18 B;  2JSS A;  5B0Z C;  4J8V D;  3UTA C;  5DNM D;  5BT1 D;  3TU4 A;  3UTB D;  4Z5T C;  3X1V A;  5AV5 D;  4J8V C;  3AZJ B;  3V9R A;  1P3P B;  3W99 A;  5DNM C;  3B0D C;  5BT1 C;  5B32 B;  4XZQ D;  3KXB D;  2ARO A;  4E45 A;  3UTB C;  5B31 D;  3W96 B;  5AV5 C;  4XZQ C;  3KXB C;  3B6F C;  5F99 B;  3O62 D;  3WAA D;  5BNX A;  5B31 C;  4UUZ B;  3LZ1 B;  3A6N A;  4JJN D;  1TAF B;  3X1S A;  3WAA C;  5KDM B;  3O62 C;  2CV5 B;  3AZI B;  4KUD B;  3C1B A;  1P3O B;  1P3F D;  3MNN D;  4JJN C;  3REL B;  5GT3 A;  5AV6 B;  5CPJ D;  3MGP D;  1P3F C;  3MNN C;  5B2J A;  3MGS D;  5CPJ C;  4H9Q A;  3MGP C;  5B24 D;  3C1C A;  5AY8 D;  4NFT A;  1P3G D;  4H9P A;  4WU8 B;  3AN2 D;  2PYO B;  5JRG D;  1M19 B;  3MGS C;  3AZE B;  5B24 C;  3B6F B;  5AY8 C;  2HIO A;  1P3G C;  3LZ0 A;  1P3A B;  5E5A B;  3AN2 C;  1HQ3 D;  5JRG C;  1S32 D;  3REH A;  1P3I D;  4R8P D;  1HQ3 C;  4YM6 B;  3AV1 D;  3WTP E;  4WNN A;  1S32 C;  1KX4 B;  5AV9 B;  1P3I C;  2FJ7 B;  3W98 B;  2YFW A;  4R8P C;  3W97 D;  1H3O B;  1P3L D;  4ZBJ C;  4Z66 D;  3AV1 C;  5DNN A;  1P3K B;  1N1J A;  2BYM B;  4XUJ D;  1JFI B;  3W97 C;  5B1M B;  3B0B A;  1P3L C;  4Z66 C;  4XUJ C;  5B0Z A;  4KHA B;  5JA4 A;  3UTA A;  4J8X D;  3R45 A;  5B2I B;  4Z5T A;  4J8V A;  4J8X C;  5DNM A;  3WKJ B;  3UTB A;  5CPI B;  5AV5 A;  5GT0 D;  5GSU D;  3KXB A;  2IO5 C;  5B31 A;  5AV8 D;  3TU4 D;  3V9R B;  5GT0 C;  3B6G C;  5GSU C;  3MVD B;  5B33 D;  3O62 A;  5AV8 C;  2ARO D;  2HUE C;  5BO0 A;  3AZN B;  1F1E A;  5GXQ D;  4JJN A;  5B33 C;  2ARO C;  1P3F A;  3MNN A;  5GXQ C;  4CSR A;  5C3I B;  3X1U B;  3AZM B;  2F8N A;  5AVC A;  4H9N A;  1HTA A;  3MGP A;  4H9O A;  1ID3 B;  5B0Y B;  3MGS A;  3AZL A;  5CPK B;  5B24 A;  1TZY D;  1P3G A;  3AN2 A;  5B40 B;  4G92 B;  1BH9 A;  5B2J B;  1A7W A;  1TZY C;  1P3M B;  1S32 A;  4X23 D;  2RVQ D;  4WV4 B;  1P3I A;  3X1T B;  4R8P A;  3KUY B;  2HIO D;  3AV1 A;  4X23 C;  2RVQ C;  3KSY A;  1EQZ D;  2YFV B;  3W97 A;  4DRA A;  1P3L A;  2HIO C;  4Z66 A;  4LD9 D;  1EQZ C;  4XUJ A;  3AV2 B;  1U35 B;  3VH5 A;  4WU9 B;  5BS7 C;  1P34 D;  4LD9 C;  3MGR D;  4J8X A;  1P34 C;  4QLC D;  2F8N K;  5CP6 B;  5BNV B;  3MGR C;  5G49 B;  4QLC C;  4CAY B;  4NE3 A;  5AVB B;  5GT0 A;  3B6G A;  5GSU A;  2BYK B;  3NQU A;  3WTP D;  5AV8 A;  3AZH D;  4XZQ B;  2NZD D;  4Z2M G;  3WA9 D;  5B33 A;  3WTP C;  1F66 C;  3AZH C;  3UT9 D;  4J8W B;  2NZD C;  3AYW B;  5GXQ A;  3WA9 C;  3WAA B;  1AOI D;  3UT9 C;  3AFA A;  3VH5 T;  3LEL B;  5FUG A;  1ULY A;  3REI D;  1AOI C;  4EO5 C;  5B1L D;  3REJ B;  3REI C;  3AZK B;  3MNN B;  5B1L C;  1M18 D;  2F8N D;  5CPJ B;  5AVC D;  1TZY A;  1KX5 B;  1M18 C;  3AZJ D;  1P3P D;  5AVC C;  5B32 D;  3B0C T;  5AY8 B;  3AZL D;  1KX3 B;  3W96 D;  3KWQ B;  5JRG B;  3AZJ C;  4X23 A;  1P3P C;  5B32 C;  5F99 D;  3AZL C;  4YS3 B;  3W96 C;  1HQ3 B;  3AZG B;  1P3B B;  1EQZ A;  5F99 C;  4R8P B;  3LZ1 D;  5BS7 A;  4ZBJ B;  2CV5 D;  4LD9 A;  3AZI D;  4KUD D;  1P3O D;  3LZ1 C;  3REL D;  1P34 A;  2CV5 C;  5AV6 D;  3REK B;  3AZI C;  4KUD C;  3MGR A;  1P3O C;  1ZLA B;  3AZF B;  3REL C;  3MGQ B;  4H9R A;  4QLC A;  5AV6 C;  4J8U B;  4WU8 D;  2NQB B;  3LJA A;  3AZE D;  4ZUX B;  1Q9C A;  1P3A D;  5E5A D;  4WU8 C;  1BH8 B;  3AZE C;  1BFM A;  3WTP A;  4KGC B; 
#chains in the Genus database with same CATH topology
 1F66 A;  3AZH A;  1P3A C;  1Z2C B;  5E5A C;  4YM6 D;  2FJ7 D;  2VQR A;  3W98 D;  2NZD A;  5AV9 D;  3B6G D;  3WA9 A;  2JE5 A;  3TU4 B;  3UT9 A;  4YM6 C;  3X1V B;  2FJ7 C;  1KX4 C;  5B31 G;  3W98 C;  5AV9 C;  1P3K D;  3W99 B;  1AOI A;  5B1M D;  2ARO B;  3IP4 C;  3NQJ A;  3REI A;  1P3K C;  4HGA C;  5CHL B;  5B1M C;  5B1L A;  5BNX B;  3AFA D;  2F8N H;  4NE6 A;  3A1K A;  3A6N B;  1M18 A;  2ZM5 A;  3X1S B;  3AFA C;  5CPI D;  3C1B B;  3AZJ A;  2XD1 A;  3H0R C;  1P3P A;  5B32 A;  5GT3 B;  3WKJ C;  5CPI C;  3W96 A;  5F99 A;  4H9Q B;  3MVD D;  3C1C B;  4UUZ A;  3AZN D;  4H9P B;  3LZ1 A;  3MVD C;  1TAF A;  5KDM A;  2Y2P A;  2HIO B;  3EPK A;  3LZ0 B;  3AZN C;  2CV5 A;  3AZI A;  4KUD A;  1P3O A;  3REH B;  4AWL B;  3AZM D;  3X1U D;  3REL A;  5AV6 A;  4WNN B;  2YFW B;  5C3I C;  3AZM C;  3X1U C;  1ID3 D;  5B0Y D;  5CPK D;  1B67 A;  5DNN B;  1N1J B;  4WU8 A;  5B40 D;  2PYO A;  4G91 B;  1ID3 C;  5B0Y C;  1M19 A;  3AZE A;  5CPK C;  3B6F A;  1P3A A;  5E5A A;  1P3M D;  5B40 C;  4G92 C;  5B0Z B;  5JA4 B;  3UTA B;  3X1T D;  3R45 B;  4WZS B;  3LJA D;  3KUY D;  3H0M C;  4Z5T B;  1P3M C;  4YM6 A;  2FJ7 A;  4J8V B;  1KX4 A;  3W98 A;  5AV9 A;  5DNM B;  3X1T C;  3B0D B;  3LJA C;  3KUY C;  1M1A D;  1H3O A;  3UTB B;  1F66 D;  5AV5 B;  1P3K A;  2BYM A;  1U35 D;  3F6T A;  3AV2 D;  3KXB B;  1JFI A;  5B1M A;  4WU9 D;  1M1A C;  4NE5 A;  3VH6 A;  5B31 B;  1U35 C;  3AV2 C;  4WU9 C;  1AOI B;  4KHA A;  3O62 B;  5BO0 B;  1R4V A;  4H9S C;  5CP6 D;  4JJN B;  4WJ3 C;  4DRB A;  3WKJ A;  5CP6 C;  5CPI A;  1P3F B;  5AVB D;  4CSR B;  2F8N B;  4Z2M H;  5AVC B;  4H9N B;  3MGP B;  4H9O B;  5AVB C;  3MGS B;  3MVD A;  3AZL B;  5B24 B;  2BG1 A;  1P3G B;  3AZN A;  3AN2 B;  4J8W D;  1BH9 B;  3AYW D;  4J8W C;  2JCH A;  1S32 B;  3LEL D;  3AYW C;  1P3I B;  3VH6 T;  3AZM A;  3X1U A;  3AV1 B;  3EPJ A;  3REJ D;  3LEL C;  3AZK D;  2CWE A;  3W97 B;  1ID3 A;  5B0Y A;  1P3L B;  5CPK A;  4Z66 B;  3REJ C;  3AZK C;  1KX5 D;  2RIQ A;  4XUJ B;  5B40 A;  1KX5 C;  1P3M A;  1KX3 D;  3KWQ D;  4J8X B;  2PYO D;  3X1T A;  1M19 D;  3KUY A;  4YS3 D;  1KX3 C;  3B6F D;  3KWQ C;  3AZG D;  1P3B D;  2PYO C;  2YFV A;  1M19 C;  4M6B A;  1B6W A;  1M1A A;  2IO5 B;  4YS3 C;  3AZG C;  1P3B C;  5GT0 B;  3B6G B;  1U35 A;  3AV2 A;  5GSU B;  1KX4 D;  4WU9 A;  3NQU B;  5AV8 B;  2HUE B;  3REK D;  4HGA B;  4H9S A;  1ZLA D;  5B33 B;  3AZF D;  3MGQ D;  4J8U D;  3REK C;  5CP6 A;  5BNV A;  2G5I C;  3A1I A;  2F2A C;  3FDD A;  1ZLA C;  5GXQ B;  3AZF C;  3MGQ C;  5G49 A;  2NQB D;  3AFA B;  4J8U C;  4CAY A;  5B2I D;  4ZUX D;  5FUG B;  5AVB A;  2NQB C;  2BYK A;  5B2I C;  4ZUX C;  2F8N G;  4KGC D;  3WKJ D;  1WWS A;  2LY8 A;  3KFU G;  4XZQ A;  2L5A A;  4KGC C;  1TZY B;  5B32 G;  4J8W A;  3X1V D;  3W99 D;  3AYW A;  3WAA A;  3TU4 C;  3X1V C;  3W99 C;  4X23 B;  3LEL A;  3REJ A;  3AZK A;  1EQZ B;  3A6N D;  3X1S D;  5CPJ A;  2DQN C;  1KX5 A;  4LD9 B;  3C1B D;  3A6N C;  3X1S C;  1P34 B;  1W2E A;  5GT3 D;  5AY8 A;  3MGR B;  3C1B C;  1KX3 A;  3KWQ A;  5JRG A;  1WWI A;  4H9R B;  5GT3 C;  5B2J D;  4QLC B;  4YS3 A;  3C1C D;  1HQ3 A;  3AZG A;  1P3B A;  5B2J C;  3LJA B;  3C1C C;  3VH5 W;  3LZ0 D;  1KU5 A;  3REH D;  1M1A B;  3WTP B;  1F66 B;  3LZ0 C;  3AZH B;  3REK A;  2G5H C;  1ZLA A;  2NZD B;  3REH C;  3WA9 B;  4AWL C;  3AZF A;  3MGQ A;  3UT9 B;  4J8U A;  4E44 A;  5DNN D;  4EO5 B;  3B0C W;  2NQB A;  3NQJ B;  5B2I A;  4ZUX A;  3EPL A;  3REI B;  5DNN C;  4G91 C;  5B1L B;  5B0Z D;  1BH8 A;  3UTA D;  3AL0 C;  4KGC A;  4Z5T D;  3VH6 W;  1M18 B;  2JSS A;  5B0Z C;  4J8V D;  3UTA C;  5DNM D;  5BT1 D;  3TU4 A;  3UTB D;  4Z5T C;  3X1V A;  5AV5 D;  4J8V C;  3AZJ B;  3V9R A;  1P3P B;  3W99 A;  5DNM C;  3B0D C;  5BT1 C;  5B32 B;  4XZQ D;  3KXB D;  2ARO A;  4E45 A;  3UTB C;  5B31 D;  3W96 B;  5AV5 C;  2ZY4 A;  4XZQ C;  3KXB C;  3B6F C;  5F99 B;  3O62 D;  3WAA D;  5B31 C;  2Y2O A;  5BNX A;  2Y2I A;  4UUZ B;  3LZ1 B;  3A6N A;  4JJN D;  1TAF B;  3X1S A;  3WAA C;  5KDM B;  3O62 C;  2CV5 B;  3AZI B;  4KUD B;  3C1B A;  1P3O B;  1P3F D;  3MNN D;  4JJN C;  3REL B;  5GT3 A;  5AV6 B;  2ZY2 A;  5CPJ D;  3MGP D;  1P3F C;  3MNN C;  3EG5 B;  5B2J A;  2XD5 A;  3MGS D;  4H9Q A;  5CPJ C;  3MGP C;  2Y2Q A;  5B24 D;  5AY8 D;  3C1C A;  4NFT A;  1P3G D;  4H9P A;  4WU8 B;  3AN2 D;  2PYO B;  5JRG D;  1M19 B;  3MGS C;  3AZE B;  5B24 C;  3B6F B;  5AY8 C;  2HIO A;  1P3G C;  3LZ0 A;  1P3A B;  5E5A B;  3AN2 C;  1HQ3 D;  5JRG C;  1S32 D;  3REH A;  1P3I D;  4R8P D;  1HQ3 C;  4YM6 B;  3AV1 D;  3WTP E;  4WNN A;  1S32 C;  1KX4 B;  5AV9 B;  1P3I C;  2FJ7 B;  3W98 B;  2YFW A;  4R8P C;  3W97 D;  1H3O B;  1P3L D;  4ZBJ C;  4Z66 D;  3AV1 C;  5DNN A;  2ZY5 A;  1N1J A;  2BYM B;  1P3K B;  4XUJ D;  1JFI B;  3W97 C;  5B1M B;  3B0B A;  1P3L C;  4Z66 C;  4XUJ C;  5B0Z A;  4KHA B;  5JA4 A;  3UTA A;  2FFF B;  4J8X D;  3R45 A;  5B2I B;  4Z5T A;  4J8V A;  4J8X C;  5DNM A;  3WKJ B;  3UTB A;  5CPI B;  2Y2N A;  5AV5 A;  5GT0 D;  5GSU D;  3KXB A;  2Y2L A;  2IO5 C;  5B31 A;  5AV8 D;  3H0L C;  3TU4 D;  3V9R B;  5GT0 C;  3B6G C;  5GSU C;  3MVD B;  5B33 D;  3O62 A;  5AV8 C;  2ARO D;  2HUE C;  5BO0 A;  3AZN B;  1F1E A;  5GXQ D;  4JJN A;  5B33 C;  2ARO C;  1P3F A;  3MNN A;  5GXQ C;  4CSR A;  5C3I B;  3X1U B;  3AZM B;  2F8N A;  5AVC A;  4H9N A;  1HTA A;  3MGP A;  4H9O A;  1ID3 B;  2Y2H A;  5B0Y B;  3MGS A;  3AZL A;  5CPK B;  5B24 A;  1TZY D;  1P3G A;  3AN2 A;  5B40 B;  4G92 B;  1BH9 A;  5B2J B;  1A7W A;  1TZY C;  1P3M B;  1S32 A;  4X23 D;  2RVQ D;  4WV4 B;  1P3I A;  3X1T B;  3EPH A;  4R8P A;  3KUY B;  2HIO D;  2Y2G A;  3AV1 A;  4X23 C;  2RVQ C;  3KSY A;  1EQZ D;  2YFV B;  3W97 A;  4DRA A;  2UWX A;  1P3L A;  2HIO C;  4Z66 A;  4LD9 D;  1EQZ C;  4XUJ A;  3AV2 B;  1U35 B;  2J8P A;  3VH5 A;  4WU9 B;  5BS7 C;  1P34 D;  4LD9 C;  3MGR D;  4J8X A;  1P34 C;  2ZY3 A;  4QLC D;  2F8N K;  5CP6 B;  5BNV B;  3MGR C;  5G49 B;  4QLC C;  2Y2K A;  4CAY B;  4NE3 A;  5AVB B;  5GT0 A;  3B6G A;  5GSU A;  2BYK B;  3NQU A;  3WTP D;  5AV8 A;  3AZH D;  4XZQ B;  2NZD D;  1PZR A;  4Z2M G;  3WA9 D;  5B33 A;  3WTP C;  1F66 C;  3AZH C;  3UT9 D;  4J8W B;  2NZD C;  3AYW B;  5GXQ A;  3WA9 C;  3WAA B;  1AOI D;  3UT9 C;  3AFA A;  3VH5 T;  3LEL B;  5FUG A;  1ULY A;  3REI D;  1AOI C;  4EO5 C;  5B1L D;  2Y2J A;  2W8S A;  3REJ B;  3REI C;  3AZK B;  3MNN B;  5B1L C;  1M18 D;  2F8N D;  5CPJ B;  5AVC D;  2DF4 C;  1TZY A;  1KX5 B;  1M18 C;  4DQY B;  3AZJ D;  4UPK A;  1P3P D;  5AVC C;  5B32 D;  3B0C T;  5AY8 B;  3AZL D;  1KX3 B;  3W96 D;  3KWQ B;  5JRG B;  3AZJ C;  4X23 A;  1P3P C;  5B32 C;  5F99 D;  3AZL C;  4YS3 B;  3W96 C;  1HQ3 B;  3AZG B;  1P3B B;  1EQZ A;  5F99 C;  4R8P B;  3LZ1 D;  1T3U A;  5BS7 A;  4ZBJ B;  2CV5 D;  4LD9 A;  3AZI D;  4KUD D;  1P3O D;  3LZ1 C;  3REL D;  1P34 A;  2CV5 C;  5AV6 D;  3REK B;  3AZI C;  4KUD C;  3MGR A;  1P3O C;  1ZLA B;  3AZF B;  3REL C;  3MGQ B;  4H9R A;  2Y2M A;  4QLC A;  5AV6 C;  4J8U B;  3P5J B;  4WU8 D;  2NQB B;  3LJA A;  3AZE D;  4ZUX B;  1Q9C A;  1P3A D;  5E5A D;  4WU8 C;  1BH8 B;  3AZE C;  1BFM A;  3WTP A;  4KGC B; 
#chains in the Genus database with same CATH homology
 1F66 A;  3AZH A;  1P3A C;  1Z2C B;  5E5A C;  4YM6 D;  2FJ7 D;  2VQR A;  3W98 D;  2NZD A;  5AV9 D;  3B6G D;  3WA9 A;  2JE5 A;  3TU4 B;  3UT9 A;  4YM6 C;  3X1V B;  2FJ7 C;  1KX4 C;  5B31 G;  3W98 C;  5AV9 C;  1P3K D;  3W99 B;  1AOI A;  5B1M D;  2ARO B;  3IP4 C;  3NQJ A;  3REI A;  1P3K C;  4HGA C;  5CHL B;  5B1M C;  5B1L A;  5BNX B;  3AFA D;  2F8N H;  4NE6 A;  3A1K A;  3A6N B;  1M18 A;  2ZM5 A;  3X1S B;  3AFA C;  5CPI D;  3C1B B;  3AZJ A;  2XD1 A;  3H0R C;  1P3P A;  5B32 A;  5GT3 B;  3WKJ C;  5CPI C;  3W96 A;  5F99 A;  4H9Q B;  3MVD D;  3C1C B;  4UUZ A;  3AZN D;  4H9P B;  3LZ1 A;  3MVD C;  1TAF A;  5KDM A;  2Y2P A;  2HIO B;  3EPK A;  3LZ0 B;  3AZN C;  2CV5 A;  3AZI A;  4KUD A;  1P3O A;  3REH B;  4AWL B;  3AZM D;  3X1U D;  3REL A;  5AV6 A;  4WNN B;  2YFW B;  5C3I C;  3AZM C;  3X1U C;  1ID3 D;  5B0Y D;  5CPK D;  1B67 A;  5DNN B;  1N1J B;  4WU8 A;  5B40 D;  2PYO A;  4G91 B;  1ID3 C;  5B0Y C;  1M19 A;  3AZE A;  5CPK C;  3B6F A;  1P3A A;  5E5A A;  1P3M D;  5B40 C;  4G92 C;  5B0Z B;  5JA4 B;  3UTA B;  3X1T D;  3R45 B;  4WZS B;  3LJA D;  3KUY D;  3H0M C;  4Z5T B;  1P3M C;  4YM6 A;  2FJ7 A;  4J8V B;  1KX4 A;  3W98 A;  5AV9 A;  5DNM B;  3X1T C;  3B0D B;  3LJA C;  3KUY C;  1M1A D;  1H3O A;  3UTB B;  1F66 D;  5AV5 B;  1P3K A;  2BYM A;  1U35 D;  3F6T A;  3AV2 D;  3KXB B;  1JFI A;  5B1M A;  4WU9 D;  1M1A C;  4NE5 A;  3VH6 A;  5B31 B;  1U35 C;  3AV2 C;  4WU9 C;  1AOI B;  4KHA A;  3O62 B;  5BO0 B;  1R4V A;  4H9S C;  5CP6 D;  4JJN B;  4WJ3 C;  4DRB A;  3WKJ A;  5CP6 C;  5CPI A;  1P3F B;  5AVB D;  4CSR B;  2F8N B;  4Z2M H;  5AVC B;  4H9N B;  3MGP B;  4H9O B;  5AVB C;  3MGS B;  3MVD A;  3AZL B;  5B24 B;  2BG1 A;  1P3G B;  3AZN A;  3AN2 B;  4J8W D;  1BH9 B;  3AYW D;  4J8W C;  2JCH A;  1S32 B;  3LEL D;  3AYW C;  1P3I B;  3VH6 T;  3AZM A;  3X1U A;  3AV1 B;  3EPJ A;  3REJ D;  3LEL C;  3AZK D;  2CWE A;  3W97 B;  1ID3 A;  5B0Y A;  1P3L B;  5CPK A;  4Z66 B;  3REJ C;  3AZK C;  1KX5 D;  2RIQ A;  4XUJ B;  5B40 A;  1KX5 C;  1P3M A;  1KX3 D;  3KWQ D;  4J8X B;  2PYO D;  3X1T A;  1M19 D;  3KUY A;  4YS3 D;  1KX3 C;  3B6F D;  3KWQ C;  3AZG D;  1P3B D;  2PYO C;  2YFV A;  1M19 C;  4M6B A;  1B6W A;  1M1A A;  2IO5 B;  4YS3 C;  3AZG C;  1P3B C;  5GT0 B;  3B6G B;  1U35 A;  3AV2 A;  5GSU B;  1KX4 D;  4WU9 A;  3NQU B;  5AV8 B;  2HUE B;  3REK D;  4HGA B;  4H9S A;  1ZLA D;  5B33 B;  3AZF D;  3MGQ D;  4J8U D;  3REK C;  5CP6 A;  5BNV A;  2G5I C;  3A1I A;  2F2A C;  3FDD A;  1ZLA C;  5GXQ B;  3AZF C;  3MGQ C;  5G49 A;  2NQB D;  3AFA B;  4J8U C;  4CAY A;  5B2I D;  4ZUX D;  5FUG B;  5AVB A;  2NQB C;  2BYK A;  5B2I C;  4ZUX C;  2F8N G;  4KGC D;  3WKJ D;  1WWS A;  2LY8 A;  3KFU G;  4XZQ A;  2L5A A;  4KGC C;  1TZY B;  5B32 G;  4J8W A;  3X1V D;  3W99 D;  3AYW A;  3WAA A;  3TU4 C;  3X1V C;  3W99 C;  4X23 B;  3LEL A;  3REJ A;  3AZK A;  1EQZ B;  3A6N D;  3X1S D;  5CPJ A;  2DQN C;  1KX5 A;  4LD9 B;  3C1B D;  3A6N C;  3X1S C;  1P34 B;  1W2E A;  5GT3 D;  5AY8 A;  3MGR B;  3C1B C;  1KX3 A;  3KWQ A;  5JRG A;  1WWI A;  4H9R B;  5GT3 C;  5B2J D;  4QLC B;  4YS3 A;  3C1C D;  1HQ3 A;  3AZG A;  1P3B A;  5B2J C;  3LJA B;  3C1C C;  3VH5 W;  3LZ0 D;  1KU5 A;  3REH D;  1M1A B;  3WTP B;  1F66 B;  3LZ0 C;  3AZH B;  3REK A;  2G5H C;  1ZLA A;  2NZD B;  3REH C;  3WA9 B;  4AWL C;  3AZF A;  3MGQ A;  3UT9 B;  4J8U A;  4E44 A;  5DNN D;  4EO5 B;  3B0C W;  2NQB A;  3NQJ B;  5B2I A;  4ZUX A;  3EPL A;  3REI B;  5DNN C;  4G91 C;  5B1L B;  5B0Z D;  1BH8 A;  3UTA D;  3AL0 C;  4KGC A;  4Z5T D;  3VH6 W;  1M18 B;  2JSS A;  5B0Z C;  4J8V D;  3UTA C;  5DNM D;  5BT1 D;  3TU4 A;  3UTB D;  4Z5T C;  3X1V A;  5AV5 D;  4J8V C;  3AZJ B;  3V9R A;  1P3P B;  3W99 A;  5DNM C;  3B0D C;  5BT1 C;  5B32 B;  4XZQ D;  3KXB D;  2ARO A;  4E45 A;  3UTB C;  5B31 D;  3W96 B;  5AV5 C;  2ZY4 A;  4XZQ C;  3KXB C;  3B6F C;  5F99 B;  3O62 D;  3WAA D;  5B31 C;  2Y2O A;  5BNX A;  2Y2I A;  4UUZ B;  3LZ1 B;  3A6N A;  4JJN D;  1TAF B;  3X1S A;  3WAA C;  5KDM B;  3O62 C;  2CV5 B;  3AZI B;  4KUD B;  3C1B A;  1P3O B;  1P3F D;  3MNN D;  4JJN C;  3REL B;  5GT3 A;  5AV6 B;  2ZY2 A;  5CPJ D;  3MGP D;  1P3F C;  3MNN C;  3EG5 B;  5B2J A;  2XD5 A;  3MGS D;  4H9Q A;  5CPJ C;  3MGP C;  2Y2Q A;  5B24 D;  5AY8 D;  3C1C A;  4NFT A;  1P3G D;  4H9P A;  4WU8 B;  3AN2 D;  2PYO B;  5JRG D;  1M19 B;  3MGS C;  3AZE B;  5B24 C;  3B6F B;  5AY8 C;  2HIO A;  1P3G C;  3LZ0 A;  1P3A B;  5E5A B;  3AN2 C;  1HQ3 D;  5JRG C;  1S32 D;  3REH A;  1P3I D;  4R8P D;  1HQ3 C;  4YM6 B;  3AV1 D;  3WTP E;  4WNN A;  1S32 C;  1KX4 B;  5AV9 B;  1P3I C;  2FJ7 B;  3W98 B;  2YFW A;  4R8P C;  3W97 D;  1H3O B;  1P3L D;  4ZBJ C;  4Z66 D;  3AV1 C;  5DNN A;  2ZY5 A;  1N1J A;  2BYM B;  1P3K B;  4XUJ D;  1JFI B;  3W97 C;  5B1M B;  3B0B A;  1P3L C;  4Z66 C;  4XUJ C;  5B0Z A;  4KHA B;  5JA4 A;  3UTA A;  2FFF B;  4J8X D;  3R45 A;  5B2I B;  4Z5T A;  4J8V A;  4J8X C;  5DNM A;  3WKJ B;  3UTB A;  5CPI B;  2Y2N A;  5AV5 A;  5GT0 D;  5GSU D;  3KXB A;  2Y2L A;  2IO5 C;  5B31 A;  5AV8 D;  3H0L C;  3TU4 D;  3V9R B;  5GT0 C;  3B6G C;  5GSU C;  3MVD B;  5B33 D;  3O62 A;  5AV8 C;  2ARO D;  2HUE C;  5BO0 A;  3AZN B;  1F1E A;  5GXQ D;  4JJN A;  5B33 C;  2ARO C;  1P3F A;  3MNN A;  5GXQ C;  4CSR A;  5C3I B;  3X1U B;  3AZM B;  2F8N A;  5AVC A;  4H9N A;  1HTA A;  3MGP A;  4H9O A;  1ID3 B;  2Y2H A;  5B0Y B;  3MGS A;  3AZL A;  5CPK B;  5B24 A;  1TZY D;  1P3G A;  3AN2 A;  5B40 B;  4G92 B;  1BH9 A;  5B2J B;  1A7W A;  1TZY C;  1P3M B;  1S32 A;  4X23 D;  2RVQ D;  4WV4 B;  1P3I A;  3X1T B;  3EPH A;  4R8P A;  3KUY B;  2HIO D;  2Y2G A;  3AV1 A;  4X23 C;  2RVQ C;  3KSY A;  1EQZ D;  2YFV B;  3W97 A;  4DRA A;  2UWX A;  1P3L A;  2HIO C;  4Z66 A;  4LD9 D;  1EQZ C;  4XUJ A;  3AV2 B;  1U35 B;  2J8P A;  3VH5 A;  4WU9 B;  5BS7 C;  1P34 D;  4LD9 C;  3MGR D;  4J8X A;  1P34 C;  2ZY3 A;  4QLC D;  2F8N K;  5CP6 B;  5BNV B;  3MGR C;  5G49 B;  4QLC C;  2Y2K A;  4CAY B;  4NE3 A;  5AVB B;  5GT0 A;  3B6G A;  5GSU A;  2BYK B;  3NQU A;  3WTP D;  5AV8 A;  3AZH D;  4XZQ B;  2NZD D;  1PZR A;  4Z2M G;  3WA9 D;  5B33 A;  3WTP C;  1F66 C;  3AZH C;  3UT9 D;  4J8W B;  2NZD C;  3AYW B;  5GXQ A;  3WA9 C;  3WAA B;  1AOI D;  3UT9 C;  3AFA A;  3VH5 T;  3LEL B;  5FUG A;  1ULY A;  3REI D;  1AOI C;  4EO5 C;  5B1L D;  2Y2J A;  2W8S A;  3REJ B;  3REI C;  3AZK B;  3MNN B;  5B1L C;  1M18 D;  2F8N D;  5CPJ B;  5AVC D;  2DF4 C;  1TZY A;  1KX5 B;  1M18 C;  4DQY B;  3AZJ D;  4UPK A;  1P3P D;  5AVC C;  5B32 D;  3B0C T;  5AY8 B;  3AZL D;  1KX3 B;  3W96 D;  3KWQ B;  5JRG B;  3AZJ C;  4X23 A;  1P3P C;  5B32 C;  5F99 D;  3AZL C;  4YS3 B;  3W96 C;  1HQ3 B;  3AZG B;  1P3B B;  1EQZ A;  5F99 C;  4R8P B;  3LZ1 D;  1T3U A;  5BS7 A;  4ZBJ B;  2CV5 D;  4LD9 A;  3AZI D;  4KUD D;  1P3O D;  3LZ1 C;  3REL D;  1P34 A;  2CV5 C;  5AV6 D;  3REK B;  3AZI C;  4KUD C;  3MGR A;  1P3O C;  1ZLA B;  3AZF B;  3REL C;  3MGQ B;  4H9R A;  2Y2M A;  4QLC A;  5AV6 C;  4J8U B;  3P5J B;  4WU8 D;  2NQB B;  3LJA A;  3AZE D;  4ZUX B;  1Q9C A;  1P3A D;  5E5A D;  4WU8 C;  1BH8 B;  3AZE C;  1BFM A;  3WTP A;  4KGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...