3UT9C

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9C00
3MGPA 1ID3D 4QLCA 4R8PD 3MVDC 3C1CD 4YS3D 1KX5A 5GSUD 3W97B 3KXBD 3AZIB 4KGCC 5CPKC 2AROB 5AV6A 4JJNB 3KUYA 2PYOA 1BFMA 1P3LA 3X1VA 4WU9D 5GSUA 5BS7A 3AN2C 1ZLAB 1S32D 5B0YC 1P3IA 3REHC 4CAYB 5JRGB 5F99B 5DNMC 5B40D 3AZLC 1HTAA 4LD9D 5GXQC 5CPJC 2BYMA 3B0DB 1F1EA 3KSYA 5B2IA 4H9NB 3LJAA 4J8XC 2NQBA 3V9RB 5AV8B 1P3PC 3X1TD 4E44A 2YFVB 5AV8A 4WU8B 3REJB 3AZHC 4YM6C 2NZDA 5E5AA 5AV6C 5B2IB 4EO5C 1JFIA 3UTBD 3REJA 5B24B 5B31D 3AZGD 3AZGC 1P3OD 4ZUXC 1P34C 3AV2C 5B32A 4J8UC 3AYWB 3VH5T 1U35C 3WKJC 5F99A 5DNND 3X1TC 3X1VB 5B2JD 3UTAC 1F66D 4J8XD 1ZLAA 3AZFC 3AFAC 1P3KD 2FJ7A 1P3PA 3VH6T 5B1LD 3TU4D 1P3LB 1AOIB 3AV1D 4ZBJB 2IO5B 3W99B 3REHD 5B2ID 1M19A 2IO5C 3WAAC 3AZGA 3AZMA 3A6NC 5BNXA 3AFAB 3NQJB 1P34A 5BS7C 1P3ID 4Z66A 3REHA 3UTAB 5AVBA 3X1VC 5AVBB 3WKJB 4WV4B 2CV5D 4H9PA 2F8NA 1P34B 5B0YA 4CSRA 3X1UD 3AZGB 1ULYA 1P3KB 1TZYA 3B0CT 1B6WA 3WTPE 3W99A 5B2IC 4KUDA 3AZED 3UT9C 3WA9B 3REJC 1P3PB 5AV8C 1R4VA 3MGQA 5B0ZD 3LZ0D 3AZFD 3LZ1D 4KHAB 3B6FD 3KWQA 4DRAA 4Z5TD 3NQJA 4G92C 5DNMB 3AZLB 5JRGC 4Z66D 5B2JC 1P34D 1EQZD 3AN2B 3O62B 3AZFA 5C3IB 5JA4A 1ID3A 4JJND 4JJNC 2AROC 5CPKB 1KX4A 4NE5A 3AZIC 3W97C 4KGCB 4J8VA 2NQBB 3NQUB 3REIB 3AZHD 1P3MA 3LELD 1F66A 5AV6D 3MVDB 3LZ1B 5B0ZB 5G49A 3RELD 4CAYA 3B6FB 3MGSC 1P3AB 4WNNA 3C1BD 1S32C 1EQZB 1H3OA 3AZEC 4R8PA 4QLCC 3KWQB 4R8PB 5GT3D 3C1CA 3C1CB 3KUYB 2PYOB 4H9SA 5B40C 4YS3B 5CP6B 4LD9C 1KX4C 3X1UC 1P3BA 1BH8A 3WTPD 5BT1C 1TZYC 5AVBD 3KXBC 4KGCD 2CV5B 2HUEC 1P3MB 2FJ7D 4M6BA 5CPKD 5BO0B 3W96D 3MGPB 3RELB 5B1MD 3A6ND 5JRGD 1P3IC 4H9PB 1HQ3B 4G91C 3LELB 3X1SC 4Z5TC 3UTAA 4WU9B 1ID3C 3AV1B 4J8WA 5BNXB 3AFAA 1KX3D 1KX3C 3REKB 4J8XA 1ZLAD 2LY8A 4Z2MH 5E5AD 4NE3A 3X1SD 2F8NG 5AV9C 3MGQB 1F66C 4J8UD 2FJ7B 3WA9A 1P3FB 2F8NK 3MNNB 5B31B 5CP6A 4ZUXA 5B24D 3AZNC 1M18D 3X1TA 4XZQD 5DNNB 2NQBD 4J8WB 3B6FA 5AV9D 5AVCD 3AZKB 2YFWB 1HQ3D 5B0ZA 3WAAD 5B1MB 4H9SC 5B40A 4LD9A 3REIA 1P3GA 5E5AB 3NQUA 1KX5C 1KX5D 3REKD 3W99D 4X23D 1M1AC 1WWSA 3AZMC 4XUJB 5B1LB 1P3LD 5DNMD 3AZLD 1AOID 3UTAD 2BYMB 5GT0B 2HIOD 2F8NH 1BH8B 3AZJC 2F8ND 1P3BB 5JRGA 3AN2A 3AV2D 3W97D 1M18C 3MGRC 5CPIB 3MGRD 1P3OC 4YS3A 5GSUB 5KDMA 3W96A 5AVCB 4J8WD 5AY8C 4NFTA 1H3OB 3AZJD 4HGAC 3AZIA 3C1BC 3W98B 3MGSB 5G49B 4KUDB 5B24A 1M1AD 3B6GD 5FUGA 5CPJD 3WA9D 1P3KA 4KUDC 2NZDB 4NE6A 4Z2MG 3C1BB 3W98C 4J8VB 4KGCA 3V9RA 4HGAB 1N1JB 5F99D 2F8NB 3B6GA 1TAFB 4H9QB 2JSSA 2HIOA 5GT0D 4X23B 5AVCC 1BH9B 4Z66B 4XUJD 4AWLC 3VH5W 5GT3A 5CPIC 3MGRB 5DNNA 1P3BC 4UUZB 3O62D 1Q9CA 3WTPC 4KHAA 1M19B 4XZQB 4XUJC 1P3GC 1P3FA 1M1AB 3LZ0C 5AV5C 1KX5B 5E5AC 4XZQA 3MGRA 2CWEA 3MGSD 3AV2A 3KWQD 1S32A 3VH6A 5B32B 3TU4C 3AYWA 3B6GB 5GT3B 1P3GD 4WZSB 1BH9A 3W96C 1P3AD 2HIOB 3C1BA 5GXQA 5AV9A 5BT1D 5FUGB 1P3FC 3RELA 2FJ7C 3LJAC 3UTBB 3WAAA 3LZ0A 5B33B 5BO0A 5B33C 3MGQC 4H9NA 3LJAB 3UTBC 3AZHA 3R45A 2CV5A 3MGPD 2RVQC 3W98A 3AZKD 2HIOC 3W96B 3AV1C 5GT3C 3B6GC 3AZMD 4Z5TB 5B32C 4J8UA 3TU4B 5AVCA 5KDMB 3LELC 1WWIA 1EQZA 4WNNB 2RVQD 5CPIA 3RELC 3MGPC 1KU5A 5AV5B 3LZ0B 3LZ1A 5GT0A 5CP6D 1JFIB 2HUEB 1P3MC 3MGQD 3KXBB 3AZID 4XZQC 1P3GB 4XUJA 1M19D 3AZJA 3WTPB 2YFVA 4WU8A 1M19C 3X1UB 5CPKA 1KX4B 2YFWA 1P3OA 3A6NA 5CP6C 4YS3C 5B40B 1P3FD 4LD9B 4R8PC 3C1CC 4AWLB 4H9OB 5AY8A 4Z66C 4YM6D 1S32B 3AZKA 1EQZC 4X23C 3O62A 5CPJA 1P3AC 3B6FC 5AV8D 3MNNA 5B0ZC 3LZ1C 4J8VC 4E45A 4YM6A 4JJNA 2NZDC 3UT9D 3REIC 5B31A 4H9RB 2NQBC 3W97A 3AN2D 4UUZA 3AV1A 4WU9A 3X1VD 1U35A 5C3IC 5AY8B 4X23A 3O62C 3REKA 3LELA 5BNVA 5GSUC 1P3MD 5B2JB 3MGSA 1P3OB 1N1JA 2L5AA 5CPID 4G92B 3AZEA 3WKJA 1M18B 3AZJB 1HQ3A 4DRBA 1KX4D 5GT0C 3REID 2BYKA 5B1LC 4QLCD 3UT9B 3WA9C 3AZMB 5AV5A 5GXQD 4H9RA 5AV5D 3AFAD 1P3KC 5B1MC 1AOIA 4Z5TA 4ZUXD 3AZKC 1B67A 3B0CW 1U35D 4J8WC 3X1SA 5B33D 5DNNC 3WKJD 1TZYD 5AVBC 1P3AA 2AROD 3MVDA 3AZNB 1KX3A 3R45B 3A6NB 5B1LA 1P3PD 5B31C 3MNNC 3UT9A 3WAAB 3X1UA 3AYWD 1F66B 3WTPA 3W99C 5AV9B 4ZBJC 3KXBA 5B1MA 1AOIC 1P3LC 5B32D 4KUDD 3AZFB 3REKC 1KX3B 3AZNA 3VH6W 1A7WA 4WU9C 3REJD 3MNND 3X1TB 1ID3B 5JA4B 1U35B 4J8UB 3TU4A 3AYWC 3AV2B 5B0YD 4ZUXB 1HQ3C 4G91B 3B0BA 3X1SB 4WU8D 1P3IB 5AY8D 5DNMA 3AZLA 5B24C 3AZND 1P3BD 3LJAD 1M1AA 4EO5B 2AROA 5AV6B 3MVDD 4YM6B 5B32G 2CV5C 3AZHB 4WU8C 1TZYB 5B33A 3UTBA 4J8XB 3VH5A 3B0DC 5CHLB 2BYKB 4CSRB 5CPJB 5GXQB 2NZDD 3KUYD 2PYOD 3KUYC 2PYOC 5F99C 4H9OA 3KWQC 4QLCB 4J8VD 1M18A 3AZEB 1TAFA 4H9QA 3REHB 5B0YB 3W98D 1ZLAC 5B31G 5B2JA 5BNVB
chains in the Genus database with same CATH superfamily
3MGPA 1ID3D 4QLCA 3F6TA 4R8PD 3MVDC 3C1CD 4YS3D 1KX5A 5GSUD 3W97B 3KXBD 3AZIB 4KGCC 5CPKC 2AROB 3A1KA 5AV6A 4JJNB 3KUYA 2PYOA 1BFMA 1P3LA 3X1VA 4WU9D 5GSUA 5BS7A 3AN2C 1ZLAB 1S32D 5B0YC 1P3IA 3REHC 3H0RC 4CAYB 5JRGB 5F99B 5DNMC 5B40D 3AZLC 1HTAA 4LD9D 3EPHA 5GXQC 5CPJC 2BYMA 3B0DB 1F1EA 3KSYA 5B2IA 4H9NB 3LJAA 4J8XC 2NQBA 3H0MC 3V9RB 5AV8B 1P3PC 3X1TD 5AV8A 2YFVB 4E44A 4WU8B 3REJB 3AZHC 4YM6C 2NZDA 2JE5A 5E5AA 5AV6C 5B2IB 4EO5C 1JFIA 3UTBD 3REJA 5B24B 5B31D 3AZGD 3AZGC 1P3OD 2Y2LA 4ZUXC 1P34C 3AV2C 5B32A 4J8UC 3AYWB 3VH5T 1U35C 3WKJC 5F99A 5DNND 3X1TC 3X1VB 3FDDA 5B2JD 1W2EA 3UTAC 1F66D 4J8XD 1ZLAA 3AZFC 3AFAC 1P3KD 2FJ7A 1P3PA 3VH6T 5B1LD 3TU4D 1P3LB 1AOIB 3AV1D 4ZBJB 2IO5B 3W99B 3REHD 5B2ID 1M19A 2IO5C 3WAAC 3AZGA 3AZMA 3A6NC 5BNXA 3AFAB 3NQJB 1P34A 5BS7C 1P3ID 4Z66A 3REHA 3UTAB 5AVBA 3X1VC 5AVBB 3WKJB 4WV4B 2CV5D 4H9PA 2F8NA 1P34B 5B0YA 4CSRA 3X1UD 2ZY5A 3AZGB 1ULYA 1P3KB 4WJ3C 1TZYA 3B0CT 1B6WA 3WTPE 3W99A 5B2IC 4KUDA 3AZED 3UT9C 3WA9B 3REJC 1P3PB 5AV8C 1R4VA 3AL0C 3MGQA 5B0ZD 3LZ0D 3AZFD 3LZ1D 4KHAB 3B6FD 3KWQA 4DRAA 4Z5TD 3NQJA 2DF4C 4G92C 5DNMB 3AZLB 5JRGC 2Y2QA 4Z66D 5B2JC 1P34D 1EQZD 3AN2B 3O62B 3AZFA 5C3IB 5JA4A 1ID3A 4JJND 3P5JB 4JJNC 2RIQA 2AROC 2XD5A 5CPKB 1KX4A 4NE5A 3AZIC 3W97C 4KGCB 4J8VA 2NQBB 3EPLA 3NQUB 3REIB 1Z2CB 3AZHD 1P3MA 3LELD 1F66A 5AV6D 3MVDB 3LZ1B 5B0ZB 5G49A 3RELD 4CAYA 3B6FB 2BG1A 3MGSC 1P3AB 4WNNA 3C1BD 1S32C 1EQZB 1H3OA 3AZEC 4R8PA 4QLCC 3KWQB 4R8PB 5GT3D 3C1CA 3C1CB 3KUYB 2PYOB 4H9SA 5B40C 4YS3B 5CP6B 4LD9C 1KX4C 3X1UC 1P3BA 1BH8A 3WTPD 2G5HC 5BT1C 1TZYC 5AVBD 3KXBC 3A1IA 2CV5B 4KGCD 2HUEC 1P3MB 2FJ7D 4M6BA 5CPKD 5BO0B 3W96D 3KFUG 2Y2OA 3MGPB 3RELB 5B1MD 3A6ND 5JRGD 1P3IC 4H9PB 1HQ3B 4G91C 3LELB 3X1SC 4Z5TC 2F2AC 3UTAA 2ZM5A 4WU9B 1ID3C 3AV1B 4J8WA 5BNXB 3AFAA 1KX3D 1KX3C 3REKB 4J8XA 1ZLAD 2LY8A 4Z2MH 5E5AD 4NE3A 3X1SD 2JCHA 2F8NG 5AV9C 3MGQB 1F66C 4J8UD 2FJ7B 3WA9A 1P3FB 2F8NK 3MNNB 5B31B 5CP6A 2ZY2A 4ZUXA 2Y2PA 5B24D 3AZNC 1M18D 3X1TA 4XZQD 5DNNB 2NQBD 4J8WB 4DQYB 3B6FA 5AV9D 5AVCD 3AZKB 2YFWB 1HQ3D 5B0ZA 2ZY4A 3WAAD 5B1MB 4H9SC 5B40A 4LD9A 3REIA 1P3GA 5E5AB 3NQUA 1KX5C 1KX5D 3REKD 3W99D 4X23D 1M1AC 1WWSA 3AZMC 4XUJB 5B1LB 1P3LD 5DNMD 3AZLD 1AOID 3UTAD 2BYMB 5GT0B 2HIOD 2F8NH 1BH8B 3AZJC 2F8ND 1P3BB 5JRGA 3AN2A 3AV2D 3W97D 1M18C 3MGRC 5CPIB 3MGRD 1P3OC 2DQNC 4YS3A 5GSUB 5KDMA 3W96A 5AVCB 4J8WD 5AY8C 4NFTA 1H3OB 3AZJD 4HGAC 2Y2NA 3AZIA 3C1BC 3W98B 3MGSB 5G49B 4KUDB 5B24A 1M1AD 3B6GD 5FUGA 5CPJD 3WA9D 1P3KA 4KUDC 2NZDB 4NE6A 4Z2MG 3C1BB 3W98C 4J8VB 4KGCA 3V9RA 4HGAB 1N1JB 5F99D 2F8NB 3B6GA 1TAFB 4H9QB 2JSSA 2HIOA 5GT0D 4X23B 5AVCC 1BH9B 4Z66B 4XUJD 4AWLC 3VH5W 2Y2IA 5GT3A 5CPIC 3MGRB 5DNNA 1P3BC 3H0LC 3IP4C 4UUZB 3O62D 1Q9CA 3WTPC 4KHAA 1M19B 4XZQB 4XUJC 1P3GC 1P3FA 1M1AB 3LZ0C 5AV5C 1KX5B 5E5AC 4XZQA 3MGRA 2CWEA 3MGSD 3AV2A 3KWQD 1S32A 3VH6A 2XD1A 5B32B 3TU4C 3AYWA 3B6GB 5GT3B 1P3GD 4WZSB 1BH9A 2ZY3A 3W96C 1P3AD 2HIOB 3C1BA 5GXQA 5AV9A 5BT1D 5FUGB 1P3FC 3RELA 2FJ7C 3LJAC 3UTBB 3WAAA 3LZ0A 5B33B 5BO0A 5B33C 3MGQC 4H9NA 3LJAB 3UTBC 3AZHA 3R45A 2CV5A 3MGPD 2RVQC 3W98A 3AZKD 2HIOC 3W96B 3AV1C 5GT3C 3B6GC 3AZMD 4Z5TB 2VQRA 5B32C 4J8UA 5AVCA 3TU4B 5KDMB 3LELC 2Y2JA 1WWIA 1EQZA 4WNNB 2RVQD 5CPIA 3RELC 3MGPC 1KU5A 5AV5B 3LZ0B 3LZ1A 5GT0A 5CP6D 1JFIB 2HUEB 1P3MC 3MGQD 3KXBB 3AZID 4XZQC 1P3GB 1PZRA 4UPKA 4XUJA 1M19D 3AZJA 3WTPB 2YFVA 4WU8A 1M19C 3X1UB 3EPJA 5CPKA 1KX4B 2YFWA 1P3OA 3A6NA 5CP6C 4YS3C 5B40B 1P3FD 4LD9B 4R8PC 3C1CC 4AWLB 4H9OB 5AY8A 4Z66C 4YM6D 1S32B 3AZKA 1EQZC 4X23C 3O62A 5CPJA 1P3AC 3B6FC 5AV8D 3MNNA 5B0ZC 3LZ1C 3EPKA 2UWXA 4J8VC 4E45A 4YM6A 4JJNA 2NZDC 3UT9D 3REIC 5B31A 4H9RB 2NQBC 3W97A 3AN2D 4UUZA 3AV1A 4WU9A 3X1VD 1U35A 5C3IC 5AY8B 4X23A 3O62C 3REKA 3LELA 5BNVA 5GSUC 1P3MD 5B2JB 3MGSA 1P3OB 1N1JA 2L5AA 5CPID 4G92B 3AZEA 3WKJA 1M18B 2G5IC 3AZJB 1HQ3A 4DRBA 1KX4D 2Y2GA 5GT0C 3REID 2BYKA 2W8SA 5B1LC 4QLCD 3UT9B 3WA9C 3AZMB 5AV5A 5GXQD 4H9RA 5AV5D 3AFAD 1P3KC 5B1MC 1AOIA 4Z5TA 4ZUXD 3AZKC 1B67A 3B0CW 1U35D 4J8WC 3X1SA 5B33D 5DNNC 3WKJD 1TZYD 5AVBC 1P3AA 2AROD 3MVDA 3AZNB 1KX3A 3R45B 3EG5B 3A6NB 5B1LA 1P3PD 5B31C 3MNNC 2Y2HA 3UT9A 2J8PA 3WAAB 3X1UA 1T3UA 3AYWD 1F66B 3WTPA 3W99C 5AV9B 4ZBJC 3KXBA 5B1MA 1AOIC 1P3LC 5B32D 4KUDD 3AZFB 3REKC 1KX3B 3AZNA 3VH6W 1A7WA 4WU9C 3REJD 3MNND 3X1TB 1ID3B 5JA4B 1U35B 4J8UB 3TU4A 3AYWC 3AV2B 5B0YD 4ZUXB 1HQ3C 3B0BA 4G91B 3X1SB 4WU8D 1P3IB 5AY8D 5DNMA 3AZLA 5B24C 3AZND 1P3BD 3LJAD 1M1AA 4EO5B 2AROA 5AV6B 3MVDD 4YM6B 5B32G 2CV5C 3AZHB 4WU8C 1TZYB 2Y2KA 5B33A 3UTBA 4J8XB 3VH5A 3B0DC 5CHLB 2BYKB 4CSRB 5CPJB 5GXQB 2NZDD 3KUYD 2PYOD 3KUYC 2PYOC 5F99C 4H9OA 3KWQC 4QLCB 4J8VD 1M18A 3AZEB 1TAFA 4H9QA 2FFFB 2Y2MA 5B0YB 3REHB 3W98D 1ZLAC 5B31G 5B2JA 5BNVB
chains in the Genus database with same CATH topology
3MGPA 1ID3D 4QLCA 3F6TA 4R8PD 3MVDC 3C1CD 4YS3D 1KX5A 5GSUD 3W97B 3KXBD 3AZIB 4KGCC 5CPKC 2AROB 3A1KA 5AV6A 4JJNB 3KUYA 2PYOA 1BFMA 1P3LA 3X1VA 4WU9D 5GSUA 5BS7A 3AN2C 1ZLAB 1S32D 5B0YC 1P3IA 3REHC 3H0RC 4CAYB 5JRGB 5F99B 5DNMC 5B40D 3AZLC 1HTAA 4LD9D 3EPHA 5GXQC 5CPJC 2BYMA 3B0DB 1F1EA 3KSYA 5B2IA 4H9NB 3LJAA 4J8XC 2NQBA 3H0MC 3V9RB 5AV8B 1P3PC 3X1TD 5AV8A 2YFVB 4E44A 4WU8B 3REJB 3AZHC 4YM6C 2NZDA 2JE5A 5E5AA 5AV6C 5B2IB 4EO5C 1JFIA 3UTBD 3REJA 5B24B 5B31D 3AZGD 3AZGC 1P3OD 2Y2LA 4ZUXC 1P34C 3AV2C 5B32A 4J8UC 3AYWB 3VH5T 1U35C 3WKJC 5F99A 5DNND 3X1TC 3X1VB 3FDDA 5B2JD 1W2EA 3UTAC 1F66D 4J8XD 1ZLAA 3AZFC 3AFAC 1P3KD 2FJ7A 1P3PA 3VH6T 5B1LD 3TU4D 1P3LB 1AOIB 3AV1D 4ZBJB 2IO5B 3W99B 3REHD 5B2ID 1M19A 2IO5C 3WAAC 3AZGA 3AZMA 3A6NC 5BNXA 3AFAB 3NQJB 1P34A 5BS7C 1P3ID 4Z66A 3REHA 3UTAB 5AVBA 3X1VC 5AVBB 3WKJB 4WV4B 2CV5D 4H9PA 2F8NA 1P34B 5B0YA 4CSRA 3X1UD 2ZY5A 3AZGB 1ULYA 1P3KB 4WJ3C 1TZYA 3B0CT 1B6WA 3WTPE 3W99A 5B2IC 4KUDA 3AZED 3UT9C 3WA9B 3REJC 1P3PB 5AV8C 1R4VA 3AL0C 3MGQA 5B0ZD 3LZ0D 3AZFD 3LZ1D 4KHAB 3B6FD 3KWQA 4DRAA 4Z5TD 3NQJA 2DF4C 4G92C 5DNMB 3AZLB 5JRGC 2Y2QA 4Z66D 5B2JC 1P34D 1EQZD 3AN2B 3O62B 3AZFA 5C3IB 5JA4A 1ID3A 4JJND 3P5JB 4JJNC 2RIQA 2AROC 2XD5A 5CPKB 1KX4A 4NE5A 3AZIC 3W97C 4KGCB 4J8VA 2NQBB 3EPLA 3NQUB 3REIB 1Z2CB 3AZHD 1P3MA 3LELD 1F66A 5AV6D 3MVDB 3LZ1B 5B0ZB 5G49A 3RELD 4CAYA 3B6FB 2BG1A 3MGSC 1P3AB 4WNNA 3C1BD 1S32C 1EQZB 1H3OA 3AZEC 4R8PA 4QLCC 3KWQB 4R8PB 5GT3D 3C1CA 3C1CB 3KUYB 2PYOB 4H9SA 5B40C 4YS3B 5CP6B 4LD9C 1KX4C 3X1UC 1P3BA 1BH8A 3WTPD 2G5HC 5BT1C 1TZYC 5AVBD 3KXBC 3A1IA 2CV5B 4KGCD 2HUEC 1P3MB 2FJ7D 4M6BA 5CPKD 5BO0B 3W96D 3KFUG 2Y2OA 3MGPB 3RELB 5B1MD 3A6ND 5JRGD 1P3IC 4H9PB 1HQ3B 4G91C 3LELB 3X1SC 4Z5TC 2F2AC 3UTAA 2ZM5A 4WU9B 1ID3C 3AV1B 4J8WA 5BNXB 3AFAA 1KX3D 1KX3C 3REKB 4J8XA 1ZLAD 2LY8A 4Z2MH 5E5AD 4NE3A 3X1SD 2JCHA 2F8NG 5AV9C 3MGQB 1F66C 4J8UD 2FJ7B 3WA9A 1P3FB 2F8NK 3MNNB 5B31B 5CP6A 2ZY2A 4ZUXA 2Y2PA 5B24D 3AZNC 1M18D 3X1TA 4XZQD 5DNNB 2NQBD 4J8WB 4DQYB 3B6FA 5AV9D 5AVCD 3AZKB 2YFWB 1HQ3D 5B0ZA 2ZY4A 3WAAD 5B1MB 4H9SC 5B40A 4LD9A 3REIA 1P3GA 5E5AB 3NQUA 1KX5C 1KX5D 3REKD 3W99D 4X23D 1M1AC 1WWSA 3AZMC 4XUJB 5B1LB 1P3LD 5DNMD 3AZLD 1AOID 3UTAD 2BYMB 5GT0B 2HIOD 2F8NH 1BH8B 3AZJC 2F8ND 1P3BB 5JRGA 3AN2A 3AV2D 3W97D 1M18C 3MGRC 5CPIB 3MGRD 1P3OC 2DQNC 4YS3A 5GSUB 5KDMA 3W96A 5AVCB 4J8WD 5AY8C 4NFTA 1H3OB 3AZJD 4HGAC 2Y2NA 3AZIA 3C1BC 3W98B 3MGSB 5G49B 4KUDB 5B24A 1M1AD 3B6GD 5FUGA 5CPJD 3WA9D 1P3KA 4KUDC 2NZDB 4NE6A 4Z2MG 3C1BB 3W98C 4J8VB 4KGCA 3V9RA 4HGAB 1N1JB 5F99D 2F8NB 3B6GA 1TAFB 4H9QB 2JSSA 2HIOA 5GT0D 4X23B 5AVCC 1BH9B 4Z66B 4XUJD 4AWLC 3VH5W 2Y2IA 5GT3A 5CPIC 3MGRB 5DNNA 1P3BC 3H0LC 3IP4C 4UUZB 3O62D 1Q9CA 3WTPC 4KHAA 1M19B 4XZQB 4XUJC 1P3GC 1P3FA 1M1AB 3LZ0C 5AV5C 1KX5B 5E5AC 4XZQA 3MGRA 2CWEA 3MGSD 3AV2A 3KWQD 1S32A 3VH6A 2XD1A 5B32B 3TU4C 3AYWA 3B6GB 5GT3B 1P3GD 4WZSB 1BH9A 2ZY3A 3W96C 1P3AD 2HIOB 3C1BA 5GXQA 5AV9A 5BT1D 5FUGB 1P3FC 3RELA 2FJ7C 3LJAC 3UTBB 3WAAA 3LZ0A 5B33B 5BO0A 5B33C 3MGQC 4H9NA 3LJAB 3UTBC 3AZHA 3R45A 2CV5A 3MGPD 2RVQC 3W98A 3AZKD 2HIOC 3W96B 3AV1C 5GT3C 3B6GC 3AZMD 4Z5TB 2VQRA 5B32C 4J8UA 5AVCA 3TU4B 5KDMB 3LELC 2Y2JA 1WWIA 1EQZA 4WNNB 2RVQD 5CPIA 3RELC 3MGPC 1KU5A 5AV5B 3LZ0B 3LZ1A 5GT0A 5CP6D 1JFIB 2HUEB 1P3MC 3MGQD 3KXBB 3AZID 4XZQC 1P3GB 1PZRA 4UPKA 4XUJA 1M19D 3AZJA 3WTPB 2YFVA 4WU8A 1M19C 3X1UB 3EPJA 5CPKA 1KX4B 2YFWA 1P3OA 3A6NA 5CP6C 4YS3C 5B40B 1P3FD 4LD9B 4R8PC 3C1CC 4AWLB 4H9OB 5AY8A 4Z66C 4YM6D 1S32B 3AZKA 1EQZC 4X23C 3O62A 5CPJA 1P3AC 3B6FC 5AV8D 3MNNA 5B0ZC 3LZ1C 3EPKA 2UWXA 4J8VC 4E45A 4YM6A 4JJNA 2NZDC 3UT9D 3REIC 5B31A 4H9RB 2NQBC 3W97A 3AN2D 4UUZA 3AV1A 4WU9A 3X1VD 1U35A 5C3IC 5AY8B 4X23A 3O62C 3REKA 3LELA 5BNVA 5GSUC 1P3MD 5B2JB 3MGSA 1P3OB 1N1JA 2L5AA 5CPID 4G92B 3AZEA 3WKJA 1M18B 2G5IC 3AZJB 1HQ3A 4DRBA 1KX4D 2Y2GA 5GT0C 3REID 2BYKA 2W8SA 5B1LC 4QLCD 3UT9B 3WA9C 3AZMB 5AV5A 5GXQD 4H9RA 5AV5D 3AFAD 1P3KC 5B1MC 1AOIA 4Z5TA 4ZUXD 3AZKC 1B67A 3B0CW 1U35D 4J8WC 3X1SA 5B33D 5DNNC 3WKJD 1TZYD 5AVBC 1P3AA 2AROD 3MVDA 3AZNB 1KX3A 3R45B 3EG5B 3A6NB 5B1LA 1P3PD 5B31C 3MNNC 2Y2HA 3UT9A 2J8PA 3WAAB 3X1UA 1T3UA 3AYWD 1F66B 3WTPA 3W99C 5AV9B 4ZBJC 3KXBA 5B1MA 1AOIC 1P3LC 5B32D 4KUDD 3AZFB 3REKC 1KX3B 3AZNA 3VH6W 1A7WA 4WU9C 3REJD 3MNND 3X1TB 1ID3B 5JA4B 1U35B 4J8UB 3TU4A 3AYWC 3AV2B 5B0YD 4ZUXB 1HQ3C 3B0BA 4G91B 3X1SB 4WU8D 1P3IB 5AY8D 5DNMA 3AZLA 5B24C 3AZND 1P3BD 3LJAD 1M1AA 4EO5B 2AROA 5AV6B 3MVDD 4YM6B 5B32G 2CV5C 3AZHB 4WU8C 1TZYB 2Y2KA 5B33A 3UTBA 4J8XB 3VH5A 3B0DC 5CHLB 2BYKB 4CSRB 5CPJB 5GXQB 2NZDD 3KUYD 2PYOD 3KUYC 2PYOC 5F99C 4H9OA 3KWQC 4QLCB 4J8VD 1M18A 3AZEB 1TAFA 4H9QA 2FFFB 2Y2MA 5B0YB 3REHB 3W98D 1ZLAC 5B31G 5B2JA 5BNVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP A;  1ID3 D;  4QLC A;  4R8P D;  3MVD C;  3C1C D;  4YS3 D;  1KX5 A;  5GSU D;  3W97 B;  3KXB D;  3AZI B;  4KGC C;  5CPK C;  2ARO B;  5AV6 A;  4JJN B;  3KUY A;  2PYO A;  1BFM A;  1P3L A;  3X1V A;  4WU9 D;  5GSU A;  5BS7 A;  3AN2 C;  1ZLA B;  1S32 D;  5B0Y C;  1P3I A;  3REH C;  4CAY B;  5JRG B;  5F99 B;  5DNM C;  5B40 D;  3AZL C;  1HTA A;  4LD9 D;  5GXQ C;  5CPJ C;  2BYM A;  3B0D B;  1F1E A;  3KSY A;  5B2I A;  4H9N B;  3LJA A;  4J8X C;  2NQB A;  3V9R B;  5AV8 B;  1P3P C;  3X1T D;  4E44 A;  2YFV B;  5AV8 A;  4WU8 B;  3REJ B;  3AZH C;  4YM6 C;  2NZD A;  5E5A A;  5AV6 C;  5B2I B;  4EO5 C;  1JFI A;  3UTB D;  3REJ A;  5B24 B;  5B31 D;  3AZG D;  3AZG C;  1P3O D;  4ZUX C;  1P34 C;  3AV2 C;  5B32 A;  4J8U C;  3AYW B;  3VH5 T;  1U35 C;  3WKJ C;  5F99 A;  5DNN D;  3X1T C;  3X1V B;  5B2J D;  3UTA C;  1F66 D;  4J8X D;  1ZLA A;  3AZF C;  3AFA C;  1P3K D;  2FJ7 A;  1P3P A;  3VH6 T;  5B1L D;  3TU4 D;  1P3L B;  1AOI B;  3AV1 D;  4ZBJ B;  2IO5 B;  3W99 B;  3REH D;  5B2I D;  1M19 A;  2IO5 C;  3WAA C;  3AZG A;  3AZM A;  3A6N C;  5BNX A;  3AFA B;  3NQJ B;  1P34 A;  5BS7 C;  1P3I D;  4Z66 A;  3REH A;  3UTA B;  5AVB A;  3X1V C;  5AVB B;  3WKJ B;  4WV4 B;  2CV5 D;  4H9P A;  2F8N A;  1P34 B;  5B0Y A;  4CSR A;  3X1U D;  3AZG B;  1ULY A;  1P3K B;  1TZY A;  3B0C T;  1B6W A;  3WTP E;  3W99 A;  5B2I C;  4KUD A;  3AZE D;  3UT9 C;  3WA9 B;  3REJ C;  1P3P B;  5AV8 C;  1R4V A;  3MGQ A;  5B0Z D;  3LZ0 D;  3AZF D;  3LZ1 D;  4KHA B;  3B6F D;  3KWQ A;  4DRA A;  4Z5T D;  3NQJ A;  4G92 C;  5DNM B;  3AZL B;  5JRG C;  4Z66 D;  5B2J C;  1P34 D;  1EQZ D;  3AN2 B;  3O62 B;  3AZF A;  5C3I B;  5JA4 A;  1ID3 A;  4JJN D;  4JJN C;  2ARO C;  5CPK B;  1KX4 A;  4NE5 A;  3AZI C;  3W97 C;  4KGC B;  4J8V A;  2NQB B;  3NQU B;  3REI B;  3AZH D;  1P3M A;  3LEL D;  1F66 A;  5AV6 D;  3MVD B;  3LZ1 B;  5B0Z B;  5G49 A;  3REL D;  4CAY A;  3B6F B;  3MGS C;  1P3A B;  4WNN A;  3C1B D;  1S32 C;  1EQZ B;  1H3O A;  3AZE C;  4R8P A;  4QLC C;  3KWQ B;  4R8P B;  5GT3 D;  3C1C A;  3C1C B;  3KUY B;  2PYO B;  4H9S A;  5B40 C;  4YS3 B;  5CP6 B;  4LD9 C;  1KX4 C;  3X1U C;  1P3B A;  1BH8 A;  3WTP D;  5BT1 C;  1TZY C;  5AVB D;  3KXB C;  4KGC D;  2CV5 B;  2HUE C;  1P3M B;  2FJ7 D;  4M6B A;  5CPK D;  5BO0 B;  3W96 D;  3MGP B;  3REL B;  5B1M D;  3A6N D;  5JRG D;  1P3I C;  4H9P B;  1HQ3 B;  4G91 C;  3LEL B;  3X1S C;  4Z5T C;  3UTA A;  4WU9 B;  1ID3 C;  3AV1 B;  4J8W A;  5BNX B;  3AFA A;  1KX3 D;  1KX3 C;  3REK B;  4J8X A;  1ZLA D;  2LY8 A;  4Z2M H;  5E5A D;  4NE3 A;  3X1S D;  2F8N G;  5AV9 C;  3MGQ B;  1F66 C;  4J8U D;  2FJ7 B;  3WA9 A;  1P3F B;  2F8N K;  3MNN B;  5B31 B;  5CP6 A;  4ZUX A;  5B24 D;  3AZN C;  1M18 D;  3X1T A;  4XZQ D;  5DNN B;  2NQB D;  4J8W B;  3B6F A;  5AV9 D;  5AVC D;  3AZK B;  2YFW B;  1HQ3 D;  5B0Z A;  3WAA D;  5B1M B;  4H9S C;  5B40 A;  4LD9 A;  3REI A;  1P3G A;  5E5A B;  3NQU A;  1KX5 C;  1KX5 D;  3REK D;  3W99 D;  4X23 D;  1M1A C;  1WWS A;  3AZM C;  4XUJ B;  5B1L B;  1P3L D;  5DNM D;  3AZL D;  1AOI D;  3UTA D;  2BYM B;  5GT0 B;  2HIO D;  2F8N H;  1BH8 B;  3AZJ C;  2F8N D;  1P3B B;  5JRG A;  3AN2 A;  3AV2 D;  3W97 D;  1M18 C;  3MGR C;  5CPI B;  3MGR D;  1P3O C;  4YS3 A;  5GSU B;  5KDM A;  3W96 A;  5AVC B;  4J8W D;  5AY8 C;  4NFT A;  1H3O B;  3AZJ D;  4HGA C;  3AZI A;  3C1B C;  3W98 B;  3MGS B;  5G49 B;  4KUD B;  5B24 A;  1M1A D;  3B6G D;  5FUG A;  5CPJ D;  3WA9 D;  1P3K A;  4KUD C;  2NZD B;  4NE6 A;  4Z2M G;  3C1B B;  3W98 C;  4J8V B;  4KGC A;  3V9R A;  4HGA B;  1N1J B;  5F99 D;  2F8N B;  3B6G A;  1TAF B;  4H9Q B;  2JSS A;  2HIO A;  5GT0 D;  4X23 B;  5AVC C;  1BH9 B;  4Z66 B;  4XUJ D;  4AWL C;  3VH5 W;  5GT3 A;  5CPI C;  3MGR B;  5DNN A;  1P3B C;  4UUZ B;  3O62 D;  1Q9C A;  3WTP C;  4KHA A;  1M19 B;  4XZQ B;  4XUJ C;  1P3G C;  1P3F A;  1M1A B;  3LZ0 C;  5AV5 C;  1KX5 B;  5E5A C;  4XZQ A;  3MGR A;  2CWE A;  3MGS D;  3AV2 A;  3KWQ D;  1S32 A;  3VH6 A;  5B32 B;  3TU4 C;  3AYW A;  3B6G B;  5GT3 B;  1P3G D;  4WZS B;  1BH9 A;  3W96 C;  1P3A D;  2HIO B;  3C1B A;  5GXQ A;  5AV9 A;  5BT1 D;  5FUG B;  1P3F C;  3REL A;  2FJ7 C;  3LJA C;  3UTB B;  3WAA A;  3LZ0 A;  5B33 B;  5BO0 A;  5B33 C;  3MGQ C;  4H9N A;  3LJA B;  3UTB C;  3AZH A;  3R45 A;  2CV5 A;  3MGP D;  2RVQ C;  3W98 A;  3AZK D;  2HIO C;  3W96 B;  3AV1 C;  5GT3 C;  3B6G C;  3AZM D;  4Z5T B;  5B32 C;  4J8U A;  3TU4 B;  5AVC A;  5KDM B;  3LEL C;  1WWI A;  1EQZ A;  4WNN B;  2RVQ D;  5CPI A;  3REL C;  3MGP C;  1KU5 A;  5AV5 B;  3LZ0 B;  3LZ1 A;  5GT0 A;  5CP6 D;  1JFI B;  2HUE B;  1P3M C;  3MGQ D;  3KXB B;  3AZI D;  4XZQ C;  1P3G B;  4XUJ A;  1M19 D;  3AZJ A;  3WTP B;  2YFV A;  4WU8 A;  1M19 C;  3X1U B;  5CPK A;  1KX4 B;  2YFW A;  1P3O A;  3A6N A;  5CP6 C;  4YS3 C;  5B40 B;  1P3F D;  4LD9 B;  4R8P C;  3C1C C;  4AWL B;  4H9O B;  5AY8 A;  4Z66 C;  4YM6 D;  1S32 B;  3AZK A;  1EQZ C;  4X23 C;  3O62 A;  5CPJ A;  1P3A C;  3B6F C;  5AV8 D;  3MNN A;  5B0Z C;  3LZ1 C;  4J8V C;  4E45 A;  4YM6 A;  4JJN A;  2NZD C;  3UT9 D;  3REI C;  5B31 A;  4H9R B;  2NQB C;  3W97 A;  3AN2 D;  4UUZ A;  3AV1 A;  4WU9 A;  3X1V D;  1U35 A;  5C3I C;  5AY8 B;  4X23 A;  3O62 C;  3REK A;  3LEL A;  5BNV A;  5GSU C;  1P3M D;  5B2J B;  3MGS A;  1P3O B;  1N1J A;  2L5A A;  5CPI D;  4G92 B;  3AZE A;  3WKJ A;  1M18 B;  3AZJ B;  1HQ3 A;  4DRB A;  1KX4 D;  5GT0 C;  3REI D;  2BYK A;  5B1L C;  4QLC D;  3UT9 B;  3WA9 C;  3AZM B;  5AV5 A;  5GXQ D;  4H9R A;  5AV5 D;  3AFA D;  1P3K C;  5B1M C;  1AOI A;  4Z5T A;  4ZUX D;  3AZK C;  1B67 A;  3B0C W;  1U35 D;  4J8W C;  3X1S A;  5B33 D;  5DNN C;  3WKJ D;  1TZY D;  5AVB C;  1P3A A;  2ARO D;  3MVD A;  3AZN B;  1KX3 A;  3R45 B;  3A6N B;  5B1L A;  1P3P D;  5B31 C;  3MNN C;  3UT9 A;  3WAA B;  3X1U A;  3AYW D;  1F66 B;  3WTP A;  3W99 C;  5AV9 B;  4ZBJ C;  3KXB A;  5B1M A;  1AOI C;  1P3L C;  5B32 D;  4KUD D;  3AZF B;  3REK C;  1KX3 B;  3AZN A;  3VH6 W;  1A7W A;  4WU9 C;  3REJ D;  3MNN D;  3X1T B;  1ID3 B;  5JA4 B;  1U35 B;  4J8U B;  3TU4 A;  3AYW C;  3AV2 B;  5B0Y D;  4ZUX B;  1HQ3 C;  4G91 B;  3B0B A;  3X1S B;  4WU8 D;  1P3I B;  5AY8 D;  5DNM A;  3AZL A;  5B24 C;  3AZN D;  1P3B D;  3LJA D;  1M1A A;  4EO5 B;  2ARO A;  5AV6 B;  3MVD D;  4YM6 B;  5B32 G;  2CV5 C;  3AZH B;  4WU8 C;  1TZY B;  5B33 A;  3UTB A;  4J8X B;  3VH5 A;  3B0D C;  5CHL B;  2BYK B;  4CSR B;  5CPJ B;  5GXQ B;  2NZD D;  3KUY D;  2PYO D;  3KUY C;  2PYO C;  5F99 C;  4H9O A;  3KWQ C;  4QLC B;  4J8V D;  1M18 A;  3AZE B;  1TAF A;  4H9Q A;  3REH B;  5B0Y B;  3W98 D;  1ZLA C;  5B31 G;  5B2J A;  5BNV B; 
#chains in the Genus database with same CATH topology
 3MGP A;  1ID3 D;  4QLC A;  3F6T A;  4R8P D;  3MVD C;  3C1C D;  4YS3 D;  1KX5 A;  5GSU D;  3W97 B;  3KXB D;  3AZI B;  4KGC C;  5CPK C;  2ARO B;  3A1K A;  5AV6 A;  4JJN B;  3KUY A;  2PYO A;  1BFM A;  1P3L A;  3X1V A;  4WU9 D;  5GSU A;  5BS7 A;  3AN2 C;  1ZLA B;  1S32 D;  5B0Y C;  1P3I A;  3REH C;  3H0R C;  4CAY B;  5JRG B;  5F99 B;  5DNM C;  5B40 D;  3AZL C;  1HTA A;  4LD9 D;  3EPH A;  5GXQ C;  5CPJ C;  2BYM A;  3B0D B;  1F1E A;  3KSY A;  5B2I A;  4H9N B;  3LJA A;  4J8X C;  2NQB A;  3H0M C;  3V9R B;  5AV8 B;  1P3P C;  3X1T D;  5AV8 A;  2YFV B;  4E44 A;  4WU8 B;  3REJ B;  3AZH C;  4YM6 C;  2NZD A;  2JE5 A;  5E5A A;  5AV6 C;  5B2I B;  4EO5 C;  1JFI A;  3UTB D;  3REJ A;  5B24 B;  5B31 D;  3AZG D;  3AZG C;  1P3O D;  2Y2L A;  4ZUX C;  1P34 C;  3AV2 C;  5B32 A;  4J8U C;  3AYW B;  3VH5 T;  1U35 C;  3WKJ C;  5F99 A;  5DNN D;  3X1T C;  3X1V B;  3FDD A;  5B2J D;  1W2E A;  3UTA C;  1F66 D;  4J8X D;  1ZLA A;  3AZF C;  3AFA C;  1P3K D;  2FJ7 A;  1P3P A;  3VH6 T;  5B1L D;  3TU4 D;  1P3L B;  1AOI B;  3AV1 D;  4ZBJ B;  2IO5 B;  3W99 B;  3REH D;  5B2I D;  1M19 A;  2IO5 C;  3WAA C;  3AZG A;  3AZM A;  3A6N C;  5BNX A;  3AFA B;  3NQJ B;  1P34 A;  5BS7 C;  1P3I D;  4Z66 A;  3REH A;  3UTA B;  5AVB A;  3X1V C;  5AVB B;  3WKJ B;  4WV4 B;  2CV5 D;  4H9P A;  2F8N A;  1P34 B;  5B0Y A;  4CSR A;  3X1U D;  2ZY5 A;  3AZG B;  1ULY A;  1P3K B;  4WJ3 C;  1TZY A;  3B0C T;  1B6W A;  3WTP E;  3W99 A;  5B2I C;  4KUD A;  3AZE D;  3UT9 C;  3WA9 B;  3REJ C;  1P3P B;  5AV8 C;  1R4V A;  3AL0 C;  3MGQ A;  5B0Z D;  3LZ0 D;  3AZF D;  3LZ1 D;  4KHA B;  3B6F D;  3KWQ A;  4DRA A;  4Z5T D;  3NQJ A;  2DF4 C;  4G92 C;  5DNM B;  3AZL B;  5JRG C;  2Y2Q A;  4Z66 D;  5B2J C;  1P34 D;  1EQZ D;  3AN2 B;  3O62 B;  3AZF A;  5C3I B;  5JA4 A;  1ID3 A;  4JJN D;  3P5J B;  4JJN C;  2RIQ A;  2ARO C;  2XD5 A;  5CPK B;  1KX4 A;  4NE5 A;  3AZI C;  3W97 C;  4KGC B;  4J8V A;  2NQB B;  3EPL A;  3NQU B;  3REI B;  1Z2C B;  3AZH D;  1P3M A;  3LEL D;  1F66 A;  5AV6 D;  3MVD B;  3LZ1 B;  5B0Z B;  5G49 A;  3REL D;  4CAY A;  3B6F B;  2BG1 A;  3MGS C;  1P3A B;  4WNN A;  3C1B D;  1S32 C;  1EQZ B;  1H3O A;  3AZE C;  4R8P A;  4QLC C;  3KWQ B;  4R8P B;  5GT3 D;  3C1C A;  3C1C B;  3KUY B;  2PYO B;  4H9S A;  5B40 C;  4YS3 B;  5CP6 B;  4LD9 C;  1KX4 C;  3X1U C;  1P3B A;  1BH8 A;  3WTP D;  2G5H C;  5BT1 C;  1TZY C;  5AVB D;  3KXB C;  3A1I A;  2CV5 B;  4KGC D;  2HUE C;  1P3M B;  2FJ7 D;  4M6B A;  5CPK D;  5BO0 B;  3W96 D;  3KFU G;  2Y2O A;  3MGP B;  3REL B;  5B1M D;  3A6N D;  5JRG D;  1P3I C;  4H9P B;  1HQ3 B;  4G91 C;  3LEL B;  3X1S C;  4Z5T C;  2F2A C;  3UTA A;  2ZM5 A;  4WU9 B;  1ID3 C;  3AV1 B;  4J8W A;  5BNX B;  3AFA A;  1KX3 D;  1KX3 C;  3REK B;  4J8X A;  1ZLA D;  2LY8 A;  4Z2M H;  5E5A D;  4NE3 A;  3X1S D;  2JCH A;  2F8N G;  5AV9 C;  3MGQ B;  1F66 C;  4J8U D;  2FJ7 B;  3WA9 A;  1P3F B;  2F8N K;  3MNN B;  5B31 B;  5CP6 A;  2ZY2 A;  4ZUX A;  2Y2P A;  5B24 D;  3AZN C;  1M18 D;  3X1T A;  4XZQ D;  5DNN B;  2NQB D;  4J8W B;  4DQY B;  3B6F A;  5AV9 D;  5AVC D;  3AZK B;  2YFW B;  1HQ3 D;  5B0Z A;  2ZY4 A;  3WAA D;  5B1M B;  4H9S C;  5B40 A;  4LD9 A;  3REI A;  1P3G A;  5E5A B;  3NQU A;  1KX5 C;  1KX5 D;  3REK D;  3W99 D;  4X23 D;  1M1A C;  1WWS A;  3AZM C;  4XUJ B;  5B1L B;  1P3L D;  5DNM D;  3AZL D;  1AOI D;  3UTA D;  2BYM B;  5GT0 B;  2HIO D;  2F8N H;  1BH8 B;  3AZJ C;  2F8N D;  1P3B B;  5JRG A;  3AN2 A;  3AV2 D;  3W97 D;  1M18 C;  3MGR C;  5CPI B;  3MGR D;  1P3O C;  2DQN C;  4YS3 A;  5GSU B;  5KDM A;  3W96 A;  5AVC B;  4J8W D;  5AY8 C;  4NFT A;  1H3O B;  3AZJ D;  4HGA C;  2Y2N A;  3AZI A;  3C1B C;  3W98 B;  3MGS B;  5G49 B;  4KUD B;  5B24 A;  1M1A D;  3B6G D;  5FUG A;  5CPJ D;  3WA9 D;  1P3K A;  4KUD C;  2NZD B;  4NE6 A;  4Z2M G;  3C1B B;  3W98 C;  4J8V B;  4KGC A;  3V9R A;  4HGA B;  1N1J B;  5F99 D;  2F8N B;  3B6G A;  1TAF B;  4H9Q B;  2JSS A;  2HIO A;  5GT0 D;  4X23 B;  5AVC C;  1BH9 B;  4Z66 B;  4XUJ D;  4AWL C;  3VH5 W;  2Y2I A;  5GT3 A;  5CPI C;  3MGR B;  5DNN A;  1P3B C;  3H0L C;  3IP4 C;  4UUZ B;  3O62 D;  1Q9C A;  3WTP C;  4KHA A;  1M19 B;  4XZQ B;  4XUJ C;  1P3G C;  1P3F A;  1M1A B;  3LZ0 C;  5AV5 C;  1KX5 B;  5E5A C;  4XZQ A;  3MGR A;  2CWE A;  3MGS D;  3AV2 A;  3KWQ D;  1S32 A;  3VH6 A;  2XD1 A;  5B32 B;  3TU4 C;  3AYW A;  3B6G B;  5GT3 B;  1P3G D;  4WZS B;  1BH9 A;  2ZY3 A;  3W96 C;  1P3A D;  2HIO B;  3C1B A;  5GXQ A;  5AV9 A;  5BT1 D;  5FUG B;  1P3F C;  3REL A;  2FJ7 C;  3LJA C;  3UTB B;  3WAA A;  3LZ0 A;  5B33 B;  5BO0 A;  5B33 C;  3MGQ C;  4H9N A;  3LJA B;  3UTB C;  3AZH A;  3R45 A;  2CV5 A;  3MGP D;  2RVQ C;  3W98 A;  3AZK D;  2HIO C;  3W96 B;  3AV1 C;  5GT3 C;  3B6G C;  3AZM D;  4Z5T B;  2VQR A;  5B32 C;  4J8U A;  5AVC A;  3TU4 B;  5KDM B;  3LEL C;  2Y2J A;  1WWI A;  1EQZ A;  4WNN B;  2RVQ D;  5CPI A;  3REL C;  3MGP C;  1KU5 A;  5AV5 B;  3LZ0 B;  3LZ1 A;  5GT0 A;  5CP6 D;  1JFI B;  2HUE B;  1P3M C;  3MGQ D;  3KXB B;  3AZI D;  4XZQ C;  1P3G B;  1PZR A;  4UPK A;  4XUJ A;  1M19 D;  3AZJ A;  3WTP B;  2YFV A;  4WU8 A;  1M19 C;  3X1U B;  3EPJ A;  5CPK A;  1KX4 B;  2YFW A;  1P3O A;  3A6N A;  5CP6 C;  4YS3 C;  5B40 B;  1P3F D;  4LD9 B;  4R8P C;  3C1C C;  4AWL B;  4H9O B;  5AY8 A;  4Z66 C;  4YM6 D;  1S32 B;  3AZK A;  1EQZ C;  4X23 C;  3O62 A;  5CPJ A;  1P3A C;  3B6F C;  5AV8 D;  3MNN A;  5B0Z C;  3LZ1 C;  3EPK A;  2UWX A;  4J8V C;  4E45 A;  4YM6 A;  4JJN A;  2NZD C;  3UT9 D;  3REI C;  5B31 A;  4H9R B;  2NQB C;  3W97 A;  3AN2 D;  4UUZ A;  3AV1 A;  4WU9 A;  3X1V D;  1U35 A;  5C3I C;  5AY8 B;  4X23 A;  3O62 C;  3REK A;  3LEL A;  5BNV A;  5GSU C;  1P3M D;  5B2J B;  3MGS A;  1P3O B;  1N1J A;  2L5A A;  5CPI D;  4G92 B;  3AZE A;  3WKJ A;  1M18 B;  2G5I C;  3AZJ B;  1HQ3 A;  4DRB A;  1KX4 D;  2Y2G A;  5GT0 C;  3REI D;  2BYK A;  2W8S A;  5B1L C;  4QLC D;  3UT9 B;  3WA9 C;  3AZM B;  5AV5 A;  5GXQ D;  4H9R A;  5AV5 D;  3AFA D;  1P3K C;  5B1M C;  1AOI A;  4Z5T A;  4ZUX D;  3AZK C;  1B67 A;  3B0C W;  1U35 D;  4J8W C;  3X1S A;  5B33 D;  5DNN C;  3WKJ D;  1TZY D;  5AVB C;  1P3A A;  2ARO D;  3MVD A;  3AZN B;  1KX3 A;  3R45 B;  3EG5 B;  3A6N B;  5B1L A;  1P3P D;  5B31 C;  3MNN C;  2Y2H A;  3UT9 A;  2J8P A;  3WAA B;  3X1U A;  1T3U A;  3AYW D;  1F66 B;  3WTP A;  3W99 C;  5AV9 B;  4ZBJ C;  3KXB A;  5B1M A;  1AOI C;  1P3L C;  5B32 D;  4KUD D;  3AZF B;  3REK C;  1KX3 B;  3AZN A;  3VH6 W;  1A7W A;  4WU9 C;  3REJ D;  3MNN D;  3X1T B;  1ID3 B;  5JA4 B;  1U35 B;  4J8U B;  3TU4 A;  3AYW C;  3AV2 B;  5B0Y D;  4ZUX B;  1HQ3 C;  3B0B A;  4G91 B;  3X1S B;  4WU8 D;  1P3I B;  5AY8 D;  5DNM A;  3AZL A;  5B24 C;  3AZN D;  1P3B D;  3LJA D;  1M1A A;  4EO5 B;  2ARO A;  5AV6 B;  3MVD D;  4YM6 B;  5B32 G;  2CV5 C;  3AZH B;  4WU8 C;  1TZY B;  2Y2K A;  5B33 A;  3UTB A;  4J8X B;  3VH5 A;  3B0D C;  5CHL B;  2BYK B;  4CSR B;  5CPJ B;  5GXQ B;  2NZD D;  3KUY D;  2PYO D;  3KUY C;  2PYO C;  5F99 C;  4H9O A;  3KWQ C;  4QLC B;  4J8V D;  1M18 A;  3AZE B;  1TAF A;  4H9Q A;  2FFF B;  2Y2M A;  5B0Y B;  3REH B;  3W98 D;  1ZLA C;  5B31 G;  5B2J A;  5BNV B; 
#chains in the Genus database with same CATH homology
 3MGP A;  1ID3 D;  4QLC A;  3F6T A;  4R8P D;  3MVD C;  3C1C D;  4YS3 D;  1KX5 A;  5GSU D;  3W97 B;  3KXB D;  3AZI B;  4KGC C;  5CPK C;  2ARO B;  3A1K A;  5AV6 A;  4JJN B;  3KUY A;  2PYO A;  1BFM A;  1P3L A;  3X1V A;  4WU9 D;  5GSU A;  5BS7 A;  3AN2 C;  1ZLA B;  1S32 D;  5B0Y C;  1P3I A;  3REH C;  3H0R C;  4CAY B;  5JRG B;  5F99 B;  5DNM C;  5B40 D;  3AZL C;  1HTA A;  4LD9 D;  3EPH A;  5GXQ C;  5CPJ C;  2BYM A;  3B0D B;  1F1E A;  3KSY A;  5B2I A;  4H9N B;  3LJA A;  4J8X C;  2NQB A;  3H0M C;  3V9R B;  5AV8 B;  1P3P C;  3X1T D;  5AV8 A;  2YFV B;  4E44 A;  4WU8 B;  3REJ B;  3AZH C;  4YM6 C;  2NZD A;  2JE5 A;  5E5A A;  5AV6 C;  5B2I B;  4EO5 C;  1JFI A;  3UTB D;  3REJ A;  5B24 B;  5B31 D;  3AZG D;  3AZG C;  1P3O D;  2Y2L A;  4ZUX C;  1P34 C;  3AV2 C;  5B32 A;  4J8U C;  3AYW B;  3VH5 T;  1U35 C;  3WKJ C;  5F99 A;  5DNN D;  3X1T C;  3X1V B;  3FDD A;  5B2J D;  1W2E A;  3UTA C;  1F66 D;  4J8X D;  1ZLA A;  3AZF C;  3AFA C;  1P3K D;  2FJ7 A;  1P3P A;  3VH6 T;  5B1L D;  3TU4 D;  1P3L B;  1AOI B;  3AV1 D;  4ZBJ B;  2IO5 B;  3W99 B;  3REH D;  5B2I D;  1M19 A;  2IO5 C;  3WAA C;  3AZG A;  3AZM A;  3A6N C;  5BNX A;  3AFA B;  3NQJ B;  1P34 A;  5BS7 C;  1P3I D;  4Z66 A;  3REH A;  3UTA B;  5AVB A;  3X1V C;  5AVB B;  3WKJ B;  4WV4 B;  2CV5 D;  4H9P A;  2F8N A;  1P34 B;  5B0Y A;  4CSR A;  3X1U D;  2ZY5 A;  3AZG B;  1ULY A;  1P3K B;  4WJ3 C;  1TZY A;  3B0C T;  1B6W A;  3WTP E;  3W99 A;  5B2I C;  4KUD A;  3AZE D;  3UT9 C;  3WA9 B;  3REJ C;  1P3P B;  5AV8 C;  1R4V A;  3AL0 C;  3MGQ A;  5B0Z D;  3LZ0 D;  3AZF D;  3LZ1 D;  4KHA B;  3B6F D;  3KWQ A;  4DRA A;  4Z5T D;  3NQJ A;  2DF4 C;  4G92 C;  5DNM B;  3AZL B;  5JRG C;  2Y2Q A;  4Z66 D;  5B2J C;  1P34 D;  1EQZ D;  3AN2 B;  3O62 B;  3AZF A;  5C3I B;  5JA4 A;  1ID3 A;  4JJN D;  3P5J B;  4JJN C;  2RIQ A;  2ARO C;  2XD5 A;  5CPK B;  1KX4 A;  4NE5 A;  3AZI C;  3W97 C;  4KGC B;  4J8V A;  2NQB B;  3EPL A;  3NQU B;  3REI B;  1Z2C B;  3AZH D;  1P3M A;  3LEL D;  1F66 A;  5AV6 D;  3MVD B;  3LZ1 B;  5B0Z B;  5G49 A;  3REL D;  4CAY A;  3B6F B;  2BG1 A;  3MGS C;  1P3A B;  4WNN A;  3C1B D;  1S32 C;  1EQZ B;  1H3O A;  3AZE C;  4R8P A;  4QLC C;  3KWQ B;  4R8P B;  5GT3 D;  3C1C A;  3C1C B;  3KUY B;  2PYO B;  4H9S A;  5B40 C;  4YS3 B;  5CP6 B;  4LD9 C;  1KX4 C;  3X1U C;  1P3B A;  1BH8 A;  3WTP D;  2G5H C;  5BT1 C;  1TZY C;  5AVB D;  3KXB C;  3A1I A;  2CV5 B;  4KGC D;  2HUE C;  1P3M B;  2FJ7 D;  4M6B A;  5CPK D;  5BO0 B;  3W96 D;  3KFU G;  2Y2O A;  3MGP B;  3REL B;  5B1M D;  3A6N D;  5JRG D;  1P3I C;  4H9P B;  1HQ3 B;  4G91 C;  3LEL B;  3X1S C;  4Z5T C;  2F2A C;  3UTA A;  2ZM5 A;  4WU9 B;  1ID3 C;  3AV1 B;  4J8W A;  5BNX B;  3AFA A;  1KX3 D;  1KX3 C;  3REK B;  4J8X A;  1ZLA D;  2LY8 A;  4Z2M H;  5E5A D;  4NE3 A;  3X1S D;  2JCH A;  2F8N G;  5AV9 C;  3MGQ B;  1F66 C;  4J8U D;  2FJ7 B;  3WA9 A;  1P3F B;  2F8N K;  3MNN B;  5B31 B;  5CP6 A;  2ZY2 A;  4ZUX A;  2Y2P A;  5B24 D;  3AZN C;  1M18 D;  3X1T A;  4XZQ D;  5DNN B;  2NQB D;  4J8W B;  4DQY B;  3B6F A;  5AV9 D;  5AVC D;  3AZK B;  2YFW B;  1HQ3 D;  5B0Z A;  2ZY4 A;  3WAA D;  5B1M B;  4H9S C;  5B40 A;  4LD9 A;  3REI A;  1P3G A;  5E5A B;  3NQU A;  1KX5 C;  1KX5 D;  3REK D;  3W99 D;  4X23 D;  1M1A C;  1WWS A;  3AZM C;  4XUJ B;  5B1L B;  1P3L D;  5DNM D;  3AZL D;  1AOI D;  3UTA D;  2BYM B;  5GT0 B;  2HIO D;  2F8N H;  1BH8 B;  3AZJ C;  2F8N D;  1P3B B;  5JRG A;  3AN2 A;  3AV2 D;  3W97 D;  1M18 C;  3MGR C;  5CPI B;  3MGR D;  1P3O C;  2DQN C;  4YS3 A;  5GSU B;  5KDM A;  3W96 A;  5AVC B;  4J8W D;  5AY8 C;  4NFT A;  1H3O B;  3AZJ D;  4HGA C;  2Y2N A;  3AZI A;  3C1B C;  3W98 B;  3MGS B;  5G49 B;  4KUD B;  5B24 A;  1M1A D;  3B6G D;  5FUG A;  5CPJ D;  3WA9 D;  1P3K A;  4KUD C;  2NZD B;  4NE6 A;  4Z2M G;  3C1B B;  3W98 C;  4J8V B;  4KGC A;  3V9R A;  4HGA B;  1N1J B;  5F99 D;  2F8N B;  3B6G A;  1TAF B;  4H9Q B;  2JSS A;  2HIO A;  5GT0 D;  4X23 B;  5AVC C;  1BH9 B;  4Z66 B;  4XUJ D;  4AWL C;  3VH5 W;  2Y2I A;  5GT3 A;  5CPI C;  3MGR B;  5DNN A;  1P3B C;  3H0L C;  3IP4 C;  4UUZ B;  3O62 D;  1Q9C A;  3WTP C;  4KHA A;  1M19 B;  4XZQ B;  4XUJ C;  1P3G C;  1P3F A;  1M1A B;  3LZ0 C;  5AV5 C;  1KX5 B;  5E5A C;  4XZQ A;  3MGR A;  2CWE A;  3MGS D;  3AV2 A;  3KWQ D;  1S32 A;  3VH6 A;  2XD1 A;  5B32 B;  3TU4 C;  3AYW A;  3B6G B;  5GT3 B;  1P3G D;  4WZS B;  1BH9 A;  2ZY3 A;  3W96 C;  1P3A D;  2HIO B;  3C1B A;  5GXQ A;  5AV9 A;  5BT1 D;  5FUG B;  1P3F C;  3REL A;  2FJ7 C;  3LJA C;  3UTB B;  3WAA A;  3LZ0 A;  5B33 B;  5BO0 A;  5B33 C;  3MGQ C;  4H9N A;  3LJA B;  3UTB C;  3AZH A;  3R45 A;  2CV5 A;  3MGP D;  2RVQ C;  3W98 A;  3AZK D;  2HIO C;  3W96 B;  3AV1 C;  5GT3 C;  3B6G C;  3AZM D;  4Z5T B;  2VQR A;  5B32 C;  4J8U A;  5AVC A;  3TU4 B;  5KDM B;  3LEL C;  2Y2J A;  1WWI A;  1EQZ A;  4WNN B;  2RVQ D;  5CPI A;  3REL C;  3MGP C;  1KU5 A;  5AV5 B;  3LZ0 B;  3LZ1 A;  5GT0 A;  5CP6 D;  1JFI B;  2HUE B;  1P3M C;  3MGQ D;  3KXB B;  3AZI D;  4XZQ C;  1P3G B;  1PZR A;  4UPK A;  4XUJ A;  1M19 D;  3AZJ A;  3WTP B;  2YFV A;  4WU8 A;  1M19 C;  3X1U B;  3EPJ A;  5CPK A;  1KX4 B;  2YFW A;  1P3O A;  3A6N A;  5CP6 C;  4YS3 C;  5B40 B;  1P3F D;  4LD9 B;  4R8P C;  3C1C C;  4AWL B;  4H9O B;  5AY8 A;  4Z66 C;  4YM6 D;  1S32 B;  3AZK A;  1EQZ C;  4X23 C;  3O62 A;  5CPJ A;  1P3A C;  3B6F C;  5AV8 D;  3MNN A;  5B0Z C;  3LZ1 C;  3EPK A;  2UWX A;  4J8V C;  4E45 A;  4YM6 A;  4JJN A;  2NZD C;  3UT9 D;  3REI C;  5B31 A;  4H9R B;  2NQB C;  3W97 A;  3AN2 D;  4UUZ A;  3AV1 A;  4WU9 A;  3X1V D;  1U35 A;  5C3I C;  5AY8 B;  4X23 A;  3O62 C;  3REK A;  3LEL A;  5BNV A;  5GSU C;  1P3M D;  5B2J B;  3MGS A;  1P3O B;  1N1J A;  2L5A A;  5CPI D;  4G92 B;  3AZE A;  3WKJ A;  1M18 B;  2G5I C;  3AZJ B;  1HQ3 A;  4DRB A;  1KX4 D;  2Y2G A;  5GT0 C;  3REI D;  2BYK A;  2W8S A;  5B1L C;  4QLC D;  3UT9 B;  3WA9 C;  3AZM B;  5AV5 A;  5GXQ D;  4H9R A;  5AV5 D;  3AFA D;  1P3K C;  5B1M C;  1AOI A;  4Z5T A;  4ZUX D;  3AZK C;  1B67 A;  3B0C W;  1U35 D;  4J8W C;  3X1S A;  5B33 D;  5DNN C;  3WKJ D;  1TZY D;  5AVB C;  1P3A A;  2ARO D;  3MVD A;  3AZN B;  1KX3 A;  3R45 B;  3EG5 B;  3A6N B;  5B1L A;  1P3P D;  5B31 C;  3MNN C;  2Y2H A;  3UT9 A;  2J8P A;  3WAA B;  3X1U A;  1T3U A;  3AYW D;  1F66 B;  3WTP A;  3W99 C;  5AV9 B;  4ZBJ C;  3KXB A;  5B1M A;  1AOI C;  1P3L C;  5B32 D;  4KUD D;  3AZF B;  3REK C;  1KX3 B;  3AZN A;  3VH6 W;  1A7W A;  4WU9 C;  3REJ D;  3MNN D;  3X1T B;  1ID3 B;  5JA4 B;  1U35 B;  4J8U B;  3TU4 A;  3AYW C;  3AV2 B;  5B0Y D;  4ZUX B;  1HQ3 C;  3B0B A;  4G91 B;  3X1S B;  4WU8 D;  1P3I B;  5AY8 D;  5DNM A;  3AZL A;  5B24 C;  3AZN D;  1P3B D;  3LJA D;  1M1A A;  4EO5 B;  2ARO A;  5AV6 B;  3MVD D;  4YM6 B;  5B32 G;  2CV5 C;  3AZH B;  4WU8 C;  1TZY B;  2Y2K A;  5B33 A;  3UTB A;  4J8X B;  3VH5 A;  3B0D C;  5CHL B;  2BYK B;  4CSR B;  5CPJ B;  5GXQ B;  2NZD D;  3KUY D;  2PYO D;  3KUY C;  2PYO C;  5F99 C;  4H9O A;  3KWQ C;  4QLC B;  4J8V D;  1M18 A;  3AZE B;  1TAF A;  4H9Q A;  2FFF B;  2Y2M A;  5B0Y B;  3REH B;  3W98 D;  1ZLA C;  5B31 G;  5B2J A;  5BNV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...