5GT3D

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
RTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3D00
4J8WD 4WNNB 1P3FB 4NFTA 5CPKB 4WU8D 3C1BC 1P3ID 3UT9D 3MGQA 2HUEC 5AY8A 3AZEB 5AV9D 4WU8A 3X1SC 4JJNA 3W96D 3UTAB 3X1UB 4J8WC 1U35B 3UTBA 4EO5C 1P3PA 4H9RB 4J8XA 4M6BA 3C1CA 4YS3C 1P3AD 1P3LB 1KX5B 3MGRB 1TZYC 3W98A 2YFVA 4Z5TB 5GT3C 2HUEB 4Z66B 3WAAA 4J8VA 5B2ID 3AV1D 3REIC 4XZQD 3LELB 4KUDC 3MNNA 5CPID 2AROD 4AWLC 4ZUXC 5GT3D 3TU4A 1P34B 2AROA 4CSRA 3LZ1A 3UT9A 3LELA 5F99C 5GT3B 4HGAC 2CV5A 3MGSC 3AZNB 3NQJA 3REKB 5CPIB 1ID3A 3AZGD 4Z5TD 5B32C 2HIOB 5AY8B 1F66C 1P3LC 1TZYB 1AOIC 5BO0B 1KX5C 1F1EA 3AZFC 1KX3B 1TAFB 2NZDB 4Z5TC 4R8PC 4J8UC 3W96B 1S32A 3UTAC 3AZED 3AZNC 3V9RA 2BYMA 3X1UC 4CAYA 4LD9C 3AYWA 4WU8B 3AV2A 4DRAA 2F8NH 3B6GB 5DNMA 4X23D 3TU4D 3AZJA 3LZ1D 5E5AD 5CPKD 3KWQC 3VH6T 5AVCC 4YS3A 5AV6A 2PYOD 3B0DC 5AVBD 4X23C 3WA9C 1S32B 5B24B 3REHB 3W97B 3AZMA 4J8VC 5C3IB 2F8NG 1P3AC 1P3GA 5BNXA 3MGPC 3WTPB 2LY8A 3AZMD 3AZKA 3KXBA 5B2JC 2F8NB 3KUYD 5GSUA 3UT9C 4XZQC 2CV5C 5AV5A 5BNVA 1P3FC 1KX4D 5KDMB 5AV6B 5B32A 5B1MB 1F66A 2PYOC 4R8PB 4J8UB 1P3LA 4QLCC 3AZND 3AV2D 5GXQC 3MGQB 3W97C 2RVQD 1S32C 5AV9C 4YS3B 3AZNA 4CAYB 1ZLAA 1H3OB 4LD9A 4XUJD 3A6ND 4G92C 5B1LC 2FJ7C 3C1CB 5AVCB 3AZHA 5JRGD 3LELD 3REJA 3REKC 3VH5T 5DNMC 3AZJC 5B2JB 1ZLAB 3B0DB 3B6FD 3AZIB 1KX4C 5GT0C 1P3BA 1P34C 5AY8D 1P3AB 5B2IC 3AZGB 5AV6C 3AV1C 4KUDD 5B32D 4XUJB 3A6NB 5E5AC 1JFIA 4H9SC 5GSUD 1P34D 1P3GC 1P3AA 5B0ZD 4H9PA 5AVBC 1P3IB 3X1TB 3AZKC 3MNNB 5B40A 5B2JA 1P3FD 5CP6A 1M19A 3B6FA 5FUGA 1KX3C 5GSUC 2YFWA 1P3BB 5AV5C 4Z66D 3X1SD 5DNNA 3MGRA 4QLCD 5AY8C 2HIOC 1M1AA 5CPKC 4ZUXB 2YFWB 3AN2B 2F8ND 4H9OA 5DNND 4J8WA 3WAAB 4QLCA 2NQBB 3AZHD 4KGCC 3C1CC 3LJAA 3MGPB 3WA9D 4WNNA 5GXQA 4G92B 1P3GD 5BO0A 5B1LD 3AN2A 5CPJA 1P3MB 3AFAD 1ZLAC 2IO5C 5B32G 5DNMB 3AZJB 4ZBJC 5B0ZA 5AVBB 2F8NK 5GT0D 3C1CD 3REJC 3REKA 4JJNB 3MNNC 3B0CW 5B33D 4Z66C 2JSSA 5AV5B 5E5AB 5GT0A 4XUJC 3A6NC 3MGSD 1P3BC 3TU4B 1P34A 2YFVB 3LELC 4YM6B 1P3PD 4EO5B 5E5AA 1AOID 3RELA 5AV8B 2FJ7B 1KX3D 4G91C 3LZ0B 3AZLD 1TZYD 5B40C 5CP6C 1M19C 3B6FC 3KUYB 1F66B 5GXQB 2HIOD 3X1UA 3REKD 5DNNC 5B33A 3LJAD 3AYWC 3AV2C 1P3PB 4KGCB 2HIOA 3W99D 4H9OB 4WU9D 3AN2D 1M1AC 4ZUXD 5BS7C 3W97D 1P3IA 5B31A 3X1VC 1EQZC 5B33B 4H9NA 3B6GC 3W96A 4JJND 5AVCA 3LJAC 3AYWD 5CPJB 1P3MA 3MVDD 5B2IB 3AZGC 3AV1B 5DNMD 4X23A 3AZJD 3MNND 3AFAB 5B0ZC 1P3MD 5B40D 1HQ3B 1BH9A 5B0YC 4UUZB 3AZMC 3B0BA 3B6GD 1KX5D 3AZFD 3KUYC 4Z2MG 4Z66A 2NZDA 3WAAD 1U35D 4XUJA 3A6NA 3O62B 3KXBC 3X1UD 3AZFB 2NZDD 3O62D 1P3KC 4J8XB 3KWQB 3WKJA 3X1TA 5B24A 3REHA 3B0CT 3AZLC 1U35C 4WV4B 3RELC 1HQ3D 5CPJD 3R45B 5G49B 5JRGB 5AVCD 1R4VA 2NQBC 1WWSA 4H9RA 3REID 3UTBB 5B0YD 3AFAC 3AYWB 3W97A 5JA4A 5B31D 4WU9B 3W99B 4J8VD 5BNVB 1H3OA 4E45A 4KUDB 5B33C 3MGQC 3RELB 3AZHC 3AZEA 5CP6D 3X1VD 5CHLB 3O62C 3KXBB 1P3KD 1M19D 5BS7A 4JJNC 4E44A 3AZKB 1M18C 3W98D 4H9QB 5B31C 3UTBC 5AV6D 1ZLAD 4NE6A 5AV8C 2CV5D 3X1VA 1EQZA 1F66D 1B67A 3B6GA 3W96C 1P3LD 5BT1C 3W99C 4WU9C 1P3MC 4J8UA 3AZGA 5KDMA 1M18D 3W98C 3AZLB 3LZ0D 5GT3A 2CV5B 1HQ3A 4YS3D 3UTAD 3NQJB 3WAAC 1P3OA 3AZKD 4WZSB 4KHAB 3REIA 4YM6A 3KXBD 3MVDC 1P3KB 5BT1D 3KUYA 3MGSB 5G49A 1A7WA 5B24D 5JRGA 3WTPE 1KU5A 5AV5D 3REHD 1S32D 3TU4C 2AROC 1P3OB 3LZ1C 5F99A 5GT0B 3AZIC 1KX4B 3UTBD 3WKJC 1BH9B 1M18B 3REJB 3X1TC 3MGRC 1ID3C 5C3IC 5F99D 5CPKA 5B1LB 3AZMB 3WTPD 3NQUA 4KGCA 3LZ0A 5CP6B 1M19B 3B6FB 3MGPD 3RELD 5CPIA 3AN2C 3UTAA 2CWEA 5CPJC 1M1AD 1WWIA 2F8NA 2NQBD 5DNNB 4Z2MH 2BYKA 3X1SB 3AZEC 3R45A 1P3BD 4H9NB 3O62A 1M18A 5FUGB 3REIB 4LD9D 5B40B 3WKJD 5B1MA 3X1TD 5AV8A 1BH8A 3KWQA 3WKJB 3V9RB 4WU9A 3W99A 3MVDB 1ID3B 5GSUB 3VH6A 1BFMA 2L5AA 3WTPC 3KWQD 4HGAB 3WA9A 1HQ3C 2RVQC 5B0ZB 4J8XD 1Q9CA 5B32B 2AROB 1P3OC 4YM6C 4XZQB 3MVDA 5BNXB 4KGCD 3LJAB 3MGPA 5JRGC 3AZID 1ULYA 3MGRD 3NQUB 4XZQA 1BH8B 3VH5A 3VH6W 3AZIA 3C1BA 1TAFA 5B2JD 3REJD 1P3FA 2IO5B 4KHAA 5AV8D 2BYKB 3X1SA 4WU8C 1N1JA 5AV9B 2BYMB 4NE3A 1P3IC 1AOIB 2PYOA 4UUZA 5JA4B 3AV2B 1P3PC 4J8XC 1ID3D 3MGQD 4G91B 3LZ0C 4YM6D 4J8WB 5CPIC 5AV9A 1TZYA 5B1MD 4R8PD 4J8UD 4LD9B 5GXQD 5B1LA 5B0YA 2FJ7A 4NE5A 3C1BB 4KUDA 4H9PB 1B6WA 2NZDC 5B1MC 1HTAA 2FJ7D 1KX4A 4ZUXA 1N1JB 1M1AB 3W98B 5B31G 1P3KA 1P3GB 3X1VB 5B2IA 3AV1A 1EQZB 3WA9B 4AWLB 3UT9B 3AZHB 3MGSA 3WTPA 3KSYA 5B24C 3REHC 4H9SA 4J8VB 1JFIB 3AZLA 1U35A 5B31B 4DRBA 5F99B 3C1BD 5B0YB 4QLCB 2NQBA 5AVBA 1AOIA 2PYOB 1KX5A 3AZFA 4CSRB 3LZ1B 4ZBJB 3AFAA 4H9QA 1EQZD 3VH5W 4Z5TA 4X23B 1P3OD 4R8PA 1KX3A
chains in the Genus database with same CATH superfamily
4J8WD 4WNNB 1P3FB 4NFTA 5CPKB 4WU8D 3C1BC 1P3ID 3UT9D 3MGQA 2HUEC 5AY8A 3AZEB 5AV9D 4WU8A 3X1SC 4JJNA 3W96D 3UTAB 2Y2HA 3X1UB 4J8WC 1U35B 3UTBA 4EO5C 1P3PA 4H9RB 4J8XA 2Y2MA 4M6BA 3C1CA 4YS3C 1P3AD 1P3LB 1KX5B 3MGRB 3KFUG 1TZYC 2G5IC 3W98A 2YFVA 4Z5TB 5GT3C 2HUEB 1Z2CB 4Z66B 3P5JB 3F6TA 3WAAA 2W8SA 4J8VA 5B2ID 3AV1D 3REIC 4XZQD 3LELB 4KUDC 3MNNA 5CPID 2AROD 4AWLC 4ZUXC 5GT3D 3TU4A 1P34B 2AROA 3IP4C 4CSRA 3LZ1A 3UT9A 3LELA 5F99C 5GT3B 4HGAC 2CV5A 2Y2QA 3MGSC 3AZNB 3NQJA 3REKB 5CPIB 1ID3A 3AZGD 4Z5TD 5B32C 2HIOB 5AY8B 3EG5B 1F66C 3AL0C 2F2AC 1P3LC 2Y2GA 1TZYB 1AOIC 5BO0B 1KX5C 1F1EA 3AZFC 1KX3B 1TAFB 2NZDB 4Z5TC 3EPKA 4R8PC 4J8UC 3W96B 1S32A 3UTAC 3AZED 3AZNC 3V9RA 2BYMA 3X1UC 4CAYA 4LD9C 3AYWA 4WU8B 3AV2A 4DRAA 2XD5A 2F8NH 3B6GB 5DNMA 4X23D 3TU4D 3AZJA 3LZ1D 3EPJA 5E5AD 5CPKD 3KWQC 2ZY5A 3VH6T 5AVCC 4YS3A 3FDDA 5AV6A 2PYOD 3B0DC 5AVBD 4X23C 2Y2OA 3WA9C 1S32B 5B24B 3REHB 3W97B 3AZMA 4J8VC 5C3IB 2F8NG 1P3AC 1P3GA 5BNXA 3MGPC 3WTPB 2LY8A 3AZMD 3A1IA 3AZKA 3KXBA 5B2JC 2F8NB 3KUYD 5GSUA 3UT9C 4XZQC 2FFFB 2CV5C 2Y2PA 5AV5A 5BNVA 1P3FC 1KX4D 5KDMB 5AV6B 5B32A 5B1MB 3H0MC 1F66A 2PYOC 4R8PB 4J8UB 1P3LA 4QLCC 3AZND 3AV2D 5GXQC 3MGQB 3W97C 2RVQD 1S32C 5AV9C 4YS3B 3AZNA 4CAYB 1ZLAA 1H3OB 4LD9A 4XUJD 3A6ND 4G92C 5B1LC 2FJ7C 3C1CB 5AVCB 3AZHA 5JRGD 3LELD 3REJA 3REKC 3VH5T 5DNMC 3AZJC 5B2JB 4WJ3C 1ZLAB 3B0DB 3B6FD 3AZIB 1KX4C 5GT0C 1P3BA 1P34C 5AY8D 1P3AB 5B2IC 3AZGB 5AV6C 3AV1C 4KUDD 5B32D 4XUJB 3A6NB 5E5AC 1JFIA 2UWXA 4H9SC 5GSUD 1P34D 2ZY3A 1P3GC 1P3AA 5B0ZD 4H9PA 5AVBC 1P3IB 3X1TB 3AZKC 3MNNB 2VQRA 5B40A 5B2JA 1P3FD 5CP6A 1M19A 3B6FA 5FUGA 1KX3C 5GSUC 2YFWA 1P3BB 5AV5C 4Z66D 3X1SD 5DNNA 3MGRA 4QLCD 5AY8C 2HIOC 1M1AA 5CPKC 4ZUXB 2JCHA 2YFWB 2ZY2A 4H9OA 3AN2B 5DNND 2F8ND 1T3UA 4J8WA 3WAAB 2XD1A 4QLCA 2NQBB 3AZHD 4KGCC 3C1CC 3LJAA 3MGPB 3WA9D 4WNNA 5GXQA 4G92B 1P3GD 5BO0A 5B1LD 3AN2A 5CPJA 1P3MB 3AFAD 1ZLAC 2IO5C 5B32G 5DNMB 3AZJB 4ZBJC 3EPHA 3H0LC 5B0ZA 5AVBB 2F8NK 5GT0D 3C1CD 3REJC 3REKA 4JJNB 3MNNC 3B0CW 5B33D 4Z66C 2JSSA 5AV5B 5E5AB 2RIQA 5GT0A 4XUJC 3A6NC 3MGSD 1P3BC 3TU4B 1P34A 2YFVB 3LELC 4YM6B 1P3PD 4EO5B 5E5AA 1AOID 3RELA 5AV8B 2FJ7B 1KX3D 4G91C 3LZ0B 3AZLD 1TZYD 5B40C 5CP6C 1M19C 3B6FC 3KUYB 1F66B 5GXQB 2HIOD 3X1UA 3REKD 5DNNC 5B33A 3LJAD 3AYWC 3AV2C 1P3PB 4KGCB 2HIOA 3W99D 4H9OB 4WU9D 3AN2D 1M1AC 4ZUXD 5BS7C 3W97D 1P3IA 5B31A 3X1VC 1EQZC 5B33B 4H9NA 3B6GC 3W96A 4JJND 5AVCA 3LJAC 3AYWD 5CPJB 1P3MA 3MVDD 5B2IB 3AZGC 3AV1B 5DNMD 4X23A 3AZJD 3MNND 3AFAB 5B0ZC 1P3MD 5B40D 1HQ3B 1BH9A 5B0YC 4UUZB 3AZMC 3B0BA 3B6GD 1KX5D 3AZFD 3KUYC 4Z2MG 4Z66A 2NZDA 3WAAD 1U35D 4XUJA 3A6NA 3O62B 3KXBC 3X1UD 3AZFB 2NZDD 3O62D 1P3KC 4J8XB 3KWQB 3WKJA 3X1TA 5B24A 3REHA 3B0CT 3AZLC 1U35C 4WV4B 3RELC 1HQ3D 5CPJD 3R45B 5G49B 5JRGB 5AVCD 1R4VA 2NQBC 1W2EA 1WWSA 4H9RA 3REID 3UTBB 5B0YD 3AFAC 2ZY4A 3AYWB 3W97A 5JA4A 5B31D 4WU9B 3W99B 4J8VD 5BNVB 1H3OA 4E45A 4KUDB 5B33C 3MGQC 3RELB 3AZHC 3AZEA 5CP6D 3X1VD 5CHLB 3O62C 3KXBB 1P3KD 1M19D 5BS7A 4JJNC 4E44A 3AZKB 1M18C 3W98D 4H9QB 2J8PA 5B31C 3UTBC 5AV6D 1ZLAD 4NE6A 5AV8C 2CV5D 3X1VA 1EQZA 1F66D 1B67A 3B6GA 3W96C 1P3LD 5BT1C 3W99C 4WU9C 1P3MC 4J8UA 3AZGA 5KDMA 1M18D 3W98C 3AZLB 3H0RC 3LZ0D 5GT3A 2CV5B 1HQ3A 4YS3D 3UTAD 3NQJB 3WAAC 1P3OA 3AZKD 4WZSB 4KHAB 3REIA 4YM6A 2DQNC 3KXBD 3MVDC 5BT1D 2ZM5A 1P3KB 3KUYA 3MGSB 5G49A 1A7WA 5B24D 5JRGA 3WTPE 1KU5A 5AV5D 3REHD 1S32D 3TU4C 2AROC 1P3OB 3LZ1C 5F99A 5GT0B 2DF4C 3AZIC 1KX4B 3UTBD 3WKJC 1BH9B 1M18B 2Y2LA 3REJB 3X1TC 3MGRC 1ID3C 5C3IC 5F99D 3A1KA 5CPKA 5B1LB 3AZMB 3WTPD 3NQUA 4KGCA 3LZ0A 5CP6B 1M19B 3B6FB 3MGPD 3RELD 5CPIA 3AN2C 3UTAA 2CWEA 5CPJC 1M1AD 1WWIA 2F8NA 2NQBD 5DNNB 4Z2MH 2BYKA 3X1SB 2G5HC 3AZEC 3R45A 1P3BD 4H9NB 3O62A 1M18A 5FUGB 3REIB 4LD9D 5B40B 3WKJD 5B1MA 4UPKA 3X1TD 5AV8A 2JE5A 1BH8A 3KWQA 3WKJB 3V9RB 4WU9A 3W99A 3MVDB 1ID3B 5GSUB 3VH6A 1BFMA 2L5AA 3WTPC 3KWQD 4HGAB 3WA9A 1HQ3C 2RVQC 5B0ZB 4J8XD 1Q9CA 5B32B 2AROB 1P3OC 4YM6C 4XZQB 3MVDA 5BNXB 4KGCD 3LJAB 3MGPA 5JRGC 3AZID 1ULYA 2Y2NA 3MGRD 3NQUB 4XZQA 1BH8B 3VH5A 3VH6W 3AZIA 3C1BA 1TAFA 5B2JD 2Y2KA 3REJD 1P3FA 2IO5B 2Y2IA 4KHAA 5AV8D 2BYKB 3X1SA 4WU8C 1N1JA 5AV9B 2BYMB 4NE3A 1P3IC 1AOIB 2PYOA 4UUZA 5JA4B 3AV2B 1P3PC 4J8XC 1ID3D 3MGQD 4G91B 3LZ0C 4YM6D 4J8WB 5CPIC 5AV9A 1TZYA 5B1MD 4R8PD 4J8UD 4LD9B 5GXQD 5B1LA 5B0YA 2FJ7A 4NE5A 3C1BB 1PZRA 4DQYB 4KUDA 4H9PB 1B6WA 2NZDC 5B1MC 1HTAA 2FJ7D 1KX4A 2Y2JA 4ZUXA 1N1JB 1M1AB 3W98B 5B31G 1P3KA 1P3GB 3X1VB 5B2IA 3AV1A 1EQZB 3WA9B 4AWLB 3UT9B 3AZHB 3MGSA 3WTPA 3KSYA 5B24C 3REHC 4H9SA 4J8VB 1JFIB 3AZLA 1U35A 5B31B 4DRBA 5F99B 3C1BD 5B0YB 4QLCB 2NQBA 5AVBA 1AOIA 2PYOB 1KX5A 2BG1A 3EPLA 3AZFA 4CSRB 3LZ1B 4ZBJB 3AFAA 4H9QA 1EQZD 3VH5W 4Z5TA 4X23B 1P3OD 4R8PA 1KX3A
chains in the Genus database with same CATH topology
4J8WD 4WNNB 1P3FB 4NFTA 5CPKB 4WU8D 3C1BC 1P3ID 3UT9D 3MGQA 2HUEC 5AY8A 3AZEB 5AV9D 4WU8A 3X1SC 4JJNA 3W96D 3UTAB 2Y2HA 3X1UB 4J8WC 1U35B 3UTBA 4EO5C 1P3PA 4H9RB 4J8XA 2Y2MA 4M6BA 3C1CA 4YS3C 1P3AD 1P3LB 1KX5B 3MGRB 3KFUG 1TZYC 2G5IC 3W98A 2YFVA 4Z5TB 5GT3C 2HUEB 1Z2CB 4Z66B 3P5JB 3F6TA 3WAAA 2W8SA 4J8VA 5B2ID 3AV1D 3REIC 4XZQD 3LELB 4KUDC 3MNNA 5CPID 2AROD 4AWLC 4ZUXC 5GT3D 3TU4A 1P34B 2AROA 3IP4C 4CSRA 3LZ1A 3UT9A 3LELA 5F99C 5GT3B 4HGAC 2CV5A 2Y2QA 3MGSC 3AZNB 3NQJA 3REKB 5CPIB 1ID3A 3AZGD 4Z5TD 5B32C 2HIOB 5AY8B 3EG5B 1F66C 3AL0C 2F2AC 1P3LC 2Y2GA 1TZYB 1AOIC 5BO0B 1KX5C 1F1EA 3AZFC 1KX3B 1TAFB 2NZDB 4Z5TC 3EPKA 4R8PC 4J8UC 3W96B 1S32A 3UTAC 3AZED 3AZNC 3V9RA 2BYMA 3X1UC 4CAYA 4LD9C 3AYWA 4WU8B 3AV2A 4DRAA 2XD5A 2F8NH 3B6GB 5DNMA 4X23D 3TU4D 3AZJA 3LZ1D 3EPJA 5E5AD 5CPKD 3KWQC 2ZY5A 3VH6T 5AVCC 4YS3A 3FDDA 5AV6A 2PYOD 3B0DC 5AVBD 4X23C 2Y2OA 3WA9C 1S32B 5B24B 3REHB 3W97B 3AZMA 4J8VC 5C3IB 2F8NG 1P3AC 1P3GA 5BNXA 3MGPC 3WTPB 2LY8A 3AZMD 3A1IA 3AZKA 3KXBA 5B2JC 2F8NB 3KUYD 5GSUA 3UT9C 4XZQC 2FFFB 2CV5C 2Y2PA 5AV5A 5BNVA 1P3FC 1KX4D 5KDMB 5AV6B 5B32A 5B1MB 3H0MC 1F66A 2PYOC 4R8PB 4J8UB 1P3LA 4QLCC 3AZND 3AV2D 5GXQC 3MGQB 3W97C 2RVQD 1S32C 5AV9C 4YS3B 3AZNA 4CAYB 1ZLAA 1H3OB 4LD9A 4XUJD 3A6ND 4G92C 5B1LC 2FJ7C 3C1CB 5AVCB 3AZHA 5JRGD 3LELD 3REJA 3REKC 3VH5T 5DNMC 3AZJC 5B2JB 4WJ3C 1ZLAB 3B0DB 3B6FD 3AZIB 1KX4C 5GT0C 1P3BA 1P34C 5AY8D 1P3AB 5B2IC 3AZGB 5AV6C 3AV1C 4KUDD 5B32D 4XUJB 3A6NB 5E5AC 1JFIA 2UWXA 4H9SC 5GSUD 1P34D 2ZY3A 1P3GC 1P3AA 5B0ZD 4H9PA 5AVBC 1P3IB 3X1TB 3AZKC 3MNNB 2VQRA 5B40A 5B2JA 1P3FD 5CP6A 1M19A 3B6FA 5FUGA 1KX3C 5GSUC 2YFWA 1P3BB 5AV5C 4Z66D 3X1SD 5DNNA 3MGRA 4QLCD 5AY8C 2HIOC 1M1AA 5CPKC 4ZUXB 2JCHA 2YFWB 2ZY2A 4H9OA 3AN2B 5DNND 2F8ND 1T3UA 4J8WA 3WAAB 2XD1A 4QLCA 2NQBB 3AZHD 4KGCC 3C1CC 3LJAA 3MGPB 3WA9D 4WNNA 5GXQA 4G92B 1P3GD 5BO0A 5B1LD 3AN2A 5CPJA 1P3MB 3AFAD 1ZLAC 2IO5C 5B32G 5DNMB 3AZJB 4ZBJC 3EPHA 3H0LC 5B0ZA 5AVBB 2F8NK 5GT0D 3C1CD 3REJC 3REKA 4JJNB 3MNNC 3B0CW 5B33D 4Z66C 2JSSA 5AV5B 5E5AB 2RIQA 5GT0A 4XUJC 3A6NC 3MGSD 1P3BC 3TU4B 1P34A 2YFVB 3LELC 4YM6B 1P3PD 4EO5B 5E5AA 1AOID 3RELA 5AV8B 2FJ7B 1KX3D 4G91C 3LZ0B 3AZLD 1TZYD 5B40C 5CP6C 1M19C 3B6FC 3KUYB 1F66B 5GXQB 2HIOD 3X1UA 3REKD 5DNNC 5B33A 3LJAD 3AYWC 3AV2C 1P3PB 4KGCB 2HIOA 3W99D 4H9OB 4WU9D 3AN2D 1M1AC 4ZUXD 5BS7C 3W97D 1P3IA 5B31A 3X1VC 1EQZC 5B33B 4H9NA 3B6GC 3W96A 4JJND 5AVCA 3LJAC 3AYWD 5CPJB 1P3MA 3MVDD 5B2IB 3AZGC 3AV1B 5DNMD 4X23A 3AZJD 3MNND 3AFAB 5B0ZC 1P3MD 5B40D 1HQ3B 1BH9A 5B0YC 4UUZB 3AZMC 3B0BA 3B6GD 1KX5D 3AZFD 3KUYC 4Z2MG 4Z66A 2NZDA 3WAAD 1U35D 4XUJA 3A6NA 3O62B 3KXBC 3X1UD 3AZFB 2NZDD 3O62D 1P3KC 4J8XB 3KWQB 3WKJA 3X1TA 5B24A 3REHA 3B0CT 3AZLC 1U35C 4WV4B 3RELC 1HQ3D 5CPJD 3R45B 5G49B 5JRGB 5AVCD 1R4VA 2NQBC 1W2EA 1WWSA 4H9RA 3REID 3UTBB 5B0YD 3AFAC 2ZY4A 3AYWB 3W97A 5JA4A 5B31D 4WU9B 3W99B 4J8VD 5BNVB 1H3OA 4E45A 4KUDB 5B33C 3MGQC 3RELB 3AZHC 3AZEA 5CP6D 3X1VD 5CHLB 3O62C 3KXBB 1P3KD 1M19D 5BS7A 4JJNC 4E44A 3AZKB 1M18C 3W98D 4H9QB 2J8PA 5B31C 3UTBC 5AV6D 1ZLAD 4NE6A 5AV8C 2CV5D 3X1VA 1EQZA 1F66D 1B67A 3B6GA 3W96C 1P3LD 5BT1C 3W99C 4WU9C 1P3MC 4J8UA 3AZGA 5KDMA 1M18D 3W98C 3AZLB 3H0RC 3LZ0D 5GT3A 2CV5B 1HQ3A 4YS3D 3UTAD 3NQJB 3WAAC 1P3OA 3AZKD 4WZSB 4KHAB 3REIA 4YM6A 2DQNC 3KXBD 3MVDC 5BT1D 2ZM5A 1P3KB 3KUYA 3MGSB 5G49A 1A7WA 5B24D 5JRGA 3WTPE 1KU5A 5AV5D 3REHD 1S32D 3TU4C 2AROC 1P3OB 3LZ1C 5F99A 5GT0B 2DF4C 3AZIC 1KX4B 3UTBD 3WKJC 1BH9B 1M18B 2Y2LA 3REJB 3X1TC 3MGRC 1ID3C 5C3IC 5F99D 3A1KA 5CPKA 5B1LB 3AZMB 3WTPD 3NQUA 4KGCA 3LZ0A 5CP6B 1M19B 3B6FB 3MGPD 3RELD 5CPIA 3AN2C 3UTAA 2CWEA 5CPJC 1M1AD 1WWIA 2F8NA 2NQBD 5DNNB 4Z2MH 2BYKA 3X1SB 2G5HC 3AZEC 3R45A 1P3BD 4H9NB 3O62A 1M18A 5FUGB 3REIB 4LD9D 5B40B 3WKJD 5B1MA 4UPKA 3X1TD 5AV8A 2JE5A 1BH8A 3KWQA 3WKJB 3V9RB 4WU9A 3W99A 3MVDB 1ID3B 5GSUB 3VH6A 1BFMA 2L5AA 3WTPC 3KWQD 4HGAB 3WA9A 1HQ3C 2RVQC 5B0ZB 4J8XD 1Q9CA 5B32B 2AROB 1P3OC 4YM6C 4XZQB 3MVDA 5BNXB 4KGCD 3LJAB 3MGPA 5JRGC 3AZID 1ULYA 2Y2NA 3MGRD 3NQUB 4XZQA 1BH8B 3VH5A 3VH6W 3AZIA 3C1BA 1TAFA 5B2JD 2Y2KA 3REJD 1P3FA 2IO5B 2Y2IA 4KHAA 5AV8D 2BYKB 3X1SA 4WU8C 1N1JA 5AV9B 2BYMB 4NE3A 1P3IC 1AOIB 2PYOA 4UUZA 5JA4B 3AV2B 1P3PC 4J8XC 1ID3D 3MGQD 4G91B 3LZ0C 4YM6D 4J8WB 5CPIC 5AV9A 1TZYA 5B1MD 4R8PD 4J8UD 4LD9B 5GXQD 5B1LA 5B0YA 2FJ7A 4NE5A 3C1BB 1PZRA 4DQYB 4KUDA 4H9PB 1B6WA 2NZDC 5B1MC 1HTAA 2FJ7D 1KX4A 2Y2JA 4ZUXA 1N1JB 1M1AB 3W98B 5B31G 1P3KA 1P3GB 3X1VB 5B2IA 3AV1A 1EQZB 3WA9B 4AWLB 3UT9B 3AZHB 3MGSA 3WTPA 3KSYA 5B24C 3REHC 4H9SA 4J8VB 1JFIB 3AZLA 1U35A 5B31B 4DRBA 5F99B 3C1BD 5B0YB 4QLCB 2NQBA 5AVBA 1AOIA 2PYOB 1KX5A 2BG1A 3EPLA 3AZFA 4CSRB 3LZ1B 4ZBJB 3AFAA 4H9QA 1EQZD 3VH5W 4Z5TA 4X23B 1P3OD 4R8PA 1KX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W D;  4WNN B;  1P3F B;  4NFT A;  5CPK B;  4WU8 D;  3C1B C;  1P3I D;  3UT9 D;  3MGQ A;  2HUE C;  5AY8 A;  3AZE B;  5AV9 D;  4WU8 A;  3X1S C;  4JJN A;  3W96 D;  3UTA B;  3X1U B;  4J8W C;  1U35 B;  3UTB A;  4EO5 C;  1P3P A;  4H9R B;  4J8X A;  4M6B A;  3C1C A;  4YS3 C;  1P3A D;  1P3L B;  1KX5 B;  3MGR B;  1TZY C;  3W98 A;  2YFV A;  4Z5T B;  5GT3 C;  2HUE B;  4Z66 B;  3WAA A;  4J8V A;  5B2I D;  3AV1 D;  3REI C;  4XZQ D;  3LEL B;  4KUD C;  3MNN A;  5CPI D;  2ARO D;  4AWL C;  4ZUX C;  5GT3 D;  3TU4 A;  1P34 B;  2ARO A;  4CSR A;  3LZ1 A;  3UT9 A;  3LEL A;  5F99 C;  5GT3 B;  4HGA C;  2CV5 A;  3MGS C;  3AZN B;  3NQJ A;  3REK B;  5CPI B;  1ID3 A;  3AZG D;  4Z5T D;  5B32 C;  2HIO B;  5AY8 B;  1F66 C;  1P3L C;  1TZY B;  1AOI C;  5BO0 B;  1KX5 C;  1F1E A;  3AZF C;  1KX3 B;  1TAF B;  2NZD B;  4Z5T C;  4R8P C;  4J8U C;  3W96 B;  1S32 A;  3UTA C;  3AZE D;  3AZN C;  3V9R A;  2BYM A;  3X1U C;  4CAY A;  4LD9 C;  3AYW A;  4WU8 B;  3AV2 A;  4DRA A;  2F8N H;  3B6G B;  5DNM A;  4X23 D;  3TU4 D;  3AZJ A;  3LZ1 D;  5E5A D;  5CPK D;  3KWQ C;  3VH6 T;  5AVC C;  4YS3 A;  5AV6 A;  2PYO D;  3B0D C;  5AVB D;  4X23 C;  3WA9 C;  1S32 B;  5B24 B;  3REH B;  3W97 B;  3AZM A;  4J8V C;  5C3I B;  2F8N G;  1P3A C;  1P3G A;  5BNX A;  3MGP C;  3WTP B;  2LY8 A;  3AZM D;  3AZK A;  3KXB A;  5B2J C;  2F8N B;  3KUY D;  5GSU A;  3UT9 C;  4XZQ C;  2CV5 C;  5AV5 A;  5BNV A;  1P3F C;  1KX4 D;  5KDM B;  5AV6 B;  5B32 A;  5B1M B;  1F66 A;  2PYO C;  4R8P B;  4J8U B;  1P3L A;  4QLC C;  3AZN D;  3AV2 D;  5GXQ C;  3MGQ B;  3W97 C;  2RVQ D;  1S32 C;  5AV9 C;  4YS3 B;  3AZN A;  4CAY B;  1ZLA A;  1H3O B;  4LD9 A;  4XUJ D;  3A6N D;  4G92 C;  5B1L C;  2FJ7 C;  3C1C B;  5AVC B;  3AZH A;  5JRG D;  3LEL D;  3REJ A;  3REK C;  3VH5 T;  5DNM C;  3AZJ C;  5B2J B;  1ZLA B;  3B0D B;  3B6F D;  3AZI B;  1KX4 C;  5GT0 C;  1P3B A;  1P34 C;  5AY8 D;  1P3A B;  5B2I C;  3AZG B;  5AV6 C;  3AV1 C;  4KUD D;  5B32 D;  4XUJ B;  3A6N B;  5E5A C;  1JFI A;  4H9S C;  5GSU D;  1P34 D;  1P3G C;  1P3A A;  5B0Z D;  4H9P A;  5AVB C;  1P3I B;  3X1T B;  3AZK C;  3MNN B;  5B40 A;  5B2J A;  1P3F D;  5CP6 A;  1M19 A;  3B6F A;  5FUG A;  1KX3 C;  5GSU C;  2YFW A;  1P3B B;  5AV5 C;  4Z66 D;  3X1S D;  5DNN A;  3MGR A;  4QLC D;  5AY8 C;  2HIO C;  1M1A A;  5CPK C;  4ZUX B;  2YFW B;  3AN2 B;  2F8N D;  4H9O A;  5DNN D;  4J8W A;  3WAA B;  4QLC A;  2NQB B;  3AZH D;  4KGC C;  3C1C C;  3LJA A;  3MGP B;  3WA9 D;  4WNN A;  5GXQ A;  4G92 B;  1P3G D;  5BO0 A;  5B1L D;  3AN2 A;  5CPJ A;  1P3M B;  3AFA D;  1ZLA C;  2IO5 C;  5B32 G;  5DNM B;  3AZJ B;  4ZBJ C;  5B0Z A;  5AVB B;  2F8N K;  5GT0 D;  3C1C D;  3REJ C;  3REK A;  4JJN B;  3MNN C;  3B0C W;  5B33 D;  4Z66 C;  2JSS A;  5AV5 B;  5E5A B;  5GT0 A;  4XUJ C;  3A6N C;  3MGS D;  1P3B C;  3TU4 B;  1P34 A;  2YFV B;  3LEL C;  4YM6 B;  1P3P D;  4EO5 B;  5E5A A;  1AOI D;  3REL A;  5AV8 B;  2FJ7 B;  1KX3 D;  4G91 C;  3LZ0 B;  3AZL D;  1TZY D;  5B40 C;  5CP6 C;  1M19 C;  3B6F C;  3KUY B;  1F66 B;  5GXQ B;  2HIO D;  3X1U A;  3REK D;  5DNN C;  5B33 A;  3LJA D;  3AYW C;  3AV2 C;  1P3P B;  4KGC B;  2HIO A;  3W99 D;  4H9O B;  4WU9 D;  3AN2 D;  1M1A C;  4ZUX D;  5BS7 C;  3W97 D;  1P3I A;  5B31 A;  3X1V C;  1EQZ C;  5B33 B;  4H9N A;  3B6G C;  3W96 A;  4JJN D;  5AVC A;  3LJA C;  3AYW D;  5CPJ B;  1P3M A;  3MVD D;  5B2I B;  3AZG C;  3AV1 B;  5DNM D;  4X23 A;  3AZJ D;  3MNN D;  3AFA B;  5B0Z C;  1P3M D;  5B40 D;  1HQ3 B;  1BH9 A;  5B0Y C;  4UUZ B;  3AZM C;  3B0B A;  3B6G D;  1KX5 D;  3AZF D;  3KUY C;  4Z2M G;  4Z66 A;  2NZD A;  3WAA D;  1U35 D;  4XUJ A;  3A6N A;  3O62 B;  3KXB C;  3X1U D;  3AZF B;  2NZD D;  3O62 D;  1P3K C;  4J8X B;  3KWQ B;  3WKJ A;  3X1T A;  5B24 A;  3REH A;  3B0C T;  3AZL C;  1U35 C;  4WV4 B;  3REL C;  1HQ3 D;  5CPJ D;  3R45 B;  5G49 B;  5JRG B;  5AVC D;  1R4V A;  2NQB C;  1WWS A;  4H9R A;  3REI D;  3UTB B;  5B0Y D;  3AFA C;  3AYW B;  3W97 A;  5JA4 A;  5B31 D;  4WU9 B;  3W99 B;  4J8V D;  5BNV B;  1H3O A;  4E45 A;  4KUD B;  5B33 C;  3MGQ C;  3REL B;  3AZH C;  3AZE A;  5CP6 D;  3X1V D;  5CHL B;  3O62 C;  3KXB B;  1P3K D;  1M19 D;  5BS7 A;  4JJN C;  4E44 A;  3AZK B;  1M18 C;  3W98 D;  4H9Q B;  5B31 C;  3UTB C;  5AV6 D;  1ZLA D;  4NE6 A;  5AV8 C;  2CV5 D;  3X1V A;  1EQZ A;  1F66 D;  1B67 A;  3B6G A;  3W96 C;  1P3L D;  5BT1 C;  3W99 C;  4WU9 C;  1P3M C;  4J8U A;  3AZG A;  5KDM A;  1M18 D;  3W98 C;  3AZL B;  3LZ0 D;  5GT3 A;  2CV5 B;  1HQ3 A;  4YS3 D;  3UTA D;  3NQJ B;  3WAA C;  1P3O A;  3AZK D;  4WZS B;  4KHA B;  3REI A;  4YM6 A;  3KXB D;  3MVD C;  1P3K B;  5BT1 D;  3KUY A;  3MGS B;  5G49 A;  1A7W A;  5B24 D;  5JRG A;  3WTP E;  1KU5 A;  5AV5 D;  3REH D;  1S32 D;  3TU4 C;  2ARO C;  1P3O B;  3LZ1 C;  5F99 A;  5GT0 B;  3AZI C;  1KX4 B;  3UTB D;  3WKJ C;  1BH9 B;  1M18 B;  3REJ B;  3X1T C;  3MGR C;  1ID3 C;  5C3I C;  5F99 D;  5CPK A;  5B1L B;  3AZM B;  3WTP D;  3NQU A;  4KGC A;  3LZ0 A;  5CP6 B;  1M19 B;  3B6F B;  3MGP D;  3REL D;  5CPI A;  3AN2 C;  3UTA A;  2CWE A;  5CPJ C;  1M1A D;  1WWI A;  2F8N A;  2NQB D;  5DNN B;  4Z2M H;  2BYK A;  3X1S B;  3AZE C;  3R45 A;  1P3B D;  4H9N B;  3O62 A;  1M18 A;  5FUG B;  3REI B;  4LD9 D;  5B40 B;  3WKJ D;  5B1M A;  3X1T D;  5AV8 A;  1BH8 A;  3KWQ A;  3WKJ B;  3V9R B;  4WU9 A;  3W99 A;  3MVD B;  1ID3 B;  5GSU B;  3VH6 A;  1BFM A;  2L5A A;  3WTP C;  3KWQ D;  4HGA B;  3WA9 A;  1HQ3 C;  2RVQ C;  5B0Z B;  4J8X D;  1Q9C A;  5B32 B;  2ARO B;  1P3O C;  4YM6 C;  4XZQ B;  3MVD A;  5BNX B;  4KGC D;  3LJA B;  3MGP A;  5JRG C;  3AZI D;  1ULY A;  3MGR D;  3NQU B;  4XZQ A;  1BH8 B;  3VH5 A;  3VH6 W;  3AZI A;  3C1B A;  1TAF A;  5B2J D;  3REJ D;  1P3F A;  2IO5 B;  4KHA A;  5AV8 D;  2BYK B;  3X1S A;  4WU8 C;  1N1J A;  5AV9 B;  2BYM B;  4NE3 A;  1P3I C;  1AOI B;  2PYO A;  4UUZ A;  5JA4 B;  3AV2 B;  1P3P C;  4J8X C;  1ID3 D;  3MGQ D;  4G91 B;  3LZ0 C;  4YM6 D;  4J8W B;  5CPI C;  5AV9 A;  1TZY A;  5B1M D;  4R8P D;  4J8U D;  4LD9 B;  5GXQ D;  5B1L A;  5B0Y A;  2FJ7 A;  4NE5 A;  3C1B B;  4KUD A;  4H9P B;  1B6W A;  2NZD C;  5B1M C;  1HTA A;  2FJ7 D;  1KX4 A;  4ZUX A;  1N1J B;  1M1A B;  3W98 B;  5B31 G;  1P3K A;  1P3G B;  3X1V B;  5B2I A;  3AV1 A;  1EQZ B;  3WA9 B;  4AWL B;  3UT9 B;  3AZH B;  3MGS A;  3WTP A;  3KSY A;  5B24 C;  3REH C;  4H9S A;  4J8V B;  1JFI B;  3AZL A;  1U35 A;  5B31 B;  4DRB A;  5F99 B;  3C1B D;  5B0Y B;  4QLC B;  2NQB A;  5AVB A;  1AOI A;  2PYO B;  1KX5 A;  3AZF A;  4CSR B;  3LZ1 B;  4ZBJ B;  3AFA A;  4H9Q A;  1EQZ D;  3VH5 W;  4Z5T A;  4X23 B;  1P3O D;  4R8P A;  1KX3 A; 
#chains in the Genus database with same CATH topology
 4J8W D;  4WNN B;  1P3F B;  4NFT A;  5CPK B;  4WU8 D;  3C1B C;  1P3I D;  3UT9 D;  3MGQ A;  2HUE C;  5AY8 A;  3AZE B;  5AV9 D;  4WU8 A;  3X1S C;  4JJN A;  3W96 D;  3UTA B;  2Y2H A;  3X1U B;  4J8W C;  1U35 B;  3UTB A;  4EO5 C;  1P3P A;  4H9R B;  4J8X A;  2Y2M A;  4M6B A;  3C1C A;  4YS3 C;  1P3A D;  1P3L B;  1KX5 B;  3MGR B;  3KFU G;  1TZY C;  2G5I C;  3W98 A;  2YFV A;  4Z5T B;  5GT3 C;  2HUE B;  1Z2C B;  4Z66 B;  3P5J B;  3F6T A;  3WAA A;  2W8S A;  4J8V A;  5B2I D;  3AV1 D;  3REI C;  4XZQ D;  3LEL B;  4KUD C;  3MNN A;  5CPI D;  2ARO D;  4AWL C;  4ZUX C;  5GT3 D;  3TU4 A;  1P34 B;  2ARO A;  3IP4 C;  4CSR A;  3LZ1 A;  3UT9 A;  3LEL A;  5F99 C;  5GT3 B;  4HGA C;  2CV5 A;  2Y2Q A;  3MGS C;  3AZN B;  3NQJ A;  3REK B;  5CPI B;  1ID3 A;  3AZG D;  4Z5T D;  5B32 C;  2HIO B;  5AY8 B;  3EG5 B;  1F66 C;  3AL0 C;  2F2A C;  1P3L C;  2Y2G A;  1TZY B;  1AOI C;  5BO0 B;  1KX5 C;  1F1E A;  3AZF C;  1KX3 B;  1TAF B;  2NZD B;  4Z5T C;  3EPK A;  4R8P C;  4J8U C;  3W96 B;  1S32 A;  3UTA C;  3AZE D;  3AZN C;  3V9R A;  2BYM A;  3X1U C;  4CAY A;  4LD9 C;  3AYW A;  4WU8 B;  3AV2 A;  4DRA A;  2XD5 A;  2F8N H;  3B6G B;  5DNM A;  4X23 D;  3TU4 D;  3AZJ A;  3LZ1 D;  3EPJ A;  5E5A D;  5CPK D;  3KWQ C;  2ZY5 A;  3VH6 T;  5AVC C;  4YS3 A;  3FDD A;  5AV6 A;  2PYO D;  3B0D C;  5AVB D;  4X23 C;  2Y2O A;  3WA9 C;  1S32 B;  5B24 B;  3REH B;  3W97 B;  3AZM A;  4J8V C;  5C3I B;  2F8N G;  1P3A C;  1P3G A;  5BNX A;  3MGP C;  3WTP B;  2LY8 A;  3AZM D;  3A1I A;  3AZK A;  3KXB A;  5B2J C;  2F8N B;  3KUY D;  5GSU A;  3UT9 C;  4XZQ C;  2FFF B;  2CV5 C;  2Y2P A;  5AV5 A;  5BNV A;  1P3F C;  1KX4 D;  5KDM B;  5AV6 B;  5B32 A;  5B1M B;  3H0M C;  1F66 A;  2PYO C;  4R8P B;  4J8U B;  1P3L A;  4QLC C;  3AZN D;  3AV2 D;  5GXQ C;  3MGQ B;  3W97 C;  2RVQ D;  1S32 C;  5AV9 C;  4YS3 B;  3AZN A;  4CAY B;  1ZLA A;  1H3O B;  4LD9 A;  4XUJ D;  3A6N D;  4G92 C;  5B1L C;  2FJ7 C;  3C1C B;  5AVC B;  3AZH A;  5JRG D;  3LEL D;  3REJ A;  3REK C;  3VH5 T;  5DNM C;  3AZJ C;  5B2J B;  4WJ3 C;  1ZLA B;  3B0D B;  3B6F D;  3AZI B;  1KX4 C;  5GT0 C;  1P3B A;  1P34 C;  5AY8 D;  1P3A B;  5B2I C;  3AZG B;  5AV6 C;  3AV1 C;  4KUD D;  5B32 D;  4XUJ B;  3A6N B;  5E5A C;  1JFI A;  2UWX A;  4H9S C;  5GSU D;  1P34 D;  2ZY3 A;  1P3G C;  1P3A A;  5B0Z D;  4H9P A;  5AVB C;  1P3I B;  3X1T B;  3AZK C;  3MNN B;  2VQR A;  5B40 A;  5B2J A;  1P3F D;  5CP6 A;  1M19 A;  3B6F A;  5FUG A;  1KX3 C;  5GSU C;  2YFW A;  1P3B B;  5AV5 C;  4Z66 D;  3X1S D;  5DNN A;  3MGR A;  4QLC D;  5AY8 C;  2HIO C;  1M1A A;  5CPK C;  4ZUX B;  2JCH A;  2YFW B;  2ZY2 A;  4H9O A;  3AN2 B;  5DNN D;  2F8N D;  1T3U A;  4J8W A;  3WAA B;  2XD1 A;  4QLC A;  2NQB B;  3AZH D;  4KGC C;  3C1C C;  3LJA A;  3MGP B;  3WA9 D;  4WNN A;  5GXQ A;  4G92 B;  1P3G D;  5BO0 A;  5B1L D;  3AN2 A;  5CPJ A;  1P3M B;  3AFA D;  1ZLA C;  2IO5 C;  5B32 G;  5DNM B;  3AZJ B;  4ZBJ C;  3EPH A;  3H0L C;  5B0Z A;  5AVB B;  2F8N K;  5GT0 D;  3C1C D;  3REJ C;  3REK A;  4JJN B;  3MNN C;  3B0C W;  5B33 D;  4Z66 C;  2JSS A;  5AV5 B;  5E5A B;  2RIQ A;  5GT0 A;  4XUJ C;  3A6N C;  3MGS D;  1P3B C;  3TU4 B;  1P34 A;  2YFV B;  3LEL C;  4YM6 B;  1P3P D;  4EO5 B;  5E5A A;  1AOI D;  3REL A;  5AV8 B;  2FJ7 B;  1KX3 D;  4G91 C;  3LZ0 B;  3AZL D;  1TZY D;  5B40 C;  5CP6 C;  1M19 C;  3B6F C;  3KUY B;  1F66 B;  5GXQ B;  2HIO D;  3X1U A;  3REK D;  5DNN C;  5B33 A;  3LJA D;  3AYW C;  3AV2 C;  1P3P B;  4KGC B;  2HIO A;  3W99 D;  4H9O B;  4WU9 D;  3AN2 D;  1M1A C;  4ZUX D;  5BS7 C;  3W97 D;  1P3I A;  5B31 A;  3X1V C;  1EQZ C;  5B33 B;  4H9N A;  3B6G C;  3W96 A;  4JJN D;  5AVC A;  3LJA C;  3AYW D;  5CPJ B;  1P3M A;  3MVD D;  5B2I B;  3AZG C;  3AV1 B;  5DNM D;  4X23 A;  3AZJ D;  3MNN D;  3AFA B;  5B0Z C;  1P3M D;  5B40 D;  1HQ3 B;  1BH9 A;  5B0Y C;  4UUZ B;  3AZM C;  3B0B A;  3B6G D;  1KX5 D;  3AZF D;  3KUY C;  4Z2M G;  4Z66 A;  2NZD A;  3WAA D;  1U35 D;  4XUJ A;  3A6N A;  3O62 B;  3KXB C;  3X1U D;  3AZF B;  2NZD D;  3O62 D;  1P3K C;  4J8X B;  3KWQ B;  3WKJ A;  3X1T A;  5B24 A;  3REH A;  3B0C T;  3AZL C;  1U35 C;  4WV4 B;  3REL C;  1HQ3 D;  5CPJ D;  3R45 B;  5G49 B;  5JRG B;  5AVC D;  1R4V A;  2NQB C;  1W2E A;  1WWS A;  4H9R A;  3REI D;  3UTB B;  5B0Y D;  3AFA C;  2ZY4 A;  3AYW B;  3W97 A;  5JA4 A;  5B31 D;  4WU9 B;  3W99 B;  4J8V D;  5BNV B;  1H3O A;  4E45 A;  4KUD B;  5B33 C;  3MGQ C;  3REL B;  3AZH C;  3AZE A;  5CP6 D;  3X1V D;  5CHL B;  3O62 C;  3KXB B;  1P3K D;  1M19 D;  5BS7 A;  4JJN C;  4E44 A;  3AZK B;  1M18 C;  3W98 D;  4H9Q B;  2J8P A;  5B31 C;  3UTB C;  5AV6 D;  1ZLA D;  4NE6 A;  5AV8 C;  2CV5 D;  3X1V A;  1EQZ A;  1F66 D;  1B67 A;  3B6G A;  3W96 C;  1P3L D;  5BT1 C;  3W99 C;  4WU9 C;  1P3M C;  4J8U A;  3AZG A;  5KDM A;  1M18 D;  3W98 C;  3AZL B;  3H0R C;  3LZ0 D;  5GT3 A;  2CV5 B;  1HQ3 A;  4YS3 D;  3UTA D;  3NQJ B;  3WAA C;  1P3O A;  3AZK D;  4WZS B;  4KHA B;  3REI A;  4YM6 A;  2DQN C;  3KXB D;  3MVD C;  5BT1 D;  2ZM5 A;  1P3K B;  3KUY A;  3MGS B;  5G49 A;  1A7W A;  5B24 D;  5JRG A;  3WTP E;  1KU5 A;  5AV5 D;  3REH D;  1S32 D;  3TU4 C;  2ARO C;  1P3O B;  3LZ1 C;  5F99 A;  5GT0 B;  2DF4 C;  3AZI C;  1KX4 B;  3UTB D;  3WKJ C;  1BH9 B;  1M18 B;  2Y2L A;  3REJ B;  3X1T C;  3MGR C;  1ID3 C;  5C3I C;  5F99 D;  3A1K A;  5CPK A;  5B1L B;  3AZM B;  3WTP D;  3NQU A;  4KGC A;  3LZ0 A;  5CP6 B;  1M19 B;  3B6F B;  3MGP D;  3REL D;  5CPI A;  3AN2 C;  3UTA A;  2CWE A;  5CPJ C;  1M1A D;  1WWI A;  2F8N A;  2NQB D;  5DNN B;  4Z2M H;  2BYK A;  3X1S B;  2G5H C;  3AZE C;  3R45 A;  1P3B D;  4H9N B;  3O62 A;  1M18 A;  5FUG B;  3REI B;  4LD9 D;  5B40 B;  3WKJ D;  5B1M A;  4UPK A;  3X1T D;  5AV8 A;  2JE5 A;  1BH8 A;  3KWQ A;  3WKJ B;  3V9R B;  4WU9 A;  3W99 A;  3MVD B;  1ID3 B;  5GSU B;  3VH6 A;  1BFM A;  2L5A A;  3WTP C;  3KWQ D;  4HGA B;  3WA9 A;  1HQ3 C;  2RVQ C;  5B0Z B;  4J8X D;  1Q9C A;  5B32 B;  2ARO B;  1P3O C;  4YM6 C;  4XZQ B;  3MVD A;  5BNX B;  4KGC D;  3LJA B;  3MGP A;  5JRG C;  3AZI D;  1ULY A;  2Y2N A;  3MGR D;  3NQU B;  4XZQ A;  1BH8 B;  3VH5 A;  3VH6 W;  3AZI A;  3C1B A;  1TAF A;  5B2J D;  2Y2K A;  3REJ D;  1P3F A;  2IO5 B;  2Y2I A;  4KHA A;  5AV8 D;  2BYK B;  3X1S A;  4WU8 C;  1N1J A;  5AV9 B;  2BYM B;  4NE3 A;  1P3I C;  1AOI B;  2PYO A;  4UUZ A;  5JA4 B;  3AV2 B;  1P3P C;  4J8X C;  1ID3 D;  3MGQ D;  4G91 B;  3LZ0 C;  4YM6 D;  4J8W B;  5CPI C;  5AV9 A;  1TZY A;  5B1M D;  4R8P D;  4J8U D;  4LD9 B;  5GXQ D;  5B1L A;  5B0Y A;  2FJ7 A;  4NE5 A;  3C1B B;  1PZR A;  4DQY B;  4KUD A;  4H9P B;  1B6W A;  2NZD C;  5B1M C;  1HTA A;  2FJ7 D;  1KX4 A;  2Y2J A;  4ZUX A;  1N1J B;  1M1A B;  3W98 B;  5B31 G;  1P3K A;  1P3G B;  3X1V B;  5B2I A;  3AV1 A;  1EQZ B;  3WA9 B;  4AWL B;  3UT9 B;  3AZH B;  3MGS A;  3WTP A;  3KSY A;  5B24 C;  3REH C;  4H9S A;  4J8V B;  1JFI B;  3AZL A;  1U35 A;  5B31 B;  4DRB A;  5F99 B;  3C1B D;  5B0Y B;  4QLC B;  2NQB A;  5AVB A;  1AOI A;  2PYO B;  1KX5 A;  2BG1 A;  3EPL A;  3AZF A;  4CSR B;  3LZ1 B;  4ZBJ B;  3AFA A;  4H9Q A;  1EQZ D;  3VH5 W;  4Z5T A;  4X23 B;  1P3O D;  4R8P A;  1KX3 A; 
#chains in the Genus database with same CATH homology
 4J8W D;  4WNN B;  1P3F B;  4NFT A;  5CPK B;  4WU8 D;  3C1B C;  1P3I D;  3UT9 D;  3MGQ A;  2HUE C;  5AY8 A;  3AZE B;  5AV9 D;  4WU8 A;  3X1S C;  4JJN A;  3W96 D;  3UTA B;  2Y2H A;  3X1U B;  4J8W C;  1U35 B;  3UTB A;  4EO5 C;  1P3P A;  4H9R B;  4J8X A;  2Y2M A;  4M6B A;  3C1C A;  4YS3 C;  1P3A D;  1P3L B;  1KX5 B;  3MGR B;  3KFU G;  1TZY C;  2G5I C;  3W98 A;  2YFV A;  4Z5T B;  5GT3 C;  2HUE B;  1Z2C B;  4Z66 B;  3P5J B;  3F6T A;  3WAA A;  2W8S A;  4J8V A;  5B2I D;  3AV1 D;  3REI C;  4XZQ D;  3LEL B;  4KUD C;  3MNN A;  5CPI D;  2ARO D;  4AWL C;  4ZUX C;  5GT3 D;  3TU4 A;  1P34 B;  2ARO A;  3IP4 C;  4CSR A;  3LZ1 A;  3UT9 A;  3LEL A;  5F99 C;  5GT3 B;  4HGA C;  2CV5 A;  2Y2Q A;  3MGS C;  3AZN B;  3NQJ A;  3REK B;  5CPI B;  1ID3 A;  3AZG D;  4Z5T D;  5B32 C;  2HIO B;  5AY8 B;  3EG5 B;  1F66 C;  3AL0 C;  2F2A C;  1P3L C;  2Y2G A;  1TZY B;  1AOI C;  5BO0 B;  1KX5 C;  1F1E A;  3AZF C;  1KX3 B;  1TAF B;  2NZD B;  4Z5T C;  3EPK A;  4R8P C;  4J8U C;  3W96 B;  1S32 A;  3UTA C;  3AZE D;  3AZN C;  3V9R A;  2BYM A;  3X1U C;  4CAY A;  4LD9 C;  3AYW A;  4WU8 B;  3AV2 A;  4DRA A;  2XD5 A;  2F8N H;  3B6G B;  5DNM A;  4X23 D;  3TU4 D;  3AZJ A;  3LZ1 D;  3EPJ A;  5E5A D;  5CPK D;  3KWQ C;  2ZY5 A;  3VH6 T;  5AVC C;  4YS3 A;  3FDD A;  5AV6 A;  2PYO D;  3B0D C;  5AVB D;  4X23 C;  2Y2O A;  3WA9 C;  1S32 B;  5B24 B;  3REH B;  3W97 B;  3AZM A;  4J8V C;  5C3I B;  2F8N G;  1P3A C;  1P3G A;  5BNX A;  3MGP C;  3WTP B;  2LY8 A;  3AZM D;  3A1I A;  3AZK A;  3KXB A;  5B2J C;  2F8N B;  3KUY D;  5GSU A;  3UT9 C;  4XZQ C;  2FFF B;  2CV5 C;  2Y2P A;  5AV5 A;  5BNV A;  1P3F C;  1KX4 D;  5KDM B;  5AV6 B;  5B32 A;  5B1M B;  3H0M C;  1F66 A;  2PYO C;  4R8P B;  4J8U B;  1P3L A;  4QLC C;  3AZN D;  3AV2 D;  5GXQ C;  3MGQ B;  3W97 C;  2RVQ D;  1S32 C;  5AV9 C;  4YS3 B;  3AZN A;  4CAY B;  1ZLA A;  1H3O B;  4LD9 A;  4XUJ D;  3A6N D;  4G92 C;  5B1L C;  2FJ7 C;  3C1C B;  5AVC B;  3AZH A;  5JRG D;  3LEL D;  3REJ A;  3REK C;  3VH5 T;  5DNM C;  3AZJ C;  5B2J B;  4WJ3 C;  1ZLA B;  3B0D B;  3B6F D;  3AZI B;  1KX4 C;  5GT0 C;  1P3B A;  1P34 C;  5AY8 D;  1P3A B;  5B2I C;  3AZG B;  5AV6 C;  3AV1 C;  4KUD D;  5B32 D;  4XUJ B;  3A6N B;  5E5A C;  1JFI A;  2UWX A;  4H9S C;  5GSU D;  1P34 D;  2ZY3 A;  1P3G C;  1P3A A;  5B0Z D;  4H9P A;  5AVB C;  1P3I B;  3X1T B;  3AZK C;  3MNN B;  2VQR A;  5B40 A;  5B2J A;  1P3F D;  5CP6 A;  1M19 A;  3B6F A;  5FUG A;  1KX3 C;  5GSU C;  2YFW A;  1P3B B;  5AV5 C;  4Z66 D;  3X1S D;  5DNN A;  3MGR A;  4QLC D;  5AY8 C;  2HIO C;  1M1A A;  5CPK C;  4ZUX B;  2JCH A;  2YFW B;  2ZY2 A;  4H9O A;  3AN2 B;  5DNN D;  2F8N D;  1T3U A;  4J8W A;  3WAA B;  2XD1 A;  4QLC A;  2NQB B;  3AZH D;  4KGC C;  3C1C C;  3LJA A;  3MGP B;  3WA9 D;  4WNN A;  5GXQ A;  4G92 B;  1P3G D;  5BO0 A;  5B1L D;  3AN2 A;  5CPJ A;  1P3M B;  3AFA D;  1ZLA C;  2IO5 C;  5B32 G;  5DNM B;  3AZJ B;  4ZBJ C;  3EPH A;  3H0L C;  5B0Z A;  5AVB B;  2F8N K;  5GT0 D;  3C1C D;  3REJ C;  3REK A;  4JJN B;  3MNN C;  3B0C W;  5B33 D;  4Z66 C;  2JSS A;  5AV5 B;  5E5A B;  2RIQ A;  5GT0 A;  4XUJ C;  3A6N C;  3MGS D;  1P3B C;  3TU4 B;  1P34 A;  2YFV B;  3LEL C;  4YM6 B;  1P3P D;  4EO5 B;  5E5A A;  1AOI D;  3REL A;  5AV8 B;  2FJ7 B;  1KX3 D;  4G91 C;  3LZ0 B;  3AZL D;  1TZY D;  5B40 C;  5CP6 C;  1M19 C;  3B6F C;  3KUY B;  1F66 B;  5GXQ B;  2HIO D;  3X1U A;  3REK D;  5DNN C;  5B33 A;  3LJA D;  3AYW C;  3AV2 C;  1P3P B;  4KGC B;  2HIO A;  3W99 D;  4H9O B;  4WU9 D;  3AN2 D;  1M1A C;  4ZUX D;  5BS7 C;  3W97 D;  1P3I A;  5B31 A;  3X1V C;  1EQZ C;  5B33 B;  4H9N A;  3B6G C;  3W96 A;  4JJN D;  5AVC A;  3LJA C;  3AYW D;  5CPJ B;  1P3M A;  3MVD D;  5B2I B;  3AZG C;  3AV1 B;  5DNM D;  4X23 A;  3AZJ D;  3MNN D;  3AFA B;  5B0Z C;  1P3M D;  5B40 D;  1HQ3 B;  1BH9 A;  5B0Y C;  4UUZ B;  3AZM C;  3B0B A;  3B6G D;  1KX5 D;  3AZF D;  3KUY C;  4Z2M G;  4Z66 A;  2NZD A;  3WAA D;  1U35 D;  4XUJ A;  3A6N A;  3O62 B;  3KXB C;  3X1U D;  3AZF B;  2NZD D;  3O62 D;  1P3K C;  4J8X B;  3KWQ B;  3WKJ A;  3X1T A;  5B24 A;  3REH A;  3B0C T;  3AZL C;  1U35 C;  4WV4 B;  3REL C;  1HQ3 D;  5CPJ D;  3R45 B;  5G49 B;  5JRG B;  5AVC D;  1R4V A;  2NQB C;  1W2E A;  1WWS A;  4H9R A;  3REI D;  3UTB B;  5B0Y D;  3AFA C;  2ZY4 A;  3AYW B;  3W97 A;  5JA4 A;  5B31 D;  4WU9 B;  3W99 B;  4J8V D;  5BNV B;  1H3O A;  4E45 A;  4KUD B;  5B33 C;  3MGQ C;  3REL B;  3AZH C;  3AZE A;  5CP6 D;  3X1V D;  5CHL B;  3O62 C;  3KXB B;  1P3K D;  1M19 D;  5BS7 A;  4JJN C;  4E44 A;  3AZK B;  1M18 C;  3W98 D;  4H9Q B;  2J8P A;  5B31 C;  3UTB C;  5AV6 D;  1ZLA D;  4NE6 A;  5AV8 C;  2CV5 D;  3X1V A;  1EQZ A;  1F66 D;  1B67 A;  3B6G A;  3W96 C;  1P3L D;  5BT1 C;  3W99 C;  4WU9 C;  1P3M C;  4J8U A;  3AZG A;  5KDM A;  1M18 D;  3W98 C;  3AZL B;  3H0R C;  3LZ0 D;  5GT3 A;  2CV5 B;  1HQ3 A;  4YS3 D;  3UTA D;  3NQJ B;  3WAA C;  1P3O A;  3AZK D;  4WZS B;  4KHA B;  3REI A;  4YM6 A;  2DQN C;  3KXB D;  3MVD C;  5BT1 D;  2ZM5 A;  1P3K B;  3KUY A;  3MGS B;  5G49 A;  1A7W A;  5B24 D;  5JRG A;  3WTP E;  1KU5 A;  5AV5 D;  3REH D;  1S32 D;  3TU4 C;  2ARO C;  1P3O B;  3LZ1 C;  5F99 A;  5GT0 B;  2DF4 C;  3AZI C;  1KX4 B;  3UTB D;  3WKJ C;  1BH9 B;  1M18 B;  2Y2L A;  3REJ B;  3X1T C;  3MGR C;  1ID3 C;  5C3I C;  5F99 D;  3A1K A;  5CPK A;  5B1L B;  3AZM B;  3WTP D;  3NQU A;  4KGC A;  3LZ0 A;  5CP6 B;  1M19 B;  3B6F B;  3MGP D;  3REL D;  5CPI A;  3AN2 C;  3UTA A;  2CWE A;  5CPJ C;  1M1A D;  1WWI A;  2F8N A;  2NQB D;  5DNN B;  4Z2M H;  2BYK A;  3X1S B;  2G5H C;  3AZE C;  3R45 A;  1P3B D;  4H9N B;  3O62 A;  1M18 A;  5FUG B;  3REI B;  4LD9 D;  5B40 B;  3WKJ D;  5B1M A;  4UPK A;  3X1T D;  5AV8 A;  2JE5 A;  1BH8 A;  3KWQ A;  3WKJ B;  3V9R B;  4WU9 A;  3W99 A;  3MVD B;  1ID3 B;  5GSU B;  3VH6 A;  1BFM A;  2L5A A;  3WTP C;  3KWQ D;  4HGA B;  3WA9 A;  1HQ3 C;  2RVQ C;  5B0Z B;  4J8X D;  1Q9C A;  5B32 B;  2ARO B;  1P3O C;  4YM6 C;  4XZQ B;  3MVD A;  5BNX B;  4KGC D;  3LJA B;  3MGP A;  5JRG C;  3AZI D;  1ULY A;  2Y2N A;  3MGR D;  3NQU B;  4XZQ A;  1BH8 B;  3VH5 A;  3VH6 W;  3AZI A;  3C1B A;  1TAF A;  5B2J D;  2Y2K A;  3REJ D;  1P3F A;  2IO5 B;  2Y2I A;  4KHA A;  5AV8 D;  2BYK B;  3X1S A;  4WU8 C;  1N1J A;  5AV9 B;  2BYM B;  4NE3 A;  1P3I C;  1AOI B;  2PYO A;  4UUZ A;  5JA4 B;  3AV2 B;  1P3P C;  4J8X C;  1ID3 D;  3MGQ D;  4G91 B;  3LZ0 C;  4YM6 D;  4J8W B;  5CPI C;  5AV9 A;  1TZY A;  5B1M D;  4R8P D;  4J8U D;  4LD9 B;  5GXQ D;  5B1L A;  5B0Y A;  2FJ7 A;  4NE5 A;  3C1B B;  1PZR A;  4DQY B;  4KUD A;  4H9P B;  1B6W A;  2NZD C;  5B1M C;  1HTA A;  2FJ7 D;  1KX4 A;  2Y2J A;  4ZUX A;  1N1J B;  1M1A B;  3W98 B;  5B31 G;  1P3K A;  1P3G B;  3X1V B;  5B2I A;  3AV1 A;  1EQZ B;  3WA9 B;  4AWL B;  3UT9 B;  3AZH B;  3MGS A;  3WTP A;  3KSY A;  5B24 C;  3REH C;  4H9S A;  4J8V B;  1JFI B;  3AZL A;  1U35 A;  5B31 B;  4DRB A;  5F99 B;  3C1B D;  5B0Y B;  4QLC B;  2NQB A;  5AVB A;  1AOI A;  2PYO B;  1KX5 A;  2BG1 A;  3EPL A;  3AZF A;  4CSR B;  3LZ1 B;  4ZBJ B;  3AFA A;  4H9Q A;  1EQZ D;  3VH5 W;  4Z5T A;  4X23 B;  1P3O D;  4R8P A;  1KX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...