5GT3D

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
RTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3D00
1P3OA 4Z2MG 3WKJC 3UTAB 4EO5B 4J8WC 5DNND 3AZIC 5AVBB 1P3IC 4H9RA 3C1BD 2FJ7D 1P3MD 3MGPD 4YS3D 4LD9D 5CPKD 1P3GC 1HTAA 3B0DC 5BS7C 5B40B 4NFTA 3WTPD 3MNNA 5CP6D 3AZNA 5BNXA 2PYOB 5E5AB 3O62D 3MGSA 2IO5C 1P3OD 3W99A 3RELB 3B0CT 3UTBC 5B1LA 3X1SA 3A6NA 4G91B 4QLCA 5AV9A 5FUGB 2HIOC 3V9RB 3W97A 5B24A 5BO0A 3AYWA 5B1MD 4XUJA 3MNND 4J8VB 3B6FB 4J8UD 5G49B 1ID3C 3REKA 5B31D 3MGSD 3KWQB 1M1AB 3W99D 3LZ0B 4WU8B 2CV5C 2NQBC 2FJ7C 5B1LD 4UUZB 4YS3C 3X1SD 3A6ND 3LELA 5GT0B 4G92C 3AZFD 5AV9D 5CPKC 4LD9C 2BYMA 5AY8C 4HGAB 2NZDC 4E44A 1TAFB 5B0ZC 2YFVA 1WWSA 4CSRA 5B24D 5B2JC 3B6GA 5GT3A 3AYWD 5GXQA 2BYKA 4XUJD 2PYOA 5E5AA 3REKD 3RELA 3UTAD 5B32G 5BNVA 4H9OB 5AVBD 2RVQD 3UT9B 3AZHB 1P3BA 3AV2A 5CPJB 1P3FC 5FUGA 5B2IC 3B0CW 5B40D 2AROB 1N1JA 3VH5T 5F99B 3NQJB 5B1MC 4AWLB 1ZLAB 1KX3B 3REHC 4J8VA 1U35B 3MGPB 4J8UC 5G49A 3AV1A 2PYOD 5CHLB 5E5AD 4H9NB 3KWQA 3X1TB 3RELD 1R4VA 3NQUB 4UUZA 3AZFC 3AV2D 4H9SA 3W98B 3WAAA 4WV4B 3MGRA 4YM6B 5KDMA 1KX5C 5AV5C 4J8VD 3B6FD 4ZBJB 3TU4C 1P3GA 1P3PC 4WU9C 3UTAC 4EO5C 3KWQD 1M1AD 5B0YC 3LZ0D 3UT9A 5AVBC 4R8PA 4WU8D 3REIC 3MNNB 3WA9C 5JRGB 5B40C 3MGRD 3AZNB 5BNXB 3C1CA 3MGSB 3UTBA 3VH5W 4QLCB 3AZEB 5AV6B 3AZJA 3REJA 3W97B 4X23C 3UT9D 5B32B 5BO0B 3X1UC 3AFAB 4CAYB 4G91C 3W98A 5JA4A 4XZQB 2AROD 5F99D 3AZLC 1KX4C 1ZLAD 1KX3D 1U35D 3AZGB 3LELB 4M6BA 2BYMB 5C3IB 1BH9A 1A7WA 1TZYC 4JJNB 3X1TD 3LZ0C 3REJD 2YFVB 4CSRB 4WU8C 3B6GB 4Z5TC 5GT0C 5GT3B 5B2JA 1M19B 3W98D 4Z66C 4H9QB 5GXQB 2BYKB 5JRGA 5DNMA 1P34C 4YM6D 5AVCC 4KGCC 1P3AB 4KHAA 4KUDB 5AV8C 2F8NG 5BNVB 3KUYC 1EQZC 1P3BB 3AV2B 3AZEA 1Q9CA 3AN2C 5AV6A 1P3KA 1F1EA 1HQ3A 2HUEC 4NE5A 3MGQB 5B32A 1N1JB 3AZHC 1AOIC 3AFAA 4CAYA 5CPJC 5GSUC 1S32C 5JRGD 3LZ1A 3X1VB 4XZQA 3AV1B 2AROC 3AZND 4ZUXB 5F99C 5DNNC 4AWLC 1BH8A 3AZMB 1ULYA 1KX3C 3C1BC 1ZLAC 1P3MC 1U35C 3MGPC 3AZGA 4QLCD 3AZKB 3AZED 5AV6D 3VH6A 3WAAB 4JJNA 3MGRB 3X1TC 1HQ3D 4NE6A 3W97D 5B32D 5KDMB 1M19A 3WTPC 3AFAD 3WKJB 3LJAA 5CP6C 4H9QA 3AZIB 3W96A 1P3LA 4XZQD 3O62C 1P3OC 1P3AA 1P3GB 4KUDA 3B0DB 4WU9A 4R8PB 3AZGD 3LELD 4JJND 3MGQA 3C1CB 5B31G 3B6GD 1M19D 2IO5B 5GT3D 4J8XA 3LJAD 3MNNC 3KXBA 5GXQD 3UTBB 3X1VA 1M18A 4ZUXA 5B31C 3MGSC 4NE3A 2L5AA 3W99C 1P3AD 1B6WA 3AZJB 3REJB 3AZMA 4KUDD 2HIOB 5B1LC 5B33A 3A6NC 3X1SC 1P3BD 5AV9C 4QLCC 3X1UA 3MVDA 3AZKA 5JA4B 1F66A 5CPIA 3W97C 3MGQD 5B24C 4Z2MH 3WKJA 3AYWC 4J8WA 3AZIA 4XUJC 1P3IA 2NQBB 3X1VD 3AV1D 4G92B 3REKC 1M18D 4ZUXD 1BH9B 5BS7A 5AY8B 2NZDB 1TZYA 2RVQC 5B0ZB 3AZMD 3LELC 5B2JB 3MVDD 3AZKD 3WAAD 1F66D 1JFIB 5DNMB 5CPID 3VH5A 4KHAB 1KU5A 3B6GC 5GT3C 3WKJD 2F8NH 3AZID 1P3KB 2PYOC 5E5AC 2JSSA 1P3FB 5B2IB 3RELC 1HQ3B 1P3GD 2HIOA 4R8PD 2F8NA 4WNNA 1P3BC 3AV2C 3LZ1B 3REHB 3C1CD 1ID3A 1BH8B 2CV5A 4J8VC 3UTBD 2NQBA 2FJ7A 3B6FC 3AV1C 4YS3A 4LD9A 5CPKA 5AY8A 3KSYA 3KWQC 1M1AC 2NZDA 3AZJD 5B0ZA 2HIOD 2YFWA 4H9SC 3LJAB 4HGAC 3WAAC 1KX5B 3W96B 3MGRC 1JFIA 1P3LB 3O62A 3TU4B 1P3PB 4WU9B 5B0YB 2CV5D 2NQBD 1P3FA 3REIB 3VH6T 5B2IA 5AY8D 2NZDD 3WA9B 3UT9C 4R8PC 5B0ZD 4WZSB 5B2JD 4J8XB 3KXBB 5B1MA 3REHA 5DNMD 4J8UA 3C1CC 1M18B 5B31A 4E45A 4X23B 5B33B 3MVDB 1P3KD 3X1UB 3AZFA 1P3FD 1H3OA 5B2ID 1F66B 3AZJC 3REJC 5CPIB 3R45B 3W98C 2LY8A 4J8WB 3AZLB 1KX4B 1P3IB 1KX5A 1WWIA 5AV5A 3LZ1D 3REHD 4YM6C 4DRBA 3TU4A 1P3PA 3UTAA 1TZYB 5B0YA 5AVBA 4ZBJC 3REIA 4Z5TB 1B67A 4Z66B 3WA9A 5B40A 1P34B 5AVCB 5BT1D 4KGCB 3VH6W 4H9PB 5AV8B 5JRGC 3KUYB 1KX5D 3W96D 5DNMC 3AZNC 1P3LD 1EQZB 5AV5D 3AN2B 3TU4D 1P3PD 4WU9D 2HUEB 5B0YD 4X23A 2F8NB 4WNNB 1P3KC 3AZEC 1AOIB 5AV6C 5GSUB 3REID 1HQ3C 1S32B 3V9RA 3WA9D 5B32C 1ID3B 3AFAC 3R45A 5DNNB 4J8XD 3AZLA 1KX4A 3KXBD 2CV5B 3LZ1C 3C1BB 1P3MB 4XZQC 2FJ7B 3B6FA 4YS3B 4LD9B 5CPKB 1M1AA 4DRAA 3LZ0A 4WU8A 4X23D 5B33D 3AZGC 2YFWB 4Z5TA 3WTPB 5GT0A 5C3IC 3X1UD 4Z66A 5CP6B 4JJNC 1BFMA 1TAFA 1P34A 3WTPE 3O62B 5AVCA 5BT1C 1M19C 1P3OB 4H9PA 4KGCA 3LJAC 5GXQC 5AV8A 4J8WD 3KUYA 3AZLD 1KX4D 3W96C 1P3ID 4H9RB 1P3LC 1EQZA 3AN2A 1P3AC 4KUDC 3B0BA 1TZYD 4H9OA 3AZHA 1AOIA 5CPJA 5GSUA 4Z5TD 5GT0D 5B1MB 4Z66D 1S32A 3MGQC 4J8UB 2F8NK 2AROA 1P34D 5F99A 5B31B 5AVCD 3NQJA 4KGCD 5DNNA 4J8XC 3W99B 3KXBC 5AV8D 1ZLAA 1KX3A 3KUYD 3C1BA 3X1VC 1U35A 5B1LB 3MGPA 1P3MA 3X1SB 3A6NB 4ZUXC 1M18C 3AZFB 1EQZD 5AV9B 3AN2D 1H3OB 4H9NA 3X1TA 3AZMC 3NQUA 2F8ND 5B33C 3AZHD 5B24B 3MVDC 1AOID 3AZKC 3WTPA 3AYWB 5CPJD 5GSUD 5CP6A 2CWEA 1F66C 4XUJB 5CPIC 5AV5B 1S32D 4YM6A 1ID3D 3REKB
chains in the Genus database with same CATH superfamily
1P3OA 4Z2MG 3WKJC 3UTAB 4EO5B 4J8WC 5DNND 3AZIC 5AVBB 1P3IC 4H9RA 3C1BD 2FJ7D 1P3MD 2VQRA 3MGPD 4YS3D 4LD9D 5CPKD 1P3GC 1HTAA 2Y2IA 3B0DC 5BS7C 5B40B 4NFTA 3WTPD 3MNNA 5CP6D 2Y2PA 3AZNA 5BNXA 2PYOB 5E5AB 2Y2NA 2JE5A 3O62D 3MGSA 2IO5C 1P3OD 3W99A 3RELB 3B0CT 3UTBC 2ZY3A 5B1LA 3X1SA 3A6NA 4G91B 4QLCA 5AV9A 5FUGB 2DF4C 3A1KA 2HIOC 3V9RB 3W97A 5B24A 5BO0A 3AYWA 5B1MD 4XUJA 3MNND 4J8VB 3B6FB 4J8UD 5G49B 1ID3C 3REKA 5B31D 3MGSD 3KWQB 1M1AB 3W99D 3LZ0B 2FFFB 2Y2KA 4WU8B 2CV5C 2NQBC 2FJ7C 5B1LD 4UUZB 4YS3C 3X1SD 3A6ND 3LELA 5GT0B 4G92C 3AZFD 5AV9D 5CPKC 4LD9C 2BYMA 5AY8C 4HGAB 2NZDC 4E44A 1TAFB 5B0ZC 2W8SA 1WWSA 2YFVA 4CSRA 5B24D 5B2JC 3B6GA 5GT3A 3AYWD 5GXQA 2BYKA 4XUJD 2PYOA 5E5AA 3REKD 2Y2MA 3RELA 3UTAD 5B32G 5BNVA 4H9OB 5AVBD 2RVQD 3UT9B 3AZHB 1P3BA 3AV2A 5CPJB 1P3FC 5FUGA 5B2IC 3H0RC 3B0CW 5B40D 2AROB 1N1JA 3VH5T 5F99B 3NQJB 3EPLA 5B1MC 4AWLB 1ZLAB 1KX3B 3REHC 4J8VA 2JCHA 3MGPB 4J8UC 1U35B 5G49A 3AV1A 3A1IA 2PYOD 5CHLB 5E5AD 4H9NB 3KWQA 3X1TB 3RELD 1R4VA 3NQUB 4UUZA 3AZFC 3AV2D 4H9SA 3W98B 3WAAA 4WV4B 3MGRA 4YM6B 5KDMA 1KX5C 5AV5C 4J8VD 3B6FD 4ZBJB 3TU4C 1P3GA 1P3PC 4WU9C 3UTAC 4EO5C 3KWQD 1M1AD 5B0YC 3LZ0D 2RIQA 5AVBC 4R8PA 3UT9A 4WU8D 3REIC 3MNNB 2Y2OA 3WA9C 5JRGB 5B40C 3MGRD 3AZNB 5BNXB 3C1CA 3MGSB 3UTBA 3VH5W 4QLCB 3AZEB 5AV6B 2J8PA 3AZJA 3REJA 3W97B 4X23C 3UT9D 5B32B 5BO0B 3X1UC 3AFAB 4CAYB 4G91C 3W98A 5JA4A 4XZQB 2AROD 5F99D 3AZLC 1KX4C 1ZLAD 1KX3D 1U35D 3AZGB 3LELB 4M6BA 2BYMB 5C3IB 1BH9A 1A7WA 1TZYC 1W2EA 4JJNB 3X1TD 3LZ0C 3REJD 2YFVB 4CSRB 4WU8C 1Z2CB 3B6GB 4Z5TC 2ZY4A 5B2JA 5GT3B 5GT0C 1M19B 3W98D 4Z66C 4H9QB 5GXQB 2BYKB 5JRGA 5DNMA 1P34C 4YM6D 5AVCC 4KGCC 1P3AB 4KHAA 4KUDB 5AV8C 2F8NG 5BNVB 3KUYC 1EQZC 1P3BB 3AV2B 3AZEA 1Q9CA 3AN2C 5AV6A 1P3KA 1F1EA 1HQ3A 2HUEC 4NE5A 3MGQB 5B32A 1N1JB 3AZHC 1AOIC 3AFAA 4CAYA 2ZM5A 5CPJC 5GSUC 1S32C 5JRGD 3LZ1A 3X1VB 4XZQA 3AV1B 2AROC 3AZND 4ZUXB 5F99C 2Y2LA 5DNNC 2DQNC 1BH8A 2Y2JA 1ULYA 4AWLC 3C1BC 3AZMB 1P3MC 1U35C 1KX3C 3MGPC 3AZGA 4QLCD 3AZKB 3AZED 5AV6D 3VH6A 3WAAB 4JJNA 3MGRB 3X1TC 1HQ3D 4NE6A 3W97D 5B32D 5KDMB 1M19A 3WTPC 3AFAD 3WKJB 3LJAA 5CP6C 4H9QA 3AZIB 3W96A 1P3LA 4XZQD 3O62C 1P3OC 1P3AA 1P3GB 4KUDA 3B0DB 4WU9A 3EPHA 4R8PB 2ZY2A 2BG1A 3AZGD 3LELD 4JJND 3MGQA 3C1CB 5B31G 3B6GD 1M19D 2IO5B 5GT3D 4J8XA 3LJAD 3MNNC 3KXBA 5GXQD 3UTBB 3X1VA 1M18A 4ZUXA 5B31C 3MGSC 4NE3A 2L5AA 3W99C 1P3AD 1B6WA 1PZRA 3REJB 3AZMA 3AZJB 4KUDD 2HIOB 5B1LC 5B33A 3A6NC 3X1SC 1P3BD 5AV9C 4QLCC 3X1UA 3MVDA 3AZKA 5JA4B 3H0LC 1F66A 5CPIA 3W97C 3MGQD 5B24C 4Z2MH 3WKJA 3AYWC 4J8WA 3AZIA 4XUJC 1P3IA 2NQBB 3X1VD 3AV1D 4G92B 3REKC 1M18D 4ZUXD 1BH9B 5BS7A 5AY8B 2NZDB 1TZYA 2RVQC 5B0ZB 3AZMD 3LELC 5B2JB 3MVDD 3AZKD 3WAAD 1F66D 1JFIB 5DNMB 5CPID 3VH5A 2XD1A 4KHAB 1KU5A 3B6GC 5GT3C 3WKJD 2F8NH 3AZID 1P3KB 2PYOC 5E5AC 2JSSA 1P3FB 5B2IB 3RELC 1HQ3B 1P3GD 2HIOA 4R8PD 2F8NA 4WNNA 2XD5A 1P3BC 3AV2C 2Y2HA 3LZ1B 3REHB 3C1CD 1ID3A 4UPKA 2G5IC 1BH8B 2CV5A 4J8VC 3UTBD 2NQBA 2FJ7A 3B6FC 3AV1C 4YS3A 4LD9A 5CPKA 5AY8A 3KSYA 3KWQC 1M1AC 2NZDA 3AZJD 5B0ZA 2HIOD 3H0MC 2YFWA 4H9SC 3LJAB 4HGAC 3WAAC 1KX5B 4DQYB 3MGRC 1JFIA 3W96B 1P3LB 3O62A 3TU4B 1P3PB 4WU9B 4WJ3C 5B0YB 2CV5D 2NQBD 1P3FA 3REIB 3VH6T 5B2IA 5AY8D 2NZDD 3WA9B 3UT9C 4R8PC 5B0ZD 2ZY5A 4WZSB 5B2JD 4J8XB 3KXBB 5B1MA 3REHA 5DNMD 4J8UA 3C1CC 1M18B 5B31A 4E45A 4X23B 3EPKA 5B33B 3MVDB 1P3KD 3X1UB 3AZFA 1P3FD 1H3OA 5B2ID 1F66B 3AZJC 3REJC 5CPIB 2Y2GA 3F6TA 3R45B 3W98C 2LY8A 4J8WB 3AZLB 1KX4B 1P3IB 1KX5A 1WWIA 5AV5A 3LZ1D 3REHD 4YM6C 4DRBA 3EPJA 3TU4A 1P3PA 3UTAA 1TZYB 5B0YA 5AVBA 4ZBJC 3REIA 4Z5TB 1B67A 4Z66B 3WA9A 5B40A 1P34B 1T3UA 5AVCB 5BT1D 4KGCB 3VH6W 4H9PB 5AV8B 5JRGC 3KUYB 1KX5D 3W96D 5DNMC 3AZNC 1P3LD 1EQZB 5AV5D 3AN2B 3FDDA 3TU4D 1P3PD 4WU9D 2HUEB 5B0YD 4X23A 2F8NB 4WNNB 1P3KC 3AZEC 1AOIB 5AV6C 5GSUB 3REID 1HQ3C 1S32B 3V9RA 3WA9D 5B32C 1ID3B 3AFAC 3R45A 5DNNB 3IP4C 4J8XD 3AZLA 1KX4A 3KXBD 2CV5B 3LZ1C 3C1BB 1P3MB 4XZQC 2FJ7B 3B6FA 2UWXA 4YS3B 4LD9B 5CPKB 1M1AA 4DRAA 3LZ0A 4WU8A 4X23D 5B33D 3AZGC 2YFWB 3EG5B 3WTPB 4Z5TA 5C3IC 5GT0A 3X1UD 4Z66A 3P5JB 5CP6B 2F2AC 4JJNC 1BFMA 1TAFA 1P34A 3WTPE 3O62B 5AVCA 5BT1C 1M19C 1P3OB 4H9PA 4KGCA 3LJAC 5GXQC 5AV8A 4J8WD 3KUYA 3AZLD 1KX4D 3W96C 1P3ID 4H9RB 1P3LC 1EQZA 3AN2A 1P3AC 2Y2QA 1ZLAC 4KUDC 3B0BA 1TZYD 4H9OA 3AZHA 1AOIA 5CPJA 5GSUA 3AL0C 4Z5TD 5GT0D 5B1MB 4Z66D 1S32A 3MGQC 4J8UB 2F8NK 2AROA 1P34D 5F99A 5B31B 5AVCD 3NQJA 4KGCD 5DNNA 4J8XC 3W99B 2G5HC 3KFUG 3KXBC 5AV8D 1ZLAA 1KX3A 3KUYD 3C1BA 3X1VC 1U35A 5B1LB 3MGPA 1P3MA 3X1SB 3A6NB 4ZUXC 1M18C 3AZFB 1EQZD 5AV9B 3AN2D 1H3OB 4H9NA 3X1TA 3AZMC 3NQUA 2F8ND 5B33C 3AZHD 5B24B 3MVDC 1AOID 3AZKC 3WTPA 3AYWB 5CPJD 5GSUD 5CP6A 2CWEA 1F66C 4XUJB 5CPIC 5AV5B 1S32D 4YM6A 1ID3D 3REKB
chains in the Genus database with same CATH topology
1P3OA 4Z2MG 3WKJC 3UTAB 4EO5B 4J8WC 5DNND 3AZIC 5AVBB 1P3IC 4H9RA 3C1BD 2FJ7D 1P3MD 2VQRA 3MGPD 4YS3D 4LD9D 5CPKD 1P3GC 1HTAA 2Y2IA 3B0DC 5BS7C 5B40B 4NFTA 3WTPD 3MNNA 5CP6D 2Y2PA 3AZNA 5BNXA 2PYOB 5E5AB 2Y2NA 2JE5A 3O62D 3MGSA 2IO5C 1P3OD 3W99A 3RELB 3B0CT 3UTBC 2ZY3A 5B1LA 3X1SA 3A6NA 4G91B 4QLCA 5AV9A 5FUGB 2DF4C 3A1KA 2HIOC 3V9RB 3W97A 5B24A 5BO0A 3AYWA 5B1MD 4XUJA 3MNND 4J8VB 3B6FB 4J8UD 5G49B 1ID3C 3REKA 5B31D 3MGSD 3KWQB 1M1AB 3W99D 3LZ0B 2FFFB 2Y2KA 4WU8B 2CV5C 2NQBC 2FJ7C 5B1LD 4UUZB 4YS3C 3X1SD 3A6ND 3LELA 5GT0B 4G92C 3AZFD 5AV9D 5CPKC 4LD9C 2BYMA 5AY8C 4HGAB 2NZDC 4E44A 1TAFB 5B0ZC 2W8SA 1WWSA 2YFVA 4CSRA 5B24D 5B2JC 3B6GA 5GT3A 3AYWD 5GXQA 2BYKA 4XUJD 2PYOA 5E5AA 3REKD 2Y2MA 3RELA 3UTAD 5B32G 5BNVA 4H9OB 5AVBD 2RVQD 3UT9B 3AZHB 1P3BA 3AV2A 5CPJB 1P3FC 5FUGA 5B2IC 3H0RC 3B0CW 5B40D 2AROB 1N1JA 3VH5T 5F99B 3NQJB 3EPLA 5B1MC 4AWLB 1ZLAB 1KX3B 3REHC 4J8VA 2JCHA 3MGPB 4J8UC 1U35B 5G49A 3AV1A 3A1IA 2PYOD 5CHLB 5E5AD 4H9NB 3KWQA 3X1TB 3RELD 1R4VA 3NQUB 4UUZA 3AZFC 3AV2D 4H9SA 3W98B 3WAAA 4WV4B 3MGRA 4YM6B 5KDMA 1KX5C 5AV5C 4J8VD 3B6FD 4ZBJB 3TU4C 1P3GA 1P3PC 4WU9C 3UTAC 4EO5C 3KWQD 1M1AD 5B0YC 3LZ0D 2RIQA 5AVBC 4R8PA 3UT9A 4WU8D 3REIC 3MNNB 2Y2OA 3WA9C 5JRGB 5B40C 3MGRD 3AZNB 5BNXB 3C1CA 3MGSB 3UTBA 3VH5W 4QLCB 3AZEB 5AV6B 2J8PA 3AZJA 3REJA 3W97B 4X23C 3UT9D 5B32B 5BO0B 3X1UC 3AFAB 4CAYB 4G91C 3W98A 5JA4A 4XZQB 2AROD 5F99D 3AZLC 1KX4C 1ZLAD 1KX3D 1U35D 3AZGB 3LELB 4M6BA 2BYMB 5C3IB 1BH9A 1A7WA 1TZYC 1W2EA 4JJNB 3X1TD 3LZ0C 3REJD 2YFVB 4CSRB 4WU8C 1Z2CB 3B6GB 4Z5TC 2ZY4A 5B2JA 5GT3B 5GT0C 1M19B 3W98D 4Z66C 4H9QB 5GXQB 2BYKB 5JRGA 5DNMA 1P34C 4YM6D 5AVCC 4KGCC 1P3AB 4KHAA 4KUDB 5AV8C 2F8NG 5BNVB 3KUYC 1EQZC 1P3BB 3AV2B 3AZEA 1Q9CA 3AN2C 5AV6A 1P3KA 1F1EA 1HQ3A 2HUEC 4NE5A 3MGQB 5B32A 1N1JB 3AZHC 1AOIC 3AFAA 4CAYA 2ZM5A 5CPJC 5GSUC 1S32C 5JRGD 3LZ1A 3X1VB 4XZQA 3AV1B 2AROC 3AZND 4ZUXB 5F99C 2Y2LA 5DNNC 2DQNC 1BH8A 2Y2JA 1ULYA 4AWLC 3C1BC 3AZMB 1P3MC 1U35C 1KX3C 3MGPC 3AZGA 4QLCD 3AZKB 3AZED 5AV6D 3VH6A 3WAAB 4JJNA 3MGRB 3X1TC 1HQ3D 4NE6A 3W97D 5B32D 5KDMB 1M19A 3WTPC 3AFAD 3WKJB 3LJAA 5CP6C 4H9QA 3AZIB 3W96A 1P3LA 4XZQD 3O62C 1P3OC 1P3AA 1P3GB 4KUDA 3B0DB 4WU9A 3EPHA 4R8PB 2ZY2A 2BG1A 3AZGD 3LELD 4JJND 3MGQA 3C1CB 5B31G 3B6GD 1M19D 2IO5B 5GT3D 4J8XA 3LJAD 3MNNC 3KXBA 5GXQD 3UTBB 3X1VA 1M18A 4ZUXA 5B31C 3MGSC 4NE3A 2L5AA 3W99C 1P3AD 1B6WA 1PZRA 3REJB 3AZMA 3AZJB 4KUDD 2HIOB 5B1LC 5B33A 3A6NC 3X1SC 1P3BD 5AV9C 4QLCC 3X1UA 3MVDA 3AZKA 5JA4B 3H0LC 1F66A 5CPIA 3W97C 3MGQD 5B24C 4Z2MH 3WKJA 3AYWC 4J8WA 3AZIA 4XUJC 1P3IA 2NQBB 3X1VD 3AV1D 4G92B 3REKC 1M18D 4ZUXD 1BH9B 5BS7A 5AY8B 2NZDB 1TZYA 2RVQC 5B0ZB 3AZMD 3LELC 5B2JB 3MVDD 3AZKD 3WAAD 1F66D 1JFIB 5DNMB 5CPID 3VH5A 2XD1A 4KHAB 1KU5A 3B6GC 5GT3C 3WKJD 2F8NH 3AZID 1P3KB 2PYOC 5E5AC 2JSSA 1P3FB 5B2IB 3RELC 1HQ3B 1P3GD 2HIOA 4R8PD 2F8NA 4WNNA 2XD5A 1P3BC 3AV2C 2Y2HA 3LZ1B 3REHB 3C1CD 1ID3A 4UPKA 2G5IC 1BH8B 2CV5A 4J8VC 3UTBD 2NQBA 2FJ7A 3B6FC 3AV1C 4YS3A 4LD9A 5CPKA 5AY8A 3KSYA 3KWQC 1M1AC 2NZDA 3AZJD 5B0ZA 2HIOD 3H0MC 2YFWA 4H9SC 3LJAB 4HGAC 3WAAC 1KX5B 4DQYB 3MGRC 1JFIA 3W96B 1P3LB 3O62A 3TU4B 1P3PB 4WU9B 4WJ3C 5B0YB 2CV5D 2NQBD 1P3FA 3REIB 3VH6T 5B2IA 5AY8D 2NZDD 3WA9B 3UT9C 4R8PC 5B0ZD 2ZY5A 4WZSB 5B2JD 4J8XB 3KXBB 5B1MA 3REHA 5DNMD 4J8UA 3C1CC 1M18B 5B31A 4E45A 4X23B 3EPKA 5B33B 3MVDB 1P3KD 3X1UB 3AZFA 1P3FD 1H3OA 5B2ID 1F66B 3AZJC 3REJC 5CPIB 2Y2GA 3F6TA 3R45B 3W98C 2LY8A 4J8WB 3AZLB 1KX4B 1P3IB 1KX5A 1WWIA 5AV5A 3LZ1D 3REHD 4YM6C 4DRBA 3EPJA 3TU4A 1P3PA 3UTAA 1TZYB 5B0YA 5AVBA 4ZBJC 3REIA 4Z5TB 1B67A 4Z66B 3WA9A 5B40A 1P34B 1T3UA 5AVCB 5BT1D 4KGCB 3VH6W 4H9PB 5AV8B 5JRGC 3KUYB 1KX5D 3W96D 5DNMC 3AZNC 1P3LD 1EQZB 5AV5D 3AN2B 3FDDA 3TU4D 1P3PD 4WU9D 2HUEB 5B0YD 4X23A 2F8NB 4WNNB 1P3KC 3AZEC 1AOIB 5AV6C 5GSUB 3REID 1HQ3C 1S32B 3V9RA 3WA9D 5B32C 1ID3B 3AFAC 3R45A 5DNNB 3IP4C 4J8XD 3AZLA 1KX4A 3KXBD 2CV5B 3LZ1C 3C1BB 1P3MB 4XZQC 2FJ7B 3B6FA 2UWXA 4YS3B 4LD9B 5CPKB 1M1AA 4DRAA 3LZ0A 4WU8A 4X23D 5B33D 3AZGC 2YFWB 3EG5B 3WTPB 4Z5TA 5C3IC 5GT0A 3X1UD 4Z66A 3P5JB 5CP6B 2F2AC 4JJNC 1BFMA 1TAFA 1P34A 3WTPE 3O62B 5AVCA 5BT1C 1M19C 1P3OB 4H9PA 4KGCA 3LJAC 5GXQC 5AV8A 4J8WD 3KUYA 3AZLD 1KX4D 3W96C 1P3ID 4H9RB 1P3LC 1EQZA 3AN2A 1P3AC 2Y2QA 1ZLAC 4KUDC 3B0BA 1TZYD 4H9OA 3AZHA 1AOIA 5CPJA 5GSUA 3AL0C 4Z5TD 5GT0D 5B1MB 4Z66D 1S32A 3MGQC 4J8UB 2F8NK 2AROA 1P34D 5F99A 5B31B 5AVCD 3NQJA 4KGCD 5DNNA 4J8XC 3W99B 2G5HC 3KFUG 3KXBC 5AV8D 1ZLAA 1KX3A 3KUYD 3C1BA 3X1VC 1U35A 5B1LB 3MGPA 1P3MA 3X1SB 3A6NB 4ZUXC 1M18C 3AZFB 1EQZD 5AV9B 3AN2D 1H3OB 4H9NA 3X1TA 3AZMC 3NQUA 2F8ND 5B33C 3AZHD 5B24B 3MVDC 1AOID 3AZKC 3WTPA 3AYWB 5CPJD 5GSUD 5CP6A 2CWEA 1F66C 4XUJB 5CPIC 5AV5B 1S32D 4YM6A 1ID3D 3REKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O A;  4Z2M G;  3WKJ C;  3UTA B;  4EO5 B;  4J8W C;  5DNN D;  3AZI C;  5AVB B;  1P3I C;  4H9R A;  3C1B D;  2FJ7 D;  1P3M D;  3MGP D;  4YS3 D;  4LD9 D;  5CPK D;  1P3G C;  1HTA A;  3B0D C;  5BS7 C;  5B40 B;  4NFT A;  3WTP D;  3MNN A;  5CP6 D;  3AZN A;  5BNX A;  2PYO B;  5E5A B;  3O62 D;  3MGS A;  2IO5 C;  1P3O D;  3W99 A;  3REL B;  3B0C T;  3UTB C;  5B1L A;  3X1S A;  3A6N A;  4G91 B;  4QLC A;  5AV9 A;  5FUG B;  2HIO C;  3V9R B;  3W97 A;  5B24 A;  5BO0 A;  3AYW A;  5B1M D;  4XUJ A;  3MNN D;  4J8V B;  3B6F B;  4J8U D;  5G49 B;  1ID3 C;  3REK A;  5B31 D;  3MGS D;  3KWQ B;  1M1A B;  3W99 D;  3LZ0 B;  4WU8 B;  2CV5 C;  2NQB C;  2FJ7 C;  5B1L D;  4UUZ B;  4YS3 C;  3X1S D;  3A6N D;  3LEL A;  5GT0 B;  4G92 C;  3AZF D;  5AV9 D;  5CPK C;  4LD9 C;  2BYM A;  5AY8 C;  4HGA B;  2NZD C;  4E44 A;  1TAF B;  5B0Z C;  2YFV A;  1WWS A;  4CSR A;  5B24 D;  5B2J C;  3B6G A;  5GT3 A;  3AYW D;  5GXQ A;  2BYK A;  4XUJ D;  2PYO A;  5E5A A;  3REK D;  3REL A;  3UTA D;  5B32 G;  5BNV A;  4H9O B;  5AVB D;  2RVQ D;  3UT9 B;  3AZH B;  1P3B A;  3AV2 A;  5CPJ B;  1P3F C;  5FUG A;  5B2I C;  3B0C W;  5B40 D;  2ARO B;  1N1J A;  3VH5 T;  5F99 B;  3NQJ B;  5B1M C;  4AWL B;  1ZLA B;  1KX3 B;  3REH C;  4J8V A;  1U35 B;  3MGP B;  4J8U C;  5G49 A;  3AV1 A;  2PYO D;  5CHL B;  5E5A D;  4H9N B;  3KWQ A;  3X1T B;  3REL D;  1R4V A;  3NQU B;  4UUZ A;  3AZF C;  3AV2 D;  4H9S A;  3W98 B;  3WAA A;  4WV4 B;  3MGR A;  4YM6 B;  5KDM A;  1KX5 C;  5AV5 C;  4J8V D;  3B6F D;  4ZBJ B;  3TU4 C;  1P3G A;  1P3P C;  4WU9 C;  3UTA C;  4EO5 C;  3KWQ D;  1M1A D;  5B0Y C;  3LZ0 D;  3UT9 A;  5AVB C;  4R8P A;  4WU8 D;  3REI C;  3MNN B;  3WA9 C;  5JRG B;  5B40 C;  3MGR D;  3AZN B;  5BNX B;  3C1C A;  3MGS B;  3UTB A;  3VH5 W;  4QLC B;  3AZE B;  5AV6 B;  3AZJ A;  3REJ A;  3W97 B;  4X23 C;  3UT9 D;  5B32 B;  5BO0 B;  3X1U C;  3AFA B;  4CAY B;  4G91 C;  3W98 A;  5JA4 A;  4XZQ B;  2ARO D;  5F99 D;  3AZL C;  1KX4 C;  1ZLA D;  1KX3 D;  1U35 D;  3AZG B;  3LEL B;  4M6B A;  2BYM B;  5C3I B;  1BH9 A;  1A7W A;  1TZY C;  4JJN B;  3X1T D;  3LZ0 C;  3REJ D;  2YFV B;  4CSR B;  4WU8 C;  3B6G B;  4Z5T C;  5GT0 C;  5GT3 B;  5B2J A;  1M19 B;  3W98 D;  4Z66 C;  4H9Q B;  5GXQ B;  2BYK B;  5JRG A;  5DNM A;  1P34 C;  4YM6 D;  5AVC C;  4KGC C;  1P3A B;  4KHA A;  4KUD B;  5AV8 C;  2F8N G;  5BNV B;  3KUY C;  1EQZ C;  1P3B B;  3AV2 B;  3AZE A;  1Q9C A;  3AN2 C;  5AV6 A;  1P3K A;  1F1E A;  1HQ3 A;  2HUE C;  4NE5 A;  3MGQ B;  5B32 A;  1N1J B;  3AZH C;  1AOI C;  3AFA A;  4CAY A;  5CPJ C;  5GSU C;  1S32 C;  5JRG D;  3LZ1 A;  3X1V B;  4XZQ A;  3AV1 B;  2ARO C;  3AZN D;  4ZUX B;  5F99 C;  5DNN C;  4AWL C;  1BH8 A;  3AZM B;  1ULY A;  1KX3 C;  3C1B C;  1ZLA C;  1P3M C;  1U35 C;  3MGP C;  3AZG A;  4QLC D;  3AZK B;  3AZE D;  5AV6 D;  3VH6 A;  3WAA B;  4JJN A;  3MGR B;  3X1T C;  1HQ3 D;  4NE6 A;  3W97 D;  5B32 D;  5KDM B;  1M19 A;  3WTP C;  3AFA D;  3WKJ B;  3LJA A;  5CP6 C;  4H9Q A;  3AZI B;  3W96 A;  1P3L A;  4XZQ D;  3O62 C;  1P3O C;  1P3A A;  1P3G B;  4KUD A;  3B0D B;  4WU9 A;  4R8P B;  3AZG D;  3LEL D;  4JJN D;  3MGQ A;  3C1C B;  5B31 G;  3B6G D;  1M19 D;  2IO5 B;  5GT3 D;  4J8X A;  3LJA D;  3MNN C;  3KXB A;  5GXQ D;  3UTB B;  3X1V A;  1M18 A;  4ZUX A;  5B31 C;  3MGS C;  4NE3 A;  2L5A A;  3W99 C;  1P3A D;  1B6W A;  3AZJ B;  3REJ B;  3AZM A;  4KUD D;  2HIO B;  5B1L C;  5B33 A;  3A6N C;  3X1S C;  1P3B D;  5AV9 C;  4QLC C;  3X1U A;  3MVD A;  3AZK A;  5JA4 B;  1F66 A;  5CPI A;  3W97 C;  3MGQ D;  5B24 C;  4Z2M H;  3WKJ A;  3AYW C;  4J8W A;  3AZI A;  4XUJ C;  1P3I A;  2NQB B;  3X1V D;  3AV1 D;  4G92 B;  3REK C;  1M18 D;  4ZUX D;  1BH9 B;  5BS7 A;  5AY8 B;  2NZD B;  1TZY A;  2RVQ C;  5B0Z B;  3AZM D;  3LEL C;  5B2J B;  3MVD D;  3AZK D;  3WAA D;  1F66 D;  1JFI B;  5DNM B;  5CPI D;  3VH5 A;  4KHA B;  1KU5 A;  3B6G C;  5GT3 C;  3WKJ D;  2F8N H;  3AZI D;  1P3K B;  2PYO C;  5E5A C;  2JSS A;  1P3F B;  5B2I B;  3REL C;  1HQ3 B;  1P3G D;  2HIO A;  4R8P D;  2F8N A;  4WNN A;  1P3B C;  3AV2 C;  3LZ1 B;  3REH B;  3C1C D;  1ID3 A;  1BH8 B;  2CV5 A;  4J8V C;  3UTB D;  2NQB A;  2FJ7 A;  3B6F C;  3AV1 C;  4YS3 A;  4LD9 A;  5CPK A;  5AY8 A;  3KSY A;  3KWQ C;  1M1A C;  2NZD A;  3AZJ D;  5B0Z A;  2HIO D;  2YFW A;  4H9S C;  3LJA B;  4HGA C;  3WAA C;  1KX5 B;  3W96 B;  3MGR C;  1JFI A;  1P3L B;  3O62 A;  3TU4 B;  1P3P B;  4WU9 B;  5B0Y B;  2CV5 D;  2NQB D;  1P3F A;  3REI B;  3VH6 T;  5B2I A;  5AY8 D;  2NZD D;  3WA9 B;  3UT9 C;  4R8P C;  5B0Z D;  4WZS B;  5B2J D;  4J8X B;  3KXB B;  5B1M A;  3REH A;  5DNM D;  4J8U A;  3C1C C;  1M18 B;  5B31 A;  4E45 A;  4X23 B;  5B33 B;  3MVD B;  1P3K D;  3X1U B;  3AZF A;  1P3F D;  1H3O A;  5B2I D;  1F66 B;  3AZJ C;  3REJ C;  5CPI B;  3R45 B;  3W98 C;  2LY8 A;  4J8W B;  3AZL B;  1KX4 B;  1P3I B;  1KX5 A;  1WWI A;  5AV5 A;  3LZ1 D;  3REH D;  4YM6 C;  4DRB A;  3TU4 A;  1P3P A;  3UTA A;  1TZY B;  5B0Y A;  5AVB A;  4ZBJ C;  3REI A;  4Z5T B;  1B67 A;  4Z66 B;  3WA9 A;  5B40 A;  1P34 B;  5AVC B;  5BT1 D;  4KGC B;  3VH6 W;  4H9P B;  5AV8 B;  5JRG C;  3KUY B;  1KX5 D;  3W96 D;  5DNM C;  3AZN C;  1P3L D;  1EQZ B;  5AV5 D;  3AN2 B;  3TU4 D;  1P3P D;  4WU9 D;  2HUE B;  5B0Y D;  4X23 A;  2F8N B;  4WNN B;  1P3K C;  3AZE C;  1AOI B;  5AV6 C;  5GSU B;  3REI D;  1HQ3 C;  1S32 B;  3V9R A;  3WA9 D;  5B32 C;  1ID3 B;  3AFA C;  3R45 A;  5DNN B;  4J8X D;  3AZL A;  1KX4 A;  3KXB D;  2CV5 B;  3LZ1 C;  3C1B B;  1P3M B;  4XZQ C;  2FJ7 B;  3B6F A;  4YS3 B;  4LD9 B;  5CPK B;  1M1A A;  4DRA A;  3LZ0 A;  4WU8 A;  4X23 D;  5B33 D;  3AZG C;  2YFW B;  4Z5T A;  3WTP B;  5GT0 A;  5C3I C;  3X1U D;  4Z66 A;  5CP6 B;  4JJN C;  1BFM A;  1TAF A;  1P34 A;  3WTP E;  3O62 B;  5AVC A;  5BT1 C;  1M19 C;  1P3O B;  4H9P A;  4KGC A;  3LJA C;  5GXQ C;  5AV8 A;  4J8W D;  3KUY A;  3AZL D;  1KX4 D;  3W96 C;  1P3I D;  4H9R B;  1P3L C;  1EQZ A;  3AN2 A;  1P3A C;  4KUD C;  3B0B A;  1TZY D;  4H9O A;  3AZH A;  1AOI A;  5CPJ A;  5GSU A;  4Z5T D;  5GT0 D;  5B1M B;  4Z66 D;  1S32 A;  3MGQ C;  4J8U B;  2F8N K;  2ARO A;  1P34 D;  5F99 A;  5B31 B;  5AVC D;  3NQJ A;  4KGC D;  5DNN A;  4J8X C;  3W99 B;  3KXB C;  5AV8 D;  1ZLA A;  1KX3 A;  3KUY D;  3C1B A;  3X1V C;  1U35 A;  5B1L B;  3MGP A;  1P3M A;  3X1S B;  3A6N B;  4ZUX C;  1M18 C;  3AZF B;  1EQZ D;  5AV9 B;  3AN2 D;  1H3O B;  4H9N A;  3X1T A;  3AZM C;  3NQU A;  2F8N D;  5B33 C;  3AZH D;  5B24 B;  3MVD C;  1AOI D;  3AZK C;  3WTP A;  3AYW B;  5CPJ D;  5GSU D;  5CP6 A;  2CWE A;  1F66 C;  4XUJ B;  5CPI C;  5AV5 B;  1S32 D;  4YM6 A;  1ID3 D;  3REK B; 
#chains in the Genus database with same CATH topology
 1P3O A;  4Z2M G;  3WKJ C;  3UTA B;  4EO5 B;  4J8W C;  5DNN D;  3AZI C;  5AVB B;  1P3I C;  4H9R A;  3C1B D;  2FJ7 D;  1P3M D;  2VQR A;  3MGP D;  4YS3 D;  4LD9 D;  5CPK D;  1P3G C;  1HTA A;  2Y2I A;  3B0D C;  5BS7 C;  5B40 B;  4NFT A;  3WTP D;  3MNN A;  5CP6 D;  2Y2P A;  3AZN A;  5BNX A;  2PYO B;  5E5A B;  2Y2N A;  2JE5 A;  3O62 D;  3MGS A;  2IO5 C;  1P3O D;  3W99 A;  3REL B;  3B0C T;  3UTB C;  2ZY3 A;  5B1L A;  3X1S A;  3A6N A;  4G91 B;  4QLC A;  5AV9 A;  5FUG B;  2DF4 C;  3A1K A;  2HIO C;  3V9R B;  3W97 A;  5B24 A;  5BO0 A;  3AYW A;  5B1M D;  4XUJ A;  3MNN D;  4J8V B;  3B6F B;  4J8U D;  5G49 B;  1ID3 C;  3REK A;  5B31 D;  3MGS D;  3KWQ B;  1M1A B;  3W99 D;  3LZ0 B;  2FFF B;  2Y2K A;  4WU8 B;  2CV5 C;  2NQB C;  2FJ7 C;  5B1L D;  4UUZ B;  4YS3 C;  3X1S D;  3A6N D;  3LEL A;  5GT0 B;  4G92 C;  3AZF D;  5AV9 D;  5CPK C;  4LD9 C;  2BYM A;  5AY8 C;  4HGA B;  2NZD C;  4E44 A;  1TAF B;  5B0Z C;  2W8S A;  1WWS A;  2YFV A;  4CSR A;  5B24 D;  5B2J C;  3B6G A;  5GT3 A;  3AYW D;  5GXQ A;  2BYK A;  4XUJ D;  2PYO A;  5E5A A;  3REK D;  2Y2M A;  3REL A;  3UTA D;  5B32 G;  5BNV A;  4H9O B;  5AVB D;  2RVQ D;  3UT9 B;  3AZH B;  1P3B A;  3AV2 A;  5CPJ B;  1P3F C;  5FUG A;  5B2I C;  3H0R C;  3B0C W;  5B40 D;  2ARO B;  1N1J A;  3VH5 T;  5F99 B;  3NQJ B;  3EPL A;  5B1M C;  4AWL B;  1ZLA B;  1KX3 B;  3REH C;  4J8V A;  2JCH A;  3MGP B;  4J8U C;  1U35 B;  5G49 A;  3AV1 A;  3A1I A;  2PYO D;  5CHL B;  5E5A D;  4H9N B;  3KWQ A;  3X1T B;  3REL D;  1R4V A;  3NQU B;  4UUZ A;  3AZF C;  3AV2 D;  4H9S A;  3W98 B;  3WAA A;  4WV4 B;  3MGR A;  4YM6 B;  5KDM A;  1KX5 C;  5AV5 C;  4J8V D;  3B6F D;  4ZBJ B;  3TU4 C;  1P3G A;  1P3P C;  4WU9 C;  3UTA C;  4EO5 C;  3KWQ D;  1M1A D;  5B0Y C;  3LZ0 D;  2RIQ A;  5AVB C;  4R8P A;  3UT9 A;  4WU8 D;  3REI C;  3MNN B;  2Y2O A;  3WA9 C;  5JRG B;  5B40 C;  3MGR D;  3AZN B;  5BNX B;  3C1C A;  3MGS B;  3UTB A;  3VH5 W;  4QLC B;  3AZE B;  5AV6 B;  2J8P A;  3AZJ A;  3REJ A;  3W97 B;  4X23 C;  3UT9 D;  5B32 B;  5BO0 B;  3X1U C;  3AFA B;  4CAY B;  4G91 C;  3W98 A;  5JA4 A;  4XZQ B;  2ARO D;  5F99 D;  3AZL C;  1KX4 C;  1ZLA D;  1KX3 D;  1U35 D;  3AZG B;  3LEL B;  4M6B A;  2BYM B;  5C3I B;  1BH9 A;  1A7W A;  1TZY C;  1W2E A;  4JJN B;  3X1T D;  3LZ0 C;  3REJ D;  2YFV B;  4CSR B;  4WU8 C;  1Z2C B;  3B6G B;  4Z5T C;  2ZY4 A;  5B2J A;  5GT3 B;  5GT0 C;  1M19 B;  3W98 D;  4Z66 C;  4H9Q B;  5GXQ B;  2BYK B;  5JRG A;  5DNM A;  1P34 C;  4YM6 D;  5AVC C;  4KGC C;  1P3A B;  4KHA A;  4KUD B;  5AV8 C;  2F8N G;  5BNV B;  3KUY C;  1EQZ C;  1P3B B;  3AV2 B;  3AZE A;  1Q9C A;  3AN2 C;  5AV6 A;  1P3K A;  1F1E A;  1HQ3 A;  2HUE C;  4NE5 A;  3MGQ B;  5B32 A;  1N1J B;  3AZH C;  1AOI C;  3AFA A;  4CAY A;  2ZM5 A;  5CPJ C;  5GSU C;  1S32 C;  5JRG D;  3LZ1 A;  3X1V B;  4XZQ A;  3AV1 B;  2ARO C;  3AZN D;  4ZUX B;  5F99 C;  2Y2L A;  5DNN C;  2DQN C;  1BH8 A;  2Y2J A;  1ULY A;  4AWL C;  3C1B C;  3AZM B;  1P3M C;  1U35 C;  1KX3 C;  3MGP C;  3AZG A;  4QLC D;  3AZK B;  3AZE D;  5AV6 D;  3VH6 A;  3WAA B;  4JJN A;  3MGR B;  3X1T C;  1HQ3 D;  4NE6 A;  3W97 D;  5B32 D;  5KDM B;  1M19 A;  3WTP C;  3AFA D;  3WKJ B;  3LJA A;  5CP6 C;  4H9Q A;  3AZI B;  3W96 A;  1P3L A;  4XZQ D;  3O62 C;  1P3O C;  1P3A A;  1P3G B;  4KUD A;  3B0D B;  4WU9 A;  3EPH A;  4R8P B;  2ZY2 A;  2BG1 A;  3AZG D;  3LEL D;  4JJN D;  3MGQ A;  3C1C B;  5B31 G;  3B6G D;  1M19 D;  2IO5 B;  5GT3 D;  4J8X A;  3LJA D;  3MNN C;  3KXB A;  5GXQ D;  3UTB B;  3X1V A;  1M18 A;  4ZUX A;  5B31 C;  3MGS C;  4NE3 A;  2L5A A;  3W99 C;  1P3A D;  1B6W A;  1PZR A;  3REJ B;  3AZM A;  3AZJ B;  4KUD D;  2HIO B;  5B1L C;  5B33 A;  3A6N C;  3X1S C;  1P3B D;  5AV9 C;  4QLC C;  3X1U A;  3MVD A;  3AZK A;  5JA4 B;  3H0L C;  1F66 A;  5CPI A;  3W97 C;  3MGQ D;  5B24 C;  4Z2M H;  3WKJ A;  3AYW C;  4J8W A;  3AZI A;  4XUJ C;  1P3I A;  2NQB B;  3X1V D;  3AV1 D;  4G92 B;  3REK C;  1M18 D;  4ZUX D;  1BH9 B;  5BS7 A;  5AY8 B;  2NZD B;  1TZY A;  2RVQ C;  5B0Z B;  3AZM D;  3LEL C;  5B2J B;  3MVD D;  3AZK D;  3WAA D;  1F66 D;  1JFI B;  5DNM B;  5CPI D;  3VH5 A;  2XD1 A;  4KHA B;  1KU5 A;  3B6G C;  5GT3 C;  3WKJ D;  2F8N H;  3AZI D;  1P3K B;  2PYO C;  5E5A C;  2JSS A;  1P3F B;  5B2I B;  3REL C;  1HQ3 B;  1P3G D;  2HIO A;  4R8P D;  2F8N A;  4WNN A;  2XD5 A;  1P3B C;  3AV2 C;  2Y2H A;  3LZ1 B;  3REH B;  3C1C D;  1ID3 A;  4UPK A;  2G5I C;  1BH8 B;  2CV5 A;  4J8V C;  3UTB D;  2NQB A;  2FJ7 A;  3B6F C;  3AV1 C;  4YS3 A;  4LD9 A;  5CPK A;  5AY8 A;  3KSY A;  3KWQ C;  1M1A C;  2NZD A;  3AZJ D;  5B0Z A;  2HIO D;  3H0M C;  2YFW A;  4H9S C;  3LJA B;  4HGA C;  3WAA C;  1KX5 B;  4DQY B;  3MGR C;  1JFI A;  3W96 B;  1P3L B;  3O62 A;  3TU4 B;  1P3P B;  4WU9 B;  4WJ3 C;  5B0Y B;  2CV5 D;  2NQB D;  1P3F A;  3REI B;  3VH6 T;  5B2I A;  5AY8 D;  2NZD D;  3WA9 B;  3UT9 C;  4R8P C;  5B0Z D;  2ZY5 A;  4WZS B;  5B2J D;  4J8X B;  3KXB B;  5B1M A;  3REH A;  5DNM D;  4J8U A;  3C1C C;  1M18 B;  5B31 A;  4E45 A;  4X23 B;  3EPK A;  5B33 B;  3MVD B;  1P3K D;  3X1U B;  3AZF A;  1P3F D;  1H3O A;  5B2I D;  1F66 B;  3AZJ C;  3REJ C;  5CPI B;  2Y2G A;  3F6T A;  3R45 B;  3W98 C;  2LY8 A;  4J8W B;  3AZL B;  1KX4 B;  1P3I B;  1KX5 A;  1WWI A;  5AV5 A;  3LZ1 D;  3REH D;  4YM6 C;  4DRB A;  3EPJ A;  3TU4 A;  1P3P A;  3UTA A;  1TZY B;  5B0Y A;  5AVB A;  4ZBJ C;  3REI A;  4Z5T B;  1B67 A;  4Z66 B;  3WA9 A;  5B40 A;  1P34 B;  1T3U A;  5AVC B;  5BT1 D;  4KGC B;  3VH6 W;  4H9P B;  5AV8 B;  5JRG C;  3KUY B;  1KX5 D;  3W96 D;  5DNM C;  3AZN C;  1P3L D;  1EQZ B;  5AV5 D;  3AN2 B;  3FDD A;  3TU4 D;  1P3P D;  4WU9 D;  2HUE B;  5B0Y D;  4X23 A;  2F8N B;  4WNN B;  1P3K C;  3AZE C;  1AOI B;  5AV6 C;  5GSU B;  3REI D;  1HQ3 C;  1S32 B;  3V9R A;  3WA9 D;  5B32 C;  1ID3 B;  3AFA C;  3R45 A;  5DNN B;  3IP4 C;  4J8X D;  3AZL A;  1KX4 A;  3KXB D;  2CV5 B;  3LZ1 C;  3C1B B;  1P3M B;  4XZQ C;  2FJ7 B;  3B6F A;  2UWX A;  4YS3 B;  4LD9 B;  5CPK B;  1M1A A;  4DRA A;  3LZ0 A;  4WU8 A;  4X23 D;  5B33 D;  3AZG C;  2YFW B;  3EG5 B;  3WTP B;  4Z5T A;  5C3I C;  5GT0 A;  3X1U D;  4Z66 A;  3P5J B;  5CP6 B;  2F2A C;  4JJN C;  1BFM A;  1TAF A;  1P34 A;  3WTP E;  3O62 B;  5AVC A;  5BT1 C;  1M19 C;  1P3O B;  4H9P A;  4KGC A;  3LJA C;  5GXQ C;  5AV8 A;  4J8W D;  3KUY A;  3AZL D;  1KX4 D;  3W96 C;  1P3I D;  4H9R B;  1P3L C;  1EQZ A;  3AN2 A;  1P3A C;  2Y2Q A;  1ZLA C;  4KUD C;  3B0B A;  1TZY D;  4H9O A;  3AZH A;  1AOI A;  5CPJ A;  5GSU A;  3AL0 C;  4Z5T D;  5GT0 D;  5B1M B;  4Z66 D;  1S32 A;  3MGQ C;  4J8U B;  2F8N K;  2ARO A;  1P34 D;  5F99 A;  5B31 B;  5AVC D;  3NQJ A;  4KGC D;  5DNN A;  4J8X C;  3W99 B;  2G5H C;  3KFU G;  3KXB C;  5AV8 D;  1ZLA A;  1KX3 A;  3KUY D;  3C1B A;  3X1V C;  1U35 A;  5B1L B;  3MGP A;  1P3M A;  3X1S B;  3A6N B;  4ZUX C;  1M18 C;  3AZF B;  1EQZ D;  5AV9 B;  3AN2 D;  1H3O B;  4H9N A;  3X1T A;  3AZM C;  3NQU A;  2F8N D;  5B33 C;  3AZH D;  5B24 B;  3MVD C;  1AOI D;  3AZK C;  3WTP A;  3AYW B;  5CPJ D;  5GSU D;  5CP6 A;  2CWE A;  1F66 C;  4XUJ B;  5CPI C;  5AV5 B;  1S32 D;  4YM6 A;  1ID3 D;  3REK B; 
#chains in the Genus database with same CATH homology
 1P3O A;  4Z2M G;  3WKJ C;  3UTA B;  4EO5 B;  4J8W C;  5DNN D;  3AZI C;  5AVB B;  1P3I C;  4H9R A;  3C1B D;  2FJ7 D;  1P3M D;  2VQR A;  3MGP D;  4YS3 D;  4LD9 D;  5CPK D;  1P3G C;  1HTA A;  2Y2I A;  3B0D C;  5BS7 C;  5B40 B;  4NFT A;  3WTP D;  3MNN A;  5CP6 D;  2Y2P A;  3AZN A;  5BNX A;  2PYO B;  5E5A B;  2Y2N A;  2JE5 A;  3O62 D;  3MGS A;  2IO5 C;  1P3O D;  3W99 A;  3REL B;  3B0C T;  3UTB C;  2ZY3 A;  5B1L A;  3X1S A;  3A6N A;  4G91 B;  4QLC A;  5AV9 A;  5FUG B;  2DF4 C;  3A1K A;  2HIO C;  3V9R B;  3W97 A;  5B24 A;  5BO0 A;  3AYW A;  5B1M D;  4XUJ A;  3MNN D;  4J8V B;  3B6F B;  4J8U D;  5G49 B;  1ID3 C;  3REK A;  5B31 D;  3MGS D;  3KWQ B;  1M1A B;  3W99 D;  3LZ0 B;  2FFF B;  2Y2K A;  4WU8 B;  2CV5 C;  2NQB C;  2FJ7 C;  5B1L D;  4UUZ B;  4YS3 C;  3X1S D;  3A6N D;  3LEL A;  5GT0 B;  4G92 C;  3AZF D;  5AV9 D;  5CPK C;  4LD9 C;  2BYM A;  5AY8 C;  4HGA B;  2NZD C;  4E44 A;  1TAF B;  5B0Z C;  2W8S A;  1WWS A;  2YFV A;  4CSR A;  5B24 D;  5B2J C;  3B6G A;  5GT3 A;  3AYW D;  5GXQ A;  2BYK A;  4XUJ D;  2PYO A;  5E5A A;  3REK D;  2Y2M A;  3REL A;  3UTA D;  5B32 G;  5BNV A;  4H9O B;  5AVB D;  2RVQ D;  3UT9 B;  3AZH B;  1P3B A;  3AV2 A;  5CPJ B;  1P3F C;  5FUG A;  5B2I C;  3H0R C;  3B0C W;  5B40 D;  2ARO B;  1N1J A;  3VH5 T;  5F99 B;  3NQJ B;  3EPL A;  5B1M C;  4AWL B;  1ZLA B;  1KX3 B;  3REH C;  4J8V A;  2JCH A;  3MGP B;  4J8U C;  1U35 B;  5G49 A;  3AV1 A;  3A1I A;  2PYO D;  5CHL B;  5E5A D;  4H9N B;  3KWQ A;  3X1T B;  3REL D;  1R4V A;  3NQU B;  4UUZ A;  3AZF C;  3AV2 D;  4H9S A;  3W98 B;  3WAA A;  4WV4 B;  3MGR A;  4YM6 B;  5KDM A;  1KX5 C;  5AV5 C;  4J8V D;  3B6F D;  4ZBJ B;  3TU4 C;  1P3G A;  1P3P C;  4WU9 C;  3UTA C;  4EO5 C;  3KWQ D;  1M1A D;  5B0Y C;  3LZ0 D;  2RIQ A;  5AVB C;  4R8P A;  3UT9 A;  4WU8 D;  3REI C;  3MNN B;  2Y2O A;  3WA9 C;  5JRG B;  5B40 C;  3MGR D;  3AZN B;  5BNX B;  3C1C A;  3MGS B;  3UTB A;  3VH5 W;  4QLC B;  3AZE B;  5AV6 B;  2J8P A;  3AZJ A;  3REJ A;  3W97 B;  4X23 C;  3UT9 D;  5B32 B;  5BO0 B;  3X1U C;  3AFA B;  4CAY B;  4G91 C;  3W98 A;  5JA4 A;  4XZQ B;  2ARO D;  5F99 D;  3AZL C;  1KX4 C;  1ZLA D;  1KX3 D;  1U35 D;  3AZG B;  3LEL B;  4M6B A;  2BYM B;  5C3I B;  1BH9 A;  1A7W A;  1TZY C;  1W2E A;  4JJN B;  3X1T D;  3LZ0 C;  3REJ D;  2YFV B;  4CSR B;  4WU8 C;  1Z2C B;  3B6G B;  4Z5T C;  2ZY4 A;  5B2J A;  5GT3 B;  5GT0 C;  1M19 B;  3W98 D;  4Z66 C;  4H9Q B;  5GXQ B;  2BYK B;  5JRG A;  5DNM A;  1P34 C;  4YM6 D;  5AVC C;  4KGC C;  1P3A B;  4KHA A;  4KUD B;  5AV8 C;  2F8N G;  5BNV B;  3KUY C;  1EQZ C;  1P3B B;  3AV2 B;  3AZE A;  1Q9C A;  3AN2 C;  5AV6 A;  1P3K A;  1F1E A;  1HQ3 A;  2HUE C;  4NE5 A;  3MGQ B;  5B32 A;  1N1J B;  3AZH C;  1AOI C;  3AFA A;  4CAY A;  2ZM5 A;  5CPJ C;  5GSU C;  1S32 C;  5JRG D;  3LZ1 A;  3X1V B;  4XZQ A;  3AV1 B;  2ARO C;  3AZN D;  4ZUX B;  5F99 C;  2Y2L A;  5DNN C;  2DQN C;  1BH8 A;  2Y2J A;  1ULY A;  4AWL C;  3C1B C;  3AZM B;  1P3M C;  1U35 C;  1KX3 C;  3MGP C;  3AZG A;  4QLC D;  3AZK B;  3AZE D;  5AV6 D;  3VH6 A;  3WAA B;  4JJN A;  3MGR B;  3X1T C;  1HQ3 D;  4NE6 A;  3W97 D;  5B32 D;  5KDM B;  1M19 A;  3WTP C;  3AFA D;  3WKJ B;  3LJA A;  5CP6 C;  4H9Q A;  3AZI B;  3W96 A;  1P3L A;  4XZQ D;  3O62 C;  1P3O C;  1P3A A;  1P3G B;  4KUD A;  3B0D B;  4WU9 A;  3EPH A;  4R8P B;  2ZY2 A;  2BG1 A;  3AZG D;  3LEL D;  4JJN D;  3MGQ A;  3C1C B;  5B31 G;  3B6G D;  1M19 D;  2IO5 B;  5GT3 D;  4J8X A;  3LJA D;  3MNN C;  3KXB A;  5GXQ D;  3UTB B;  3X1V A;  1M18 A;  4ZUX A;  5B31 C;  3MGS C;  4NE3 A;  2L5A A;  3W99 C;  1P3A D;  1B6W A;  1PZR A;  3REJ B;  3AZM A;  3AZJ B;  4KUD D;  2HIO B;  5B1L C;  5B33 A;  3A6N C;  3X1S C;  1P3B D;  5AV9 C;  4QLC C;  3X1U A;  3MVD A;  3AZK A;  5JA4 B;  3H0L C;  1F66 A;  5CPI A;  3W97 C;  3MGQ D;  5B24 C;  4Z2M H;  3WKJ A;  3AYW C;  4J8W A;  3AZI A;  4XUJ C;  1P3I A;  2NQB B;  3X1V D;  3AV1 D;  4G92 B;  3REK C;  1M18 D;  4ZUX D;  1BH9 B;  5BS7 A;  5AY8 B;  2NZD B;  1TZY A;  2RVQ C;  5B0Z B;  3AZM D;  3LEL C;  5B2J B;  3MVD D;  3AZK D;  3WAA D;  1F66 D;  1JFI B;  5DNM B;  5CPI D;  3VH5 A;  2XD1 A;  4KHA B;  1KU5 A;  3B6G C;  5GT3 C;  3WKJ D;  2F8N H;  3AZI D;  1P3K B;  2PYO C;  5E5A C;  2JSS A;  1P3F B;  5B2I B;  3REL C;  1HQ3 B;  1P3G D;  2HIO A;  4R8P D;  2F8N A;  4WNN A;  2XD5 A;  1P3B C;  3AV2 C;  2Y2H A;  3LZ1 B;  3REH B;  3C1C D;  1ID3 A;  4UPK A;  2G5I C;  1BH8 B;  2CV5 A;  4J8V C;  3UTB D;  2NQB A;  2FJ7 A;  3B6F C;  3AV1 C;  4YS3 A;  4LD9 A;  5CPK A;  5AY8 A;  3KSY A;  3KWQ C;  1M1A C;  2NZD A;  3AZJ D;  5B0Z A;  2HIO D;  3H0M C;  2YFW A;  4H9S C;  3LJA B;  4HGA C;  3WAA C;  1KX5 B;  4DQY B;  3MGR C;  1JFI A;  3W96 B;  1P3L B;  3O62 A;  3TU4 B;  1P3P B;  4WU9 B;  4WJ3 C;  5B0Y B;  2CV5 D;  2NQB D;  1P3F A;  3REI B;  3VH6 T;  5B2I A;  5AY8 D;  2NZD D;  3WA9 B;  3UT9 C;  4R8P C;  5B0Z D;  2ZY5 A;  4WZS B;  5B2J D;  4J8X B;  3KXB B;  5B1M A;  3REH A;  5DNM D;  4J8U A;  3C1C C;  1M18 B;  5B31 A;  4E45 A;  4X23 B;  3EPK A;  5B33 B;  3MVD B;  1P3K D;  3X1U B;  3AZF A;  1P3F D;  1H3O A;  5B2I D;  1F66 B;  3AZJ C;  3REJ C;  5CPI B;  2Y2G A;  3F6T A;  3R45 B;  3W98 C;  2LY8 A;  4J8W B;  3AZL B;  1KX4 B;  1P3I B;  1KX5 A;  1WWI A;  5AV5 A;  3LZ1 D;  3REH D;  4YM6 C;  4DRB A;  3EPJ A;  3TU4 A;  1P3P A;  3UTA A;  1TZY B;  5B0Y A;  5AVB A;  4ZBJ C;  3REI A;  4Z5T B;  1B67 A;  4Z66 B;  3WA9 A;  5B40 A;  1P34 B;  1T3U A;  5AVC B;  5BT1 D;  4KGC B;  3VH6 W;  4H9P B;  5AV8 B;  5JRG C;  3KUY B;  1KX5 D;  3W96 D;  5DNM C;  3AZN C;  1P3L D;  1EQZ B;  5AV5 D;  3AN2 B;  3FDD A;  3TU4 D;  1P3P D;  4WU9 D;  2HUE B;  5B0Y D;  4X23 A;  2F8N B;  4WNN B;  1P3K C;  3AZE C;  1AOI B;  5AV6 C;  5GSU B;  3REI D;  1HQ3 C;  1S32 B;  3V9R A;  3WA9 D;  5B32 C;  1ID3 B;  3AFA C;  3R45 A;  5DNN B;  3IP4 C;  4J8X D;  3AZL A;  1KX4 A;  3KXB D;  2CV5 B;  3LZ1 C;  3C1B B;  1P3M B;  4XZQ C;  2FJ7 B;  3B6F A;  2UWX A;  4YS3 B;  4LD9 B;  5CPK B;  1M1A A;  4DRA A;  3LZ0 A;  4WU8 A;  4X23 D;  5B33 D;  3AZG C;  2YFW B;  3EG5 B;  3WTP B;  4Z5T A;  5C3I C;  5GT0 A;  3X1U D;  4Z66 A;  3P5J B;  5CP6 B;  2F2A C;  4JJN C;  1BFM A;  1TAF A;  1P34 A;  3WTP E;  3O62 B;  5AVC A;  5BT1 C;  1M19 C;  1P3O B;  4H9P A;  4KGC A;  3LJA C;  5GXQ C;  5AV8 A;  4J8W D;  3KUY A;  3AZL D;  1KX4 D;  3W96 C;  1P3I D;  4H9R B;  1P3L C;  1EQZ A;  3AN2 A;  1P3A C;  2Y2Q A;  1ZLA C;  4KUD C;  3B0B A;  1TZY D;  4H9O A;  3AZH A;  1AOI A;  5CPJ A;  5GSU A;  3AL0 C;  4Z5T D;  5GT0 D;  5B1M B;  4Z66 D;  1S32 A;  3MGQ C;  4J8U B;  2F8N K;  2ARO A;  1P34 D;  5F99 A;  5B31 B;  5AVC D;  3NQJ A;  4KGC D;  5DNN A;  4J8X C;  3W99 B;  2G5H C;  3KFU G;  3KXB C;  5AV8 D;  1ZLA A;  1KX3 A;  3KUY D;  3C1B A;  3X1V C;  1U35 A;  5B1L B;  3MGP A;  1P3M A;  3X1S B;  3A6N B;  4ZUX C;  1M18 C;  3AZF B;  1EQZ D;  5AV9 B;  3AN2 D;  1H3O B;  4H9N A;  3X1T A;  3AZM C;  3NQU A;  2F8N D;  5B33 C;  3AZH D;  5B24 B;  3MVD C;  1AOI D;  3AZK C;  3WTP A;  3AYW B;  5CPJ D;  5GSU D;  5CP6 A;  2CWE A;  1F66 C;  4XUJ B;  5CPI C;  5AV5 B;  1S32 D;  4YM6 A;  1ID3 D;  3REK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...