5B40C

The nucleosome structure containing h2b-k120 and h4-k31 monoubiquitinations
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
rcsb
source organism Homo sapiens
total genus 29
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b40C00
5BO0A 5AV6C 3UTAA 5CPJA 1KX5B 3AN2D 3KXBC 3AZKC 3REJB 5B24A 1M19D 1M1AB 2HIOC 3W96D 5AV6A 5B0YB 4NFTA 3X1SD 3AZEA 3WA9A 3RELA 3AZGB 3KXBA 3AZKA 3AZMC 4J8UB 4H9OA 4KUDD 2HIOA 4KHAB 3V9RA 1HQ3A 1AOID 1KX4A 1P3AC 3AZMA 3AZNB 1N1JA 2BYKA 3REHA 1ID3C 4J8WD 3MGPA 2NQBD 3AZLB 4ZBJB 4H9QB 4CAYB 4XZQC 3LZ1C 5DNMB 3X1TA 5G49B 1JFIA 5B33C 3NQUB 5B2IB 3MGQD 1P34B 3REKC 3R45A 4H9NA 3WAAC 2PYOD 3LZ0B 4XZQA 5B2JD 5F99C 3LZ1A 3MGRD 1P3BA 1BH9A 4J8XC 4YS3D 1ZLAA 1P3OD 2F8NB 1H3OB 3UT9D 5B1MB 5FUGB 5F99A 1TAFB 4Z66D 2YFWB 4J8XA 4Z2MH 5BT1D 4M6BA 3WKJD 3UTBA 2AROD 4R8PA 1HTAA 1KX5A 4WNNB 3REJA 1U35D 4LD9B 5AY8D 5C3IC 3AZFD 3WTPD 5B1LD 5B0YA 3X1VD 5B32C 3AZGA 5GSUC 3MNND 1R4VA 2CV5B 4H9PB 4J8UA 1M18B 1P3ID 3AZHB 3AV2C 1S32B 5E5AD 4WU9C 4G92C 3AZLC 4NE5A 3KWQD 5AVBB 3AZNA 5CPIB 3AZLA 4H9QA 4CAYA 1TZYB 3O62D 2FJ7B 4DRBA 3AYWC 3LELC 3NQUA 5B2IA 1P34A 1WWSA 5B1MC 3LZ0A 3KUYD 4JJNB 5B40C 1P3KD 4KGCC 4XUJB 2F8NA 1H3OA 5B1MA 5FUGA 1P3FD 2RVQC 1P3MC 2YFWA 3TU4B 5GT3D 1P3PB 1EQZD 3W99B 3VH5A 2BYMB 4X23C 4WNNA 3AZIB 4LD9A 5AV8D 5JA4A 2F8NK 3AZHC 3W97B 5DNND 1S32C 5B31G 2NZDC 4WZSB 3B6GC 3NQJB 3B6FD 3AZJD 2CV5A 4CSRB 4ZUXB 5CPIC 3AZHA 1S32A 4AWLB 4J8VB 1P3GC 3B0DC 3B6GA 1TZYC 3AN2B 3VH5T 3LJAC 5GT0C 5CPKD 5CPIA 1M19B 1A7WA 3C1BC 3C1CC 4Z5TC 1KX3C 1TZYA 5GXQD 2FJ7A 3AFAC 5AV5D 4KUDB 3MVDB 4Z5TA 5B0ZC 5JRGC 3AFAD 3UTAC 5CPJC 1P3LD 4JJNA 1AOIB 4XUJA 5B24C 3W99C 4EO5B 3A6NC 5B0ZA 5JRGA 4J8WB 3AZEC 3WA9C 3REID 2NQBB 3RELC 3AV1B 5AV6D 5AVCC 3TU4A 1P3PA 3W99A 3A6NA 3MGQB 3KXBD 3AZKD 4WU8C 1HQ3C 4HGAB 1KX4C 2PYOB 2HIOD 5B2JB 3AZIA 5AVCA 3REHC 4YS3B 1KX4D 3MGPC 5KDMB 4WU8A 3AZMD 3X1UC 3UT9B 5B31B 3NQJA 3X1TC 4CSRA 4Z66B 4ZUXA 3WKJB 4J8VA 1P3AD 1B67A 3X1UA 1ID3D 1P3BC 3AN2A 3VH6W 1U35B 1ZLAC 4XZQD 3AZFB 3LZ1D 3WTPB 4UUZB 5B1LB 5B33D 3X1VB 5CHLB 3REKD 3MNNB 3WAAD 3UTBC 5F99D 1P3IB 3MVDA 4R8PC 4KUDA 2IO5B 4J8XD 1KX5C 3AV1C 3KWQB 5AV9B 3REJC 1M1AC 1B6WA 4YM6B 4J8WA 5B0YC 2NQBA 3AZGC 3AV1A 1WWIA 3O62B 5B0YD 4J8UC 1M1AA 4DRAA 2PYOA 5B2JA 3KUYB 4H9SC 3AZNC 5CP6B 1P3KB 4KHAA 5B32D 5GSUD 5KDMA 3W98B 3AZND 3B0CW 3UT9A 5B31A 4ZBJC 1P3FB 5DNMC 4H9SA 1Q9CA 3AV2D 4WU9D 4QLCB 5B2IC 3AZLD 1P34C 1EQZB 3LZ0C 5DNMA 3B0CT 5G49A 1U35A 5AV8B 2IO5C 4UUZA 2HUEB 5DNNB 3WTPA 3X1VA 2L5AA 3AYWD 3LELD 5AV9C 3B6FB 3MNNA 3AZJB 5B1MD 1F66B 1P3IA 5B40D 4YM6C 4KGCD 1TAFA 2JSSA 5AV9A 4LD9C 2RVQD 1P3MD 1BFMA 4YM6A 1BH8B 5GXQB 3O62A 2CV5C 1M18C 5CP6C 4X23D 3W98C 5BS7A 3AZHD 5AVBC 3KUYA 1M18A 1S32D 4H9PA 5CP6A 2NZDD 1P3KA 4QLCC 3MGSB 3B6GD 3W98A 2YFVB 5CPID 5AVBA 3REIB 2FJ7C 3WTPE 1P3GD 4QLCA 5AV6B 1EQZA 3W96B 4WV4B 1TZYD 3KXBB 5GT0D 3LJAD 3AZKB 3X1SB 4JJNC 3C1BD 4XUJC 3C1CD 4Z5TD 5B32G 5AV8A 1KX3D 5DNNA 2F8NH 3B6FA 5B0ZD 5JRGD 1F66A 3TU4C 5CPJD 3UTAD 1P3PC 1P3AB 5B24D 1JFIB 3W99D 3A6ND 1ID3B 3AZIC 4E44A 4H9RB 3AZED 3WA9D 3RELD 3W97C 3KSYA 1BH9B 2BYMA 5AVCD 5B33B 1BH8A 5GXQA 3MGRB 3REKB 4ZUXC 4WU8D 1HQ3D 1P3OB 3MGSC 3W97A 3WAAB 4AWLC 4J8VC 4NE6A 3REHD 3VH6A 3AN2C 3MGPD 3X1UD 3MGSA 1M19C 2AROB 3X1TD 3W96C 2YFVA 3X1SC 3REIA 3B0BA 1M19A 5AY8B 4KUDC 3MVDC 3W96A 1P3BD 3X1SA 1ZLAD 1AOIC 5C3IB 3MVDD 3VH6T 4EO5C 5B32B 4J8WC 5GSUB 5E5AB 2NQBC 1AOIA 3UTBD 4R8PD 3AV2B 4WU9B 4G92B 1KX5D 3MGQC 3AV1D 3REJD 1P3AA 4HGAC 1KU5A 2PYOC 1M1AD 5B2JC 1ID3A 3MGRC 4G91B 4H9RA 4YS3C 4E45A 1P3OC 3MGQA 3AZGD 4Z2MG 3UT9C 4J8UD 5B31C 5B33A 3AYWB 3LELB 3MGRA 4Z66C 3REKA 5BT1C 5BNXB 4YS3A 1P3OA 3WKJC 3WAAA 5B31D 2AROC 5B40B 4KGCB 4Z66A 1U35C 4NE3A 3WKJA 5GT3B 2AROA 5AY8C 3AZFC 5DNMD 1P3MB 3WTPC 5B1LC 3X1VC 5B2ID 1P34D 5JA4B 3MNNC 3LZ0D 5AY8A 3AZFA 1P3IC 5B1LA 4X23B 5BNVB 5E5AC 2F8ND 3KWQC 2NZDB 5B32A 3B6GB 5GSUA 5E5AA 5AV9D 3KWQA 3O62C 3AV2A 4G91C 4YM6D 5CPKB 1P3GB 4WU9A 3B0DB 4LD9D 5BS7C 3LJAB 5GT0B 3KUYC 1P3KC 3C1BB 5AV5B 3C1CB 4Z5TB 1KX3B 2CV5D 1M18D 5CP6D 2LY8A 3AFAB 3AYWA 1P3LB 3LELA 1P3FC 3W98D 5BNXA 5B0ZB 5BO0B 5JRGB 1EQZC 5GT3C 3UTAB 5CPJB 5AVBD 5B40A 1F1EA 4QLCD 4KGCA 1P3FA 5B24B 3A6NB 5AV8C 5GT3A 3AZEB 3WA9B 2FJ7D 3RELB 1P3MA 2HUEC 5DNNC 5AVCB 4H9OB 2HIOB 3B6FC 3AZJC 1F66C 3V9RB 4WU8B 1HQ3B 4JJND 1KX4B 3VH5W 4X23A 5BNVA 4XUJD 3AZMB 1N1JB 2BYKB 1F66D 3REHB 3AZJA 3MGPB 5CPKC 2NZDA 3X1UB 3REIC 3X1TB 3TU4D 1P3PD 2CWEA 5GXQC 5CPKA 3R45B 4H9NB 1P3GA 5AV5C 4XZQB 3LZ1B 3AZID 1P3BB 2F8NG 3LJAA 5GT0A 1P3LC 1ZLAB 3W97D 3C1BA 5AV5A 3C1CA 5F99B 1KX3A 1ULYA 4J8XB 4ZUXD 3AFAA 1P3LA 3MGSD 3UTBB 4J8VD 4R8PB
chains in the Genus database with same CATH superfamily
5BO0A 5AV6C 3UTAA 5CPJA 1KX5B 3AN2D 3KXBC 3AZKC 3REJB 5B24A 2ZY4A 2VQRA 1M19D 1M1AB 2HIOC 3W96D 5AV6A 2G5IC 5B0YB 4NFTA 3X1SD 3AZEA 3WA9A 3H0RC 3RELA 3AZGB 3KXBA 3AZKA 3AZMC 1T3UA 4J8UB 4H9OA 4KUDD 2HIOA 4KHAB 3V9RA 1HQ3A 1AOID 1KX4A 1P3AC 3AZMA 3AZNB 1N1JA 2ZY5A 2BYKA 3REHA 1ID3C 4J8WD 3MGPA 3EPJA 2NQBD 3AZLB 4ZBJB 4H9QB 4CAYB 4XZQC 3LZ1C 5DNMB 3X1TA 5G49B 1JFIA 5B33C 3NQUB 5B2IB 3MGQD 1P34B 3REKC 3R45A 4H9NA 3WAAC 2PYOD 3LZ0B 4XZQA 5B2JD 5F99C 3LZ1A 3MGRD 1P3BA 1BH9A 4J8XC 4YS3D 1ZLAA 1P3OD 2F8NB 1H3OB 3UT9D 5B1MB 5FUGB 5F99A 1TAFB 2Y2MA 2YFWB 2JCHA 4Z2MH 5BT1D 4Z66D 4J8XA 4M6BA 3WKJD 3UTBA 2AROD 4R8PA 1HTAA 1KX5A 4WNNB 3REJA 1U35D 4LD9B 5AY8D 5C3IC 3AZFD 3WTPD 5B1LD 5B0YA 3X1VD 5B32C 3AZGA 2Y2GA 5GSUC 3MNND 1R4VA 2CV5B 4H9PB 4J8UA 1M18B 1P3ID 3AZHB 3AV2C 1S32B 5E5AD 4WU9C 4G92C 3AZLC 4NE5A 3KWQD 5AVBB 3AZNA 5CPIB 3AZLA 4H9QA 4CAYA 1TZYB 3O62D 2FJ7B 4DRBA 3AYWC 3LELC 3NQUA 5B2IA 2Y2QA 1P34A 1WWSA 5B1MC 3LZ0A 3KUYD 4JJNB 5B40C 1P3KD 4KGCC 4XUJB 2F8NA 3EG5B 1H3OA 5B1MA 5FUGA 1P3FD 2RVQC 1P3MC 2YFWA 3TU4B 5GT3D 1P3PB 1EQZD 3W99B 2F2AC 3VH5A 2BYMB 4X23C 4WNNA 3AZIB 4LD9A 5AV8D 5JA4A 2F8NK 3AZHC 3W97B 5DNND 1S32C 5B31G 2NZDC 4WZSB 2ZY2A 3B6GC 3NQJB 3B6FD 3AZJD 2CV5A 4CSRB 4ZUXB 5CPIC 3AZHA 1S32A 4AWLB 4J8VB 1P3GC 3B0DC 3B6GA 1TZYC 2G5HC 3AN2B 3VH5T 3LJAC 5GT0C 5CPKD 5CPIA 1M19B 1A7WA 3C1BC 3C1CC 4Z5TC 1KX3C 1TZYA 5GXQD 2FJ7A 3AFAC 5AV5D 4KUDB 3MVDB 4Z5TA 5B0ZC 5JRGC 3AFAD 3UTAC 5CPJC 1P3LD 4JJNA 1AOIB 4XUJA 5B24C 3W99C 4EO5B 3A6NC 3AL0C 5B0ZA 5JRGA 4J8WB 3AZEC 3WA9C 3REID 2W8SA 3RELC 2NQBB 3AV1B 5AV6D 5AVCC 3TU4A 1P3PA 3W99A 3A6NA 3MGQB 3KXBD 3AZKD 4WU8C 1HQ3C 4HGAB 2Y2OA 1KX4C 2PYOB 2HIOD 5B2JB 3AZIA 1Z2CB 5AVCA 3REHC 4YS3B 1KX4D 2Y2JA 3MGPC 5KDMB 4WU8A 3IP4C 3X1UC 3AZMD 3UT9B 5B31B 3NQJA 3X1TC 4CSRA 4Z66B 4ZUXA 3WKJB 4WJ3C 4J8VA 1P3AD 1B67A 3X1UA 3H0LC 1ID3D 1P3BC 3AN2A 2Y2PA 3VH6W 1U35B 1ZLAC 4XZQD 3AZFB 3LZ1D 3WTPB 4UUZB 5B1LB 5B33D 3X1VB 5CHLB 3REKD 3FDDA 3MNNB 3WAAD 3UTBC 5F99D 1P3IB 3MVDA 4R8PC 4KUDA 2IO5B 4J8XD 1KX5C 3AV1C 3KWQB 5AV9B 3REJC 2ZM5A 1M1AC 1B6WA 4YM6B 4J8WA 5B0YC 2NQBA 3AZGC 3AV1A 1WWIA 3O62B 5B0YD 4J8UC 1M1AA 4DRAA 2PYOA 5B2JA 3KUYB 4H9SC 3AZNC 5CP6B 1P3KB 4KHAA 5B32D 5GSUD 5KDMA 3W98B 3AZND 3B0CW 3UT9A 5B31A 4ZBJC 1P3FB 5DNMC 4H9SA 1Q9CA 3AV2D 4WU9D 4QLCB 5B2IC 3AZLD 1P34C 1EQZB 3LZ0C 5DNMA 3B0CT 5G49A 1U35A 5AV8B 3EPHA 2IO5C 4UUZA 2HUEB 5DNNB 3WTPA 3X1VA 2L5AA 3AYWD 3LELD 5AV9C 3B6FB 3MNNA 3AZJB 5B1MD 1F66B 1P3IA 5B40D 4YM6C 4KGCD 2XD5A 1TAFA 2JSSA 5AV9A 4LD9C 2J8PA 2RVQD 1P3MD 1BFMA 4YM6A 2Y2LA 4UPKA 1BH8B 5GXQB 3O62A 2CV5C 1M18C 3P5JB 5CP6C 2Y2NA 4X23D 3W98C 5BS7A 3AZHD 5AVBC 3KUYA 1M18A 1S32D 4H9PA 5CP6A 2NZDD 1P3KA 2BG1A 4QLCC 3MGSB 3B6GD 3W98A 2YFVB 5CPID 5AVBA 3REIB 2FJ7C 2ZY3A 3WTPE 1P3GD 4QLCA 5AV6B 1EQZA 3W96B 4WV4B 1TZYD 3A1IA 3KXBB 5GT0D 3LJAD 3AZKB 3X1SB 4JJNC 3C1BD 4XUJC 3C1CD 4Z5TD 5B32G 5AV8A 1KX3D 5DNNA 2F8NH 3B6FA 5B0ZD 5JRGD 1F66A 3TU4C 5CPJD 3UTAD 1P3PC 1P3AB 5B24D 1JFIB 2RIQA 3W99D 3A6ND 1ID3B 3AZIC 4E44A 4H9RB 3AZED 3WA9D 3RELD 3W97C 3KSYA 2XD1A 1BH9B 2BYMA 5AVCD 5B33B 1BH8A 5GXQA 3MGRB 3REKB 4ZUXC 4WU8D 1HQ3D 1P3OB 3MGSC 3W97A 3WAAB 4AWLC 4J8VC 4NE6A 3REHD 3VH6A 3AN2C 3MGPD 3X1UD 3MGSA 1M19C 2AROB 3X1TD 3W96C 2YFVA 3X1SC 3REIA 3B0BA 1M19A 5AY8B 4KUDC 3MVDC 3W96A 1P3BD 3X1SA 1ZLAD 1AOIC 5C3IB 3MVDD 3VH6T 4EO5C 5B32B 4J8WC 5GSUB 5E5AB 2NQBC 1AOIA 3UTBD 1PZRA 4R8PD 3AV2B 4WU9B 3EPKA 4G92B 1KX5D 3MGQC 3AV1D 3REJD 1P3AA 4HGAC 3H0MC 1KU5A 2PYOC 1M1AD 5B2JC 1ID3A 3MGRC 4G91B 4H9RA 4YS3C 4E45A 1P3OC 3MGQA 3AZGD 4Z2MG 3UT9C 4J8UD 5B31C 5B33A 3AYWB 3LELB 3MGRA 4Z66C 3REKA 5BT1C 5BNXB 4YS3A 1P3OA 3WKJC 3WAAA 5B31D 2AROC 5B40B 4DQYB 4KGCB 3A1KA 4Z66A 1U35C 4NE3A 3WKJA 5GT3B 2AROA 5AY8C 3AZFC 5DNMD 1P3MB 3WTPC 5B1LC 3X1VC 5B2ID 2JE5A 5JA4B 1P34D 3MNNC 3LZ0D 5AY8A 3AZFA 1P3IC 5B1LA 4X23B 5BNVB 5E5AC 2F8ND 3KWQC 2NZDB 5B32A 3B6GB 5GSUA 5E5AA 5AV9D 3KWQA 3O62C 2Y2IA 3AV2A 4G91C 4YM6D 5CPKB 1P3GB 4WU9A 1W2EA 3B0DB 4LD9D 5BS7C 3LJAB 5GT0B 3KUYC 1P3KC 3C1BB 5AV5B 3C1CB 4Z5TB 1KX3B 2DF4C 2CV5D 1M18D 3KFUG 2UWXA 2LY8A 5CP6D 3AFAB 3AYWA 1P3LB 3LELA 1P3FC 3W98D 5BNXA 5B0ZB 5BO0B 5JRGB 1EQZC 5GT3C 3UTAB 5CPJB 5AVBD 5B40A 2Y2HA 1F1EA 3F6TA 4QLCD 1P3FA 4KGCA 2Y2KA 5B24B 3A6NB 5AV8C 3EPLA 5GT3A 3AZEB 3WA9B 2FJ7D 3RELB 1P3MA 2HUEC 5DNNC 5AVCB 4H9OB 2HIOB 3B6FC 3AZJC 1F66C 3V9RB 4WU8B 1HQ3B 4JJND 1KX4B 3VH5W 4X23A 5BNVA 4XUJD 3AZMB 1N1JB 2BYKB 1F66D 3REHB 3AZJA 3MGPB 5CPKC 2NZDA 3X1UB 3REIC 3X1TB 3TU4D 1P3PD 2CWEA 5GXQC 2DQNC 5CPKA 3R45B 4H9NB 1P3GA 5AV5C 2FFFB 4XZQB 3LZ1B 3AZID 1P3BB 2F8NG 3LJAA 5GT0A 1P3LC 1ZLAB 3W97D 3C1BA 5AV5A 3C1CA 5F99B 1KX3A 1ULYA 4J8XB 4ZUXD 3AFAA 1P3LA 3MGSD 3UTBB 4J8VD 4R8PB
chains in the Genus database with same CATH topology
5BO0A 5AV6C 3UTAA 5CPJA 1KX5B 3AN2D 3KXBC 3AZKC 3REJB 5B24A 2ZY4A 2VQRA 1M19D 1M1AB 2HIOC 3W96D 5AV6A 2G5IC 5B0YB 4NFTA 3X1SD 3AZEA 3WA9A 3H0RC 3RELA 3AZGB 3KXBA 3AZKA 3AZMC 1T3UA 4J8UB 4H9OA 4KUDD 2HIOA 4KHAB 3V9RA 1HQ3A 1AOID 1KX4A 1P3AC 3AZMA 3AZNB 1N1JA 2ZY5A 2BYKA 3REHA 1ID3C 4J8WD 3MGPA 3EPJA 2NQBD 3AZLB 4ZBJB 4H9QB 4CAYB 4XZQC 3LZ1C 5DNMB 3X1TA 5G49B 1JFIA 5B33C 3NQUB 5B2IB 3MGQD 1P34B 3REKC 3R45A 4H9NA 3WAAC 2PYOD 3LZ0B 4XZQA 5B2JD 5F99C 3LZ1A 3MGRD 1P3BA 1BH9A 4J8XC 4YS3D 1ZLAA 1P3OD 2F8NB 1H3OB 3UT9D 5B1MB 5FUGB 5F99A 1TAFB 2Y2MA 2YFWB 2JCHA 4Z2MH 5BT1D 4Z66D 4J8XA 4M6BA 3WKJD 3UTBA 2AROD 4R8PA 1HTAA 1KX5A 4WNNB 3REJA 1U35D 4LD9B 5AY8D 5C3IC 3AZFD 3WTPD 5B1LD 5B0YA 3X1VD 5B32C 3AZGA 2Y2GA 5GSUC 3MNND 1R4VA 2CV5B 4H9PB 4J8UA 1M18B 1P3ID 3AZHB 3AV2C 1S32B 5E5AD 4WU9C 4G92C 3AZLC 4NE5A 3KWQD 5AVBB 3AZNA 5CPIB 3AZLA 4H9QA 4CAYA 1TZYB 3O62D 2FJ7B 4DRBA 3AYWC 3LELC 3NQUA 5B2IA 2Y2QA 1P34A 1WWSA 5B1MC 3LZ0A 3KUYD 4JJNB 5B40C 1P3KD 4KGCC 4XUJB 2F8NA 3EG5B 1H3OA 5B1MA 5FUGA 1P3FD 2RVQC 1P3MC 2YFWA 3TU4B 5GT3D 1P3PB 1EQZD 3W99B 2F2AC 3VH5A 2BYMB 4X23C 4WNNA 3AZIB 4LD9A 5AV8D 5JA4A 2F8NK 3AZHC 3W97B 5DNND 1S32C 5B31G 2NZDC 4WZSB 2ZY2A 3B6GC 3NQJB 3B6FD 3AZJD 2CV5A 4CSRB 4ZUXB 5CPIC 3AZHA 1S32A 4AWLB 4J8VB 1P3GC 3B0DC 3B6GA 1TZYC 2G5HC 3AN2B 3VH5T 3LJAC 5GT0C 5CPKD 5CPIA 1M19B 1A7WA 3C1BC 3C1CC 4Z5TC 1KX3C 1TZYA 5GXQD 2FJ7A 3AFAC 5AV5D 4KUDB 3MVDB 4Z5TA 5B0ZC 5JRGC 3AFAD 3UTAC 5CPJC 1P3LD 4JJNA 1AOIB 4XUJA 5B24C 3W99C 4EO5B 3A6NC 3AL0C 5B0ZA 5JRGA 4J8WB 3AZEC 3WA9C 3REID 2W8SA 3RELC 2NQBB 3AV1B 5AV6D 5AVCC 3TU4A 1P3PA 3W99A 3A6NA 3MGQB 3KXBD 3AZKD 4WU8C 1HQ3C 4HGAB 2Y2OA 1KX4C 2PYOB 2HIOD 5B2JB 3AZIA 1Z2CB 5AVCA 3REHC 4YS3B 1KX4D 2Y2JA 3MGPC 5KDMB 4WU8A 3IP4C 3X1UC 3AZMD 3UT9B 5B31B 3NQJA 3X1TC 4CSRA 4Z66B 4ZUXA 3WKJB 4WJ3C 4J8VA 1P3AD 1B67A 3X1UA 3H0LC 1ID3D 1P3BC 3AN2A 2Y2PA 3VH6W 1U35B 1ZLAC 4XZQD 3AZFB 3LZ1D 3WTPB 4UUZB 5B1LB 5B33D 3X1VB 5CHLB 3REKD 3FDDA 3MNNB 3WAAD 3UTBC 5F99D 1P3IB 3MVDA 4R8PC 4KUDA 2IO5B 4J8XD 1KX5C 3AV1C 3KWQB 5AV9B 3REJC 2ZM5A 1M1AC 1B6WA 4YM6B 4J8WA 5B0YC 2NQBA 3AZGC 3AV1A 1WWIA 3O62B 5B0YD 4J8UC 1M1AA 4DRAA 2PYOA 5B2JA 3KUYB 4H9SC 3AZNC 5CP6B 1P3KB 4KHAA 5B32D 5GSUD 5KDMA 3W98B 3AZND 3B0CW 3UT9A 5B31A 4ZBJC 1P3FB 5DNMC 4H9SA 1Q9CA 3AV2D 4WU9D 4QLCB 5B2IC 3AZLD 1P34C 1EQZB 3LZ0C 5DNMA 3B0CT 5G49A 1U35A 5AV8B 3EPHA 2IO5C 4UUZA 2HUEB 5DNNB 3WTPA 3X1VA 2L5AA 3AYWD 3LELD 5AV9C 3B6FB 3MNNA 3AZJB 5B1MD 1F66B 1P3IA 5B40D 4YM6C 4KGCD 2XD5A 1TAFA 2JSSA 5AV9A 4LD9C 2J8PA 2RVQD 1P3MD 1BFMA 4YM6A 2Y2LA 4UPKA 1BH8B 5GXQB 3O62A 2CV5C 1M18C 3P5JB 5CP6C 2Y2NA 4X23D 3W98C 5BS7A 3AZHD 5AVBC 3KUYA 1M18A 1S32D 4H9PA 5CP6A 2NZDD 1P3KA 2BG1A 4QLCC 3MGSB 3B6GD 3W98A 2YFVB 5CPID 5AVBA 3REIB 2FJ7C 2ZY3A 3WTPE 1P3GD 4QLCA 5AV6B 1EQZA 3W96B 4WV4B 1TZYD 3A1IA 3KXBB 5GT0D 3LJAD 3AZKB 3X1SB 4JJNC 3C1BD 4XUJC 3C1CD 4Z5TD 5B32G 5AV8A 1KX3D 5DNNA 2F8NH 3B6FA 5B0ZD 5JRGD 1F66A 3TU4C 5CPJD 3UTAD 1P3PC 1P3AB 5B24D 1JFIB 2RIQA 3W99D 3A6ND 1ID3B 3AZIC 4E44A 4H9RB 3AZED 3WA9D 3RELD 3W97C 3KSYA 2XD1A 1BH9B 2BYMA 5AVCD 5B33B 1BH8A 5GXQA 3MGRB 3REKB 4ZUXC 4WU8D 1HQ3D 1P3OB 3MGSC 3W97A 3WAAB 4AWLC 4J8VC 4NE6A 3REHD 3VH6A 3AN2C 3MGPD 3X1UD 3MGSA 1M19C 2AROB 3X1TD 3W96C 2YFVA 3X1SC 3REIA 3B0BA 1M19A 5AY8B 4KUDC 3MVDC 3W96A 1P3BD 3X1SA 1ZLAD 1AOIC 5C3IB 3MVDD 3VH6T 4EO5C 5B32B 4J8WC 5GSUB 5E5AB 2NQBC 1AOIA 3UTBD 1PZRA 4R8PD 3AV2B 4WU9B 3EPKA 4G92B 1KX5D 3MGQC 3AV1D 3REJD 1P3AA 4HGAC 3H0MC 1KU5A 2PYOC 1M1AD 5B2JC 1ID3A 3MGRC 4G91B 4H9RA 4YS3C 4E45A 1P3OC 3MGQA 3AZGD 4Z2MG 3UT9C 4J8UD 5B31C 5B33A 3AYWB 3LELB 3MGRA 4Z66C 3REKA 5BT1C 5BNXB 4YS3A 1P3OA 3WKJC 3WAAA 5B31D 2AROC 5B40B 4DQYB 4KGCB 3A1KA 4Z66A 1U35C 4NE3A 3WKJA 5GT3B 2AROA 5AY8C 3AZFC 5DNMD 1P3MB 3WTPC 5B1LC 3X1VC 5B2ID 2JE5A 5JA4B 1P34D 3MNNC 3LZ0D 5AY8A 3AZFA 1P3IC 5B1LA 4X23B 5BNVB 5E5AC 2F8ND 3KWQC 2NZDB 5B32A 3B6GB 5GSUA 5E5AA 5AV9D 3KWQA 3O62C 2Y2IA 3AV2A 4G91C 4YM6D 5CPKB 1P3GB 4WU9A 1W2EA 3B0DB 4LD9D 5BS7C 3LJAB 5GT0B 3KUYC 1P3KC 3C1BB 5AV5B 3C1CB 4Z5TB 1KX3B 2DF4C 2CV5D 1M18D 3KFUG 2UWXA 2LY8A 5CP6D 3AFAB 3AYWA 1P3LB 3LELA 1P3FC 3W98D 5BNXA 5B0ZB 5BO0B 5JRGB 1EQZC 5GT3C 3UTAB 5CPJB 5AVBD 5B40A 2Y2HA 1F1EA 3F6TA 4QLCD 1P3FA 4KGCA 2Y2KA 5B24B 3A6NB 5AV8C 3EPLA 5GT3A 3AZEB 3WA9B 2FJ7D 3RELB 1P3MA 2HUEC 5DNNC 5AVCB 4H9OB 2HIOB 3B6FC 3AZJC 1F66C 3V9RB 4WU8B 1HQ3B 4JJND 1KX4B 3VH5W 4X23A 5BNVA 4XUJD 3AZMB 1N1JB 2BYKB 1F66D 3REHB 3AZJA 3MGPB 5CPKC 2NZDA 3X1UB 3REIC 3X1TB 3TU4D 1P3PD 2CWEA 5GXQC 2DQNC 5CPKA 3R45B 4H9NB 1P3GA 5AV5C 2FFFB 4XZQB 3LZ1B 3AZID 1P3BB 2F8NG 3LJAA 5GT0A 1P3LC 1ZLAB 3W97D 3C1BA 5AV5A 3C1CA 5F99B 1KX3A 1ULYA 4J8XB 4ZUXD 3AFAA 1P3LA 3MGSD 3UTBB 4J8VD 4R8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BO0 A;  5AV6 C;  3UTA A;  5CPJ A;  1KX5 B;  3AN2 D;  3KXB C;  3AZK C;  3REJ B;  5B24 A;  1M19 D;  1M1A B;  2HIO C;  3W96 D;  5AV6 A;  5B0Y B;  4NFT A;  3X1S D;  3AZE A;  3WA9 A;  3REL A;  3AZG B;  3KXB A;  3AZK A;  3AZM C;  4J8U B;  4H9O A;  4KUD D;  2HIO A;  4KHA B;  3V9R A;  1HQ3 A;  1AOI D;  1KX4 A;  1P3A C;  3AZM A;  3AZN B;  1N1J A;  2BYK A;  3REH A;  1ID3 C;  4J8W D;  3MGP A;  2NQB D;  3AZL B;  4ZBJ B;  4H9Q B;  4CAY B;  4XZQ C;  3LZ1 C;  5DNM B;  3X1T A;  5G49 B;  1JFI A;  5B33 C;  3NQU B;  5B2I B;  3MGQ D;  1P34 B;  3REK C;  3R45 A;  4H9N A;  3WAA C;  2PYO D;  3LZ0 B;  4XZQ A;  5B2J D;  5F99 C;  3LZ1 A;  3MGR D;  1P3B A;  1BH9 A;  4J8X C;  4YS3 D;  1ZLA A;  1P3O D;  2F8N B;  1H3O B;  3UT9 D;  5B1M B;  5FUG B;  5F99 A;  1TAF B;  4Z66 D;  2YFW B;  4J8X A;  4Z2M H;  5BT1 D;  4M6B A;  3WKJ D;  3UTB A;  2ARO D;  4R8P A;  1HTA A;  1KX5 A;  4WNN B;  3REJ A;  1U35 D;  4LD9 B;  5AY8 D;  5C3I C;  3AZF D;  3WTP D;  5B1L D;  5B0Y A;  3X1V D;  5B32 C;  3AZG A;  5GSU C;  3MNN D;  1R4V A;  2CV5 B;  4H9P B;  4J8U A;  1M18 B;  1P3I D;  3AZH B;  3AV2 C;  1S32 B;  5E5A D;  4WU9 C;  4G92 C;  3AZL C;  4NE5 A;  3KWQ D;  5AVB B;  3AZN A;  5CPI B;  3AZL A;  4H9Q A;  4CAY A;  1TZY B;  3O62 D;  2FJ7 B;  4DRB A;  3AYW C;  3LEL C;  3NQU A;  5B2I A;  1P34 A;  1WWS A;  5B1M C;  3LZ0 A;  3KUY D;  4JJN B;  5B40 C;  1P3K D;  4KGC C;  4XUJ B;  2F8N A;  1H3O A;  5B1M A;  5FUG A;  1P3F D;  2RVQ C;  1P3M C;  2YFW A;  3TU4 B;  5GT3 D;  1P3P B;  1EQZ D;  3W99 B;  3VH5 A;  2BYM B;  4X23 C;  4WNN A;  3AZI B;  4LD9 A;  5AV8 D;  5JA4 A;  2F8N K;  3AZH C;  3W97 B;  5DNN D;  1S32 C;  5B31 G;  2NZD C;  4WZS B;  3B6G C;  3NQJ B;  3B6F D;  3AZJ D;  2CV5 A;  4CSR B;  4ZUX B;  5CPI C;  3AZH A;  1S32 A;  4AWL B;  4J8V B;  1P3G C;  3B0D C;  3B6G A;  1TZY C;  3AN2 B;  3VH5 T;  3LJA C;  5GT0 C;  5CPK D;  5CPI A;  1M19 B;  1A7W A;  3C1B C;  3C1C C;  4Z5T C;  1KX3 C;  1TZY A;  5GXQ D;  2FJ7 A;  3AFA C;  5AV5 D;  4KUD B;  3MVD B;  4Z5T A;  5B0Z C;  5JRG C;  3AFA D;  3UTA C;  5CPJ C;  1P3L D;  4JJN A;  1AOI B;  4XUJ A;  5B24 C;  3W99 C;  4EO5 B;  3A6N C;  5B0Z A;  5JRG A;  4J8W B;  3AZE C;  3WA9 C;  3REI D;  2NQB B;  3REL C;  3AV1 B;  5AV6 D;  5AVC C;  3TU4 A;  1P3P A;  3W99 A;  3A6N A;  3MGQ B;  3KXB D;  3AZK D;  4WU8 C;  1HQ3 C;  4HGA B;  1KX4 C;  2PYO B;  2HIO D;  5B2J B;  3AZI A;  5AVC A;  3REH C;  4YS3 B;  1KX4 D;  3MGP C;  5KDM B;  4WU8 A;  3AZM D;  3X1U C;  3UT9 B;  5B31 B;  3NQJ A;  3X1T C;  4CSR A;  4Z66 B;  4ZUX A;  3WKJ B;  4J8V A;  1P3A D;  1B67 A;  3X1U A;  1ID3 D;  1P3B C;  3AN2 A;  3VH6 W;  1U35 B;  1ZLA C;  4XZQ D;  3AZF B;  3LZ1 D;  3WTP B;  4UUZ B;  5B1L B;  5B33 D;  3X1V B;  5CHL B;  3REK D;  3MNN B;  3WAA D;  3UTB C;  5F99 D;  1P3I B;  3MVD A;  4R8P C;  4KUD A;  2IO5 B;  4J8X D;  1KX5 C;  3AV1 C;  3KWQ B;  5AV9 B;  3REJ C;  1M1A C;  1B6W A;  4YM6 B;  4J8W A;  5B0Y C;  2NQB A;  3AZG C;  3AV1 A;  1WWI A;  3O62 B;  5B0Y D;  4J8U C;  1M1A A;  4DRA A;  2PYO A;  5B2J A;  3KUY B;  4H9S C;  3AZN C;  5CP6 B;  1P3K B;  4KHA A;  5B32 D;  5GSU D;  5KDM A;  3W98 B;  3AZN D;  3B0C W;  3UT9 A;  5B31 A;  4ZBJ C;  1P3F B;  5DNM C;  4H9S A;  1Q9C A;  3AV2 D;  4WU9 D;  4QLC B;  5B2I C;  3AZL D;  1P34 C;  1EQZ B;  3LZ0 C;  5DNM A;  3B0C T;  5G49 A;  1U35 A;  5AV8 B;  2IO5 C;  4UUZ A;  2HUE B;  5DNN B;  3WTP A;  3X1V A;  2L5A A;  3AYW D;  3LEL D;  5AV9 C;  3B6F B;  3MNN A;  3AZJ B;  5B1M D;  1F66 B;  1P3I A;  5B40 D;  4YM6 C;  4KGC D;  1TAF A;  2JSS A;  5AV9 A;  4LD9 C;  2RVQ D;  1P3M D;  1BFM A;  4YM6 A;  1BH8 B;  5GXQ B;  3O62 A;  2CV5 C;  1M18 C;  5CP6 C;  4X23 D;  3W98 C;  5BS7 A;  3AZH D;  5AVB C;  3KUY A;  1M18 A;  1S32 D;  4H9P A;  5CP6 A;  2NZD D;  1P3K A;  4QLC C;  3MGS B;  3B6G D;  3W98 A;  2YFV B;  5CPI D;  5AVB A;  3REI B;  2FJ7 C;  3WTP E;  1P3G D;  4QLC A;  5AV6 B;  1EQZ A;  3W96 B;  4WV4 B;  1TZY D;  3KXB B;  5GT0 D;  3LJA D;  3AZK B;  3X1S B;  4JJN C;  3C1B D;  4XUJ C;  3C1C D;  4Z5T D;  5B32 G;  5AV8 A;  1KX3 D;  5DNN A;  2F8N H;  3B6F A;  5B0Z D;  5JRG D;  1F66 A;  3TU4 C;  5CPJ D;  3UTA D;  1P3P C;  1P3A B;  5B24 D;  1JFI B;  3W99 D;  3A6N D;  1ID3 B;  3AZI C;  4E44 A;  4H9R B;  3AZE D;  3WA9 D;  3REL D;  3W97 C;  3KSY A;  1BH9 B;  2BYM A;  5AVC D;  5B33 B;  1BH8 A;  5GXQ A;  3MGR B;  3REK B;  4ZUX C;  4WU8 D;  1HQ3 D;  1P3O B;  3MGS C;  3W97 A;  3WAA B;  4AWL C;  4J8V C;  4NE6 A;  3REH D;  3VH6 A;  3AN2 C;  3MGP D;  3X1U D;  3MGS A;  1M19 C;  2ARO B;  3X1T D;  3W96 C;  2YFV A;  3X1S C;  3REI A;  3B0B A;  1M19 A;  5AY8 B;  4KUD C;  3MVD C;  3W96 A;  1P3B D;  3X1S A;  1ZLA D;  1AOI C;  5C3I B;  3MVD D;  3VH6 T;  4EO5 C;  5B32 B;  4J8W C;  5GSU B;  5E5A B;  2NQB C;  1AOI A;  3UTB D;  4R8P D;  3AV2 B;  4WU9 B;  4G92 B;  1KX5 D;  3MGQ C;  3AV1 D;  3REJ D;  1P3A A;  4HGA C;  1KU5 A;  2PYO C;  1M1A D;  5B2J C;  1ID3 A;  3MGR C;  4G91 B;  4H9R A;  4YS3 C;  4E45 A;  1P3O C;  3MGQ A;  3AZG D;  4Z2M G;  3UT9 C;  4J8U D;  5B31 C;  5B33 A;  3AYW B;  3LEL B;  3MGR A;  4Z66 C;  3REK A;  5BT1 C;  5BNX B;  4YS3 A;  1P3O A;  3WKJ C;  3WAA A;  5B31 D;  2ARO C;  5B40 B;  4KGC B;  4Z66 A;  1U35 C;  4NE3 A;  3WKJ A;  5GT3 B;  2ARO A;  5AY8 C;  3AZF C;  5DNM D;  1P3M B;  3WTP C;  5B1L C;  3X1V C;  5B2I D;  1P34 D;  5JA4 B;  3MNN C;  3LZ0 D;  5AY8 A;  3AZF A;  1P3I C;  5B1L A;  4X23 B;  5BNV B;  5E5A C;  2F8N D;  3KWQ C;  2NZD B;  5B32 A;  3B6G B;  5GSU A;  5E5A A;  5AV9 D;  3KWQ A;  3O62 C;  3AV2 A;  4G91 C;  4YM6 D;  5CPK B;  1P3G B;  4WU9 A;  3B0D B;  4LD9 D;  5BS7 C;  3LJA B;  5GT0 B;  3KUY C;  1P3K C;  3C1B B;  5AV5 B;  3C1C B;  4Z5T B;  1KX3 B;  2CV5 D;  1M18 D;  5CP6 D;  2LY8 A;  3AFA B;  3AYW A;  1P3L B;  3LEL A;  1P3F C;  3W98 D;  5BNX A;  5B0Z B;  5BO0 B;  5JRG B;  1EQZ C;  5GT3 C;  3UTA B;  5CPJ B;  5AVB D;  5B40 A;  1F1E A;  4QLC D;  4KGC A;  1P3F A;  5B24 B;  3A6N B;  5AV8 C;  5GT3 A;  3AZE B;  3WA9 B;  2FJ7 D;  3REL B;  1P3M A;  2HUE C;  5DNN C;  5AVC B;  4H9O B;  2HIO B;  3B6F C;  3AZJ C;  1F66 C;  3V9R B;  4WU8 B;  1HQ3 B;  4JJN D;  1KX4 B;  3VH5 W;  4X23 A;  5BNV A;  4XUJ D;  3AZM B;  1N1J B;  2BYK B;  1F66 D;  3REH B;  3AZJ A;  3MGP B;  5CPK C;  2NZD A;  3X1U B;  3REI C;  3X1T B;  3TU4 D;  1P3P D;  2CWE A;  5GXQ C;  5CPK A;  3R45 B;  4H9N B;  1P3G A;  5AV5 C;  4XZQ B;  3LZ1 B;  3AZI D;  1P3B B;  2F8N G;  3LJA A;  5GT0 A;  1P3L C;  1ZLA B;  3W97 D;  3C1B A;  5AV5 A;  3C1C A;  5F99 B;  1KX3 A;  1ULY A;  4J8X B;  4ZUX D;  3AFA A;  1P3L A;  3MGS D;  3UTB B;  4J8V D;  4R8P B; 
#chains in the Genus database with same CATH topology
 5BO0 A;  5AV6 C;  3UTA A;  5CPJ A;  1KX5 B;  3AN2 D;  3KXB C;  3AZK C;  3REJ B;  5B24 A;  2ZY4 A;  2VQR A;  1M19 D;  1M1A B;  2HIO C;  3W96 D;  5AV6 A;  2G5I C;  5B0Y B;  4NFT A;  3X1S D;  3AZE A;  3WA9 A;  3H0R C;  3REL A;  3AZG B;  3KXB A;  3AZK A;  3AZM C;  1T3U A;  4J8U B;  4H9O A;  4KUD D;  2HIO A;  4KHA B;  3V9R A;  1HQ3 A;  1AOI D;  1KX4 A;  1P3A C;  3AZM A;  3AZN B;  1N1J A;  2ZY5 A;  2BYK A;  3REH A;  1ID3 C;  4J8W D;  3MGP A;  3EPJ A;  2NQB D;  3AZL B;  4ZBJ B;  4H9Q B;  4CAY B;  4XZQ C;  3LZ1 C;  5DNM B;  3X1T A;  5G49 B;  1JFI A;  5B33 C;  3NQU B;  5B2I B;  3MGQ D;  1P34 B;  3REK C;  3R45 A;  4H9N A;  3WAA C;  2PYO D;  3LZ0 B;  4XZQ A;  5B2J D;  5F99 C;  3LZ1 A;  3MGR D;  1P3B A;  1BH9 A;  4J8X C;  4YS3 D;  1ZLA A;  1P3O D;  2F8N B;  1H3O B;  3UT9 D;  5B1M B;  5FUG B;  5F99 A;  1TAF B;  2Y2M A;  2YFW B;  2JCH A;  4Z2M H;  5BT1 D;  4Z66 D;  4J8X A;  4M6B A;  3WKJ D;  3UTB A;  2ARO D;  4R8P A;  1HTA A;  1KX5 A;  4WNN B;  3REJ A;  1U35 D;  4LD9 B;  5AY8 D;  5C3I C;  3AZF D;  3WTP D;  5B1L D;  5B0Y A;  3X1V D;  5B32 C;  3AZG A;  2Y2G A;  5GSU C;  3MNN D;  1R4V A;  2CV5 B;  4H9P B;  4J8U A;  1M18 B;  1P3I D;  3AZH B;  3AV2 C;  1S32 B;  5E5A D;  4WU9 C;  4G92 C;  3AZL C;  4NE5 A;  3KWQ D;  5AVB B;  3AZN A;  5CPI B;  3AZL A;  4H9Q A;  4CAY A;  1TZY B;  3O62 D;  2FJ7 B;  4DRB A;  3AYW C;  3LEL C;  3NQU A;  5B2I A;  2Y2Q A;  1P34 A;  1WWS A;  5B1M C;  3LZ0 A;  3KUY D;  4JJN B;  5B40 C;  1P3K D;  4KGC C;  4XUJ B;  2F8N A;  3EG5 B;  1H3O A;  5B1M A;  5FUG A;  1P3F D;  2RVQ C;  1P3M C;  2YFW A;  3TU4 B;  5GT3 D;  1P3P B;  1EQZ D;  3W99 B;  2F2A C;  3VH5 A;  2BYM B;  4X23 C;  4WNN A;  3AZI B;  4LD9 A;  5AV8 D;  5JA4 A;  2F8N K;  3AZH C;  3W97 B;  5DNN D;  1S32 C;  5B31 G;  2NZD C;  4WZS B;  2ZY2 A;  3B6G C;  3NQJ B;  3B6F D;  3AZJ D;  2CV5 A;  4CSR B;  4ZUX B;  5CPI C;  3AZH A;  1S32 A;  4AWL B;  4J8V B;  1P3G C;  3B0D C;  3B6G A;  1TZY C;  2G5H C;  3AN2 B;  3VH5 T;  3LJA C;  5GT0 C;  5CPK D;  5CPI A;  1M19 B;  1A7W A;  3C1B C;  3C1C C;  4Z5T C;  1KX3 C;  1TZY A;  5GXQ D;  2FJ7 A;  3AFA C;  5AV5 D;  4KUD B;  3MVD B;  4Z5T A;  5B0Z C;  5JRG C;  3AFA D;  3UTA C;  5CPJ C;  1P3L D;  4JJN A;  1AOI B;  4XUJ A;  5B24 C;  3W99 C;  4EO5 B;  3A6N C;  3AL0 C;  5B0Z A;  5JRG A;  4J8W B;  3AZE C;  3WA9 C;  3REI D;  2W8S A;  3REL C;  2NQB B;  3AV1 B;  5AV6 D;  5AVC C;  3TU4 A;  1P3P A;  3W99 A;  3A6N A;  3MGQ B;  3KXB D;  3AZK D;  4WU8 C;  1HQ3 C;  4HGA B;  2Y2O A;  1KX4 C;  2PYO B;  2HIO D;  5B2J B;  3AZI A;  1Z2C B;  5AVC A;  3REH C;  4YS3 B;  1KX4 D;  2Y2J A;  3MGP C;  5KDM B;  4WU8 A;  3IP4 C;  3X1U C;  3AZM D;  3UT9 B;  5B31 B;  3NQJ A;  3X1T C;  4CSR A;  4Z66 B;  4ZUX A;  3WKJ B;  4WJ3 C;  4J8V A;  1P3A D;  1B67 A;  3X1U A;  3H0L C;  1ID3 D;  1P3B C;  3AN2 A;  2Y2P A;  3VH6 W;  1U35 B;  1ZLA C;  4XZQ D;  3AZF B;  3LZ1 D;  3WTP B;  4UUZ B;  5B1L B;  5B33 D;  3X1V B;  5CHL B;  3REK D;  3FDD A;  3MNN B;  3WAA D;  3UTB C;  5F99 D;  1P3I B;  3MVD A;  4R8P C;  4KUD A;  2IO5 B;  4J8X D;  1KX5 C;  3AV1 C;  3KWQ B;  5AV9 B;  3REJ C;  2ZM5 A;  1M1A C;  1B6W A;  4YM6 B;  4J8W A;  5B0Y C;  2NQB A;  3AZG C;  3AV1 A;  1WWI A;  3O62 B;  5B0Y D;  4J8U C;  1M1A A;  4DRA A;  2PYO A;  5B2J A;  3KUY B;  4H9S C;  3AZN C;  5CP6 B;  1P3K B;  4KHA A;  5B32 D;  5GSU D;  5KDM A;  3W98 B;  3AZN D;  3B0C W;  3UT9 A;  5B31 A;  4ZBJ C;  1P3F B;  5DNM C;  4H9S A;  1Q9C A;  3AV2 D;  4WU9 D;  4QLC B;  5B2I C;  3AZL D;  1P34 C;  1EQZ B;  3LZ0 C;  5DNM A;  3B0C T;  5G49 A;  1U35 A;  5AV8 B;  3EPH A;  2IO5 C;  4UUZ A;  2HUE B;  5DNN B;  3WTP A;  3X1V A;  2L5A A;  3AYW D;  3LEL D;  5AV9 C;  3B6F B;  3MNN A;  3AZJ B;  5B1M D;  1F66 B;  1P3I A;  5B40 D;  4YM6 C;  4KGC D;  2XD5 A;  1TAF A;  2JSS A;  5AV9 A;  4LD9 C;  2J8P A;  2RVQ D;  1P3M D;  1BFM A;  4YM6 A;  2Y2L A;  4UPK A;  1BH8 B;  5GXQ B;  3O62 A;  2CV5 C;  1M18 C;  3P5J B;  5CP6 C;  2Y2N A;  4X23 D;  3W98 C;  5BS7 A;  3AZH D;  5AVB C;  3KUY A;  1M18 A;  1S32 D;  4H9P A;  5CP6 A;  2NZD D;  1P3K A;  2BG1 A;  4QLC C;  3MGS B;  3B6G D;  3W98 A;  2YFV B;  5CPI D;  5AVB A;  3REI B;  2FJ7 C;  2ZY3 A;  3WTP E;  1P3G D;  4QLC A;  5AV6 B;  1EQZ A;  3W96 B;  4WV4 B;  1TZY D;  3A1I A;  3KXB B;  5GT0 D;  3LJA D;  3AZK B;  3X1S B;  4JJN C;  3C1B D;  4XUJ C;  3C1C D;  4Z5T D;  5B32 G;  5AV8 A;  1KX3 D;  5DNN A;  2F8N H;  3B6F A;  5B0Z D;  5JRG D;  1F66 A;  3TU4 C;  5CPJ D;  3UTA D;  1P3P C;  1P3A B;  5B24 D;  1JFI B;  2RIQ A;  3W99 D;  3A6N D;  1ID3 B;  3AZI C;  4E44 A;  4H9R B;  3AZE D;  3WA9 D;  3REL D;  3W97 C;  3KSY A;  2XD1 A;  1BH9 B;  2BYM A;  5AVC D;  5B33 B;  1BH8 A;  5GXQ A;  3MGR B;  3REK B;  4ZUX C;  4WU8 D;  1HQ3 D;  1P3O B;  3MGS C;  3W97 A;  3WAA B;  4AWL C;  4J8V C;  4NE6 A;  3REH D;  3VH6 A;  3AN2 C;  3MGP D;  3X1U D;  3MGS A;  1M19 C;  2ARO B;  3X1T D;  3W96 C;  2YFV A;  3X1S C;  3REI A;  3B0B A;  1M19 A;  5AY8 B;  4KUD C;  3MVD C;  3W96 A;  1P3B D;  3X1S A;  1ZLA D;  1AOI C;  5C3I B;  3MVD D;  3VH6 T;  4EO5 C;  5B32 B;  4J8W C;  5GSU B;  5E5A B;  2NQB C;  1AOI A;  3UTB D;  1PZR A;  4R8P D;  3AV2 B;  4WU9 B;  3EPK A;  4G92 B;  1KX5 D;  3MGQ C;  3AV1 D;  3REJ D;  1P3A A;  4HGA C;  3H0M C;  1KU5 A;  2PYO C;  1M1A D;  5B2J C;  1ID3 A;  3MGR C;  4G91 B;  4H9R A;  4YS3 C;  4E45 A;  1P3O C;  3MGQ A;  3AZG D;  4Z2M G;  3UT9 C;  4J8U D;  5B31 C;  5B33 A;  3AYW B;  3LEL B;  3MGR A;  4Z66 C;  3REK A;  5BT1 C;  5BNX B;  4YS3 A;  1P3O A;  3WKJ C;  3WAA A;  5B31 D;  2ARO C;  5B40 B;  4DQY B;  4KGC B;  3A1K A;  4Z66 A;  1U35 C;  4NE3 A;  3WKJ A;  5GT3 B;  2ARO A;  5AY8 C;  3AZF C;  5DNM D;  1P3M B;  3WTP C;  5B1L C;  3X1V C;  5B2I D;  2JE5 A;  5JA4 B;  1P34 D;  3MNN C;  3LZ0 D;  5AY8 A;  3AZF A;  1P3I C;  5B1L A;  4X23 B;  5BNV B;  5E5A C;  2F8N D;  3KWQ C;  2NZD B;  5B32 A;  3B6G B;  5GSU A;  5E5A A;  5AV9 D;  3KWQ A;  3O62 C;  2Y2I A;  3AV2 A;  4G91 C;  4YM6 D;  5CPK B;  1P3G B;  4WU9 A;  1W2E A;  3B0D B;  4LD9 D;  5BS7 C;  3LJA B;  5GT0 B;  3KUY C;  1P3K C;  3C1B B;  5AV5 B;  3C1C B;  4Z5T B;  1KX3 B;  2DF4 C;  2CV5 D;  1M18 D;  3KFU G;  2UWX A;  2LY8 A;  5CP6 D;  3AFA B;  3AYW A;  1P3L B;  3LEL A;  1P3F C;  3W98 D;  5BNX A;  5B0Z B;  5BO0 B;  5JRG B;  1EQZ C;  5GT3 C;  3UTA B;  5CPJ B;  5AVB D;  5B40 A;  2Y2H A;  1F1E A;  3F6T A;  4QLC D;  1P3F A;  4KGC A;  2Y2K A;  5B24 B;  3A6N B;  5AV8 C;  3EPL A;  5GT3 A;  3AZE B;  3WA9 B;  2FJ7 D;  3REL B;  1P3M A;  2HUE C;  5DNN C;  5AVC B;  4H9O B;  2HIO B;  3B6F C;  3AZJ C;  1F66 C;  3V9R B;  4WU8 B;  1HQ3 B;  4JJN D;  1KX4 B;  3VH5 W;  4X23 A;  5BNV A;  4XUJ D;  3AZM B;  1N1J B;  2BYK B;  1F66 D;  3REH B;  3AZJ A;  3MGP B;  5CPK C;  2NZD A;  3X1U B;  3REI C;  3X1T B;  3TU4 D;  1P3P D;  2CWE A;  5GXQ C;  2DQN C;  5CPK A;  3R45 B;  4H9N B;  1P3G A;  5AV5 C;  2FFF B;  4XZQ B;  3LZ1 B;  3AZI D;  1P3B B;  2F8N G;  3LJA A;  5GT0 A;  1P3L C;  1ZLA B;  3W97 D;  3C1B A;  5AV5 A;  3C1C A;  5F99 B;  1KX3 A;  1ULY A;  4J8X B;  4ZUX D;  3AFA A;  1P3L A;  3MGS D;  3UTB B;  4J8V D;  4R8P B; 
#chains in the Genus database with same CATH homology
 5BO0 A;  5AV6 C;  3UTA A;  5CPJ A;  1KX5 B;  3AN2 D;  3KXB C;  3AZK C;  3REJ B;  5B24 A;  2ZY4 A;  2VQR A;  1M19 D;  1M1A B;  2HIO C;  3W96 D;  5AV6 A;  2G5I C;  5B0Y B;  4NFT A;  3X1S D;  3AZE A;  3WA9 A;  3H0R C;  3REL A;  3AZG B;  3KXB A;  3AZK A;  3AZM C;  1T3U A;  4J8U B;  4H9O A;  4KUD D;  2HIO A;  4KHA B;  3V9R A;  1HQ3 A;  1AOI D;  1KX4 A;  1P3A C;  3AZM A;  3AZN B;  1N1J A;  2ZY5 A;  2BYK A;  3REH A;  1ID3 C;  4J8W D;  3MGP A;  3EPJ A;  2NQB D;  3AZL B;  4ZBJ B;  4H9Q B;  4CAY B;  4XZQ C;  3LZ1 C;  5DNM B;  3X1T A;  5G49 B;  1JFI A;  5B33 C;  3NQU B;  5B2I B;  3MGQ D;  1P34 B;  3REK C;  3R45 A;  4H9N A;  3WAA C;  2PYO D;  3LZ0 B;  4XZQ A;  5B2J D;  5F99 C;  3LZ1 A;  3MGR D;  1P3B A;  1BH9 A;  4J8X C;  4YS3 D;  1ZLA A;  1P3O D;  2F8N B;  1H3O B;  3UT9 D;  5B1M B;  5FUG B;  5F99 A;  1TAF B;  2Y2M A;  2YFW B;  2JCH A;  4Z2M H;  5BT1 D;  4Z66 D;  4J8X A;  4M6B A;  3WKJ D;  3UTB A;  2ARO D;  4R8P A;  1HTA A;  1KX5 A;  4WNN B;  3REJ A;  1U35 D;  4LD9 B;  5AY8 D;  5C3I C;  3AZF D;  3WTP D;  5B1L D;  5B0Y A;  3X1V D;  5B32 C;  3AZG A;  2Y2G A;  5GSU C;  3MNN D;  1R4V A;  2CV5 B;  4H9P B;  4J8U A;  1M18 B;  1P3I D;  3AZH B;  3AV2 C;  1S32 B;  5E5A D;  4WU9 C;  4G92 C;  3AZL C;  4NE5 A;  3KWQ D;  5AVB B;  3AZN A;  5CPI B;  3AZL A;  4H9Q A;  4CAY A;  1TZY B;  3O62 D;  2FJ7 B;  4DRB A;  3AYW C;  3LEL C;  3NQU A;  5B2I A;  2Y2Q A;  1P34 A;  1WWS A;  5B1M C;  3LZ0 A;  3KUY D;  4JJN B;  5B40 C;  1P3K D;  4KGC C;  4XUJ B;  2F8N A;  3EG5 B;  1H3O A;  5B1M A;  5FUG A;  1P3F D;  2RVQ C;  1P3M C;  2YFW A;  3TU4 B;  5GT3 D;  1P3P B;  1EQZ D;  3W99 B;  2F2A C;  3VH5 A;  2BYM B;  4X23 C;  4WNN A;  3AZI B;  4LD9 A;  5AV8 D;  5JA4 A;  2F8N K;  3AZH C;  3W97 B;  5DNN D;  1S32 C;  5B31 G;  2NZD C;  4WZS B;  2ZY2 A;  3B6G C;  3NQJ B;  3B6F D;  3AZJ D;  2CV5 A;  4CSR B;  4ZUX B;  5CPI C;  3AZH A;  1S32 A;  4AWL B;  4J8V B;  1P3G C;  3B0D C;  3B6G A;  1TZY C;  2G5H C;  3AN2 B;  3VH5 T;  3LJA C;  5GT0 C;  5CPK D;  5CPI A;  1M19 B;  1A7W A;  3C1B C;  3C1C C;  4Z5T C;  1KX3 C;  1TZY A;  5GXQ D;  2FJ7 A;  3AFA C;  5AV5 D;  4KUD B;  3MVD B;  4Z5T A;  5B0Z C;  5JRG C;  3AFA D;  3UTA C;  5CPJ C;  1P3L D;  4JJN A;  1AOI B;  4XUJ A;  5B24 C;  3W99 C;  4EO5 B;  3A6N C;  3AL0 C;  5B0Z A;  5JRG A;  4J8W B;  3AZE C;  3WA9 C;  3REI D;  2W8S A;  3REL C;  2NQB B;  3AV1 B;  5AV6 D;  5AVC C;  3TU4 A;  1P3P A;  3W99 A;  3A6N A;  3MGQ B;  3KXB D;  3AZK D;  4WU8 C;  1HQ3 C;  4HGA B;  2Y2O A;  1KX4 C;  2PYO B;  2HIO D;  5B2J B;  3AZI A;  1Z2C B;  5AVC A;  3REH C;  4YS3 B;  1KX4 D;  2Y2J A;  3MGP C;  5KDM B;  4WU8 A;  3IP4 C;  3X1U C;  3AZM D;  3UT9 B;  5B31 B;  3NQJ A;  3X1T C;  4CSR A;  4Z66 B;  4ZUX A;  3WKJ B;  4WJ3 C;  4J8V A;  1P3A D;  1B67 A;  3X1U A;  3H0L C;  1ID3 D;  1P3B C;  3AN2 A;  2Y2P A;  3VH6 W;  1U35 B;  1ZLA C;  4XZQ D;  3AZF B;  3LZ1 D;  3WTP B;  4UUZ B;  5B1L B;  5B33 D;  3X1V B;  5CHL B;  3REK D;  3FDD A;  3MNN B;  3WAA D;  3UTB C;  5F99 D;  1P3I B;  3MVD A;  4R8P C;  4KUD A;  2IO5 B;  4J8X D;  1KX5 C;  3AV1 C;  3KWQ B;  5AV9 B;  3REJ C;  2ZM5 A;  1M1A C;  1B6W A;  4YM6 B;  4J8W A;  5B0Y C;  2NQB A;  3AZG C;  3AV1 A;  1WWI A;  3O62 B;  5B0Y D;  4J8U C;  1M1A A;  4DRA A;  2PYO A;  5B2J A;  3KUY B;  4H9S C;  3AZN C;  5CP6 B;  1P3K B;  4KHA A;  5B32 D;  5GSU D;  5KDM A;  3W98 B;  3AZN D;  3B0C W;  3UT9 A;  5B31 A;  4ZBJ C;  1P3F B;  5DNM C;  4H9S A;  1Q9C A;  3AV2 D;  4WU9 D;  4QLC B;  5B2I C;  3AZL D;  1P34 C;  1EQZ B;  3LZ0 C;  5DNM A;  3B0C T;  5G49 A;  1U35 A;  5AV8 B;  3EPH A;  2IO5 C;  4UUZ A;  2HUE B;  5DNN B;  3WTP A;  3X1V A;  2L5A A;  3AYW D;  3LEL D;  5AV9 C;  3B6F B;  3MNN A;  3AZJ B;  5B1M D;  1F66 B;  1P3I A;  5B40 D;  4YM6 C;  4KGC D;  2XD5 A;  1TAF A;  2JSS A;  5AV9 A;  4LD9 C;  2J8P A;  2RVQ D;  1P3M D;  1BFM A;  4YM6 A;  2Y2L A;  4UPK A;  1BH8 B;  5GXQ B;  3O62 A;  2CV5 C;  1M18 C;  3P5J B;  5CP6 C;  2Y2N A;  4X23 D;  3W98 C;  5BS7 A;  3AZH D;  5AVB C;  3KUY A;  1M18 A;  1S32 D;  4H9P A;  5CP6 A;  2NZD D;  1P3K A;  2BG1 A;  4QLC C;  3MGS B;  3B6G D;  3W98 A;  2YFV B;  5CPI D;  5AVB A;  3REI B;  2FJ7 C;  2ZY3 A;  3WTP E;  1P3G D;  4QLC A;  5AV6 B;  1EQZ A;  3W96 B;  4WV4 B;  1TZY D;  3A1I A;  3KXB B;  5GT0 D;  3LJA D;  3AZK B;  3X1S B;  4JJN C;  3C1B D;  4XUJ C;  3C1C D;  4Z5T D;  5B32 G;  5AV8 A;  1KX3 D;  5DNN A;  2F8N H;  3B6F A;  5B0Z D;  5JRG D;  1F66 A;  3TU4 C;  5CPJ D;  3UTA D;  1P3P C;  1P3A B;  5B24 D;  1JFI B;  2RIQ A;  3W99 D;  3A6N D;  1ID3 B;  3AZI C;  4E44 A;  4H9R B;  3AZE D;  3WA9 D;  3REL D;  3W97 C;  3KSY A;  2XD1 A;  1BH9 B;  2BYM A;  5AVC D;  5B33 B;  1BH8 A;  5GXQ A;  3MGR B;  3REK B;  4ZUX C;  4WU8 D;  1HQ3 D;  1P3O B;  3MGS C;  3W97 A;  3WAA B;  4AWL C;  4J8V C;  4NE6 A;  3REH D;  3VH6 A;  3AN2 C;  3MGP D;  3X1U D;  3MGS A;  1M19 C;  2ARO B;  3X1T D;  3W96 C;  2YFV A;  3X1S C;  3REI A;  3B0B A;  1M19 A;  5AY8 B;  4KUD C;  3MVD C;  3W96 A;  1P3B D;  3X1S A;  1ZLA D;  1AOI C;  5C3I B;  3MVD D;  3VH6 T;  4EO5 C;  5B32 B;  4J8W C;  5GSU B;  5E5A B;  2NQB C;  1AOI A;  3UTB D;  1PZR A;  4R8P D;  3AV2 B;  4WU9 B;  3EPK A;  4G92 B;  1KX5 D;  3MGQ C;  3AV1 D;  3REJ D;  1P3A A;  4HGA C;  3H0M C;  1KU5 A;  2PYO C;  1M1A D;  5B2J C;  1ID3 A;  3MGR C;  4G91 B;  4H9R A;  4YS3 C;  4E45 A;  1P3O C;  3MGQ A;  3AZG D;  4Z2M G;  3UT9 C;  4J8U D;  5B31 C;  5B33 A;  3AYW B;  3LEL B;  3MGR A;  4Z66 C;  3REK A;  5BT1 C;  5BNX B;  4YS3 A;  1P3O A;  3WKJ C;  3WAA A;  5B31 D;  2ARO C;  5B40 B;  4DQY B;  4KGC B;  3A1K A;  4Z66 A;  1U35 C;  4NE3 A;  3WKJ A;  5GT3 B;  2ARO A;  5AY8 C;  3AZF C;  5DNM D;  1P3M B;  3WTP C;  5B1L C;  3X1V C;  5B2I D;  2JE5 A;  5JA4 B;  1P34 D;  3MNN C;  3LZ0 D;  5AY8 A;  3AZF A;  1P3I C;  5B1L A;  4X23 B;  5BNV B;  5E5A C;  2F8N D;  3KWQ C;  2NZD B;  5B32 A;  3B6G B;  5GSU A;  5E5A A;  5AV9 D;  3KWQ A;  3O62 C;  2Y2I A;  3AV2 A;  4G91 C;  4YM6 D;  5CPK B;  1P3G B;  4WU9 A;  1W2E A;  3B0D B;  4LD9 D;  5BS7 C;  3LJA B;  5GT0 B;  3KUY C;  1P3K C;  3C1B B;  5AV5 B;  3C1C B;  4Z5T B;  1KX3 B;  2DF4 C;  2CV5 D;  1M18 D;  3KFU G;  2UWX A;  2LY8 A;  5CP6 D;  3AFA B;  3AYW A;  1P3L B;  3LEL A;  1P3F C;  3W98 D;  5BNX A;  5B0Z B;  5BO0 B;  5JRG B;  1EQZ C;  5GT3 C;  3UTA B;  5CPJ B;  5AVB D;  5B40 A;  2Y2H A;  1F1E A;  3F6T A;  4QLC D;  1P3F A;  4KGC A;  2Y2K A;  5B24 B;  3A6N B;  5AV8 C;  3EPL A;  5GT3 A;  3AZE B;  3WA9 B;  2FJ7 D;  3REL B;  1P3M A;  2HUE C;  5DNN C;  5AVC B;  4H9O B;  2HIO B;  3B6F C;  3AZJ C;  1F66 C;  3V9R B;  4WU8 B;  1HQ3 B;  4JJN D;  1KX4 B;  3VH5 W;  4X23 A;  5BNV A;  4XUJ D;  3AZM B;  1N1J B;  2BYK B;  1F66 D;  3REH B;  3AZJ A;  3MGP B;  5CPK C;  2NZD A;  3X1U B;  3REI C;  3X1T B;  3TU4 D;  1P3P D;  2CWE A;  5GXQ C;  2DQN C;  5CPK A;  3R45 B;  4H9N B;  1P3G A;  5AV5 C;  2FFF B;  4XZQ B;  3LZ1 B;  3AZI D;  1P3B B;  2F8N G;  3LJA A;  5GT0 A;  1P3L C;  1ZLA B;  3W97 D;  3C1B A;  5AV5 A;  3C1C A;  5F99 B;  1KX3 A;  1ULY A;  4J8X B;  4ZUX D;  3AFA A;  1P3L A;  3MGS D;  3UTB B;  4J8V D;  4R8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...