3W96B

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96B00
4EO5C 3REJA 3UTAA 3AFAD 4JJNA 1M1AB 1M1AD 5C3IC 2AROC 5AVCB 1M18B 1M18D 5B31A 1S32C 4KUDD 1P3AD 5AVBA 4YS3A 1ID3C 1TAFB 5B0YD 5E5AD 4J8VC 1F66C 3O62B 1P3GD 1N1JB 3REJC 4JJNC 3AYWA 3AZEB 5GT0A 2HIOB 2HIOD 2FJ7B 3WKJA 4LD9A 5BS7A 3MGPA 3AZHA 1A7WA 4R8PD 5CPKD 5B1LA 3MGRD 1KX3D 4H9QA 5BNXA 3B6FD 5GXQA 1P34D 5GT3B 2BYMB 3W96A 5AV5D 4J8UA 3X1VA 3AYWC 3AZGD 1P3KB 1P3KD 2RVQD 4WU9D 5AY8C 5CPJD 5CPJB 2CV5A 4G91C 3MGPC 3AZFA 3X1TA 3RELD 3REKA 2BYKB 3NQJA 3AZNB 3B0DB 3LJAA 3TU4C 3AN2C 1KX4B 5B1MC 3W98B 3W98D 5GSUA 4J8UC 1N1JA 5BNVB 1HQ3A 3AZLD 1M1AC 2NQBA 5AVCC 1M18C 3VH6W 4H9SC 5B32D 3C1BA 5B2JA 2F8NK 3A6NA 3MNNB 5AV8D 3O62C 3C1CA 3REHB 4G92B 5GT3A 3AZJB 3NQUB 2L5AA 3AZEC 2HIOC 2FJ7C 3AV1D 4J8XA 1EQZA 2F8NH 5B24B 1WWSA 3WAAB 3WAAD 5BO0A 5GT3C 4H9RA 5BNVA 3REIA 5AV9D 4WNNB 1P3KC 3UTBA 4H9NA 4Z5TA 1BH8B 2JSSA 4ZUXD 3LELB 5B0ZD 3WA9D 3AZNC 3B0DC 1P3PD 5DNNB 5DNND 1KX4C 3MGQA 3W98C 4WU8B 1AOIA 3W97A 3MVDB 3VH5T 1S32B 1S32D 3KXBB 3TU4B 2YFWA 1ID3D 1P3LA 3KSYA 4J8VB 4J8VD 1P3MB 1P3MD 1F66D 3MNNC 3REHC 5B33A 4YM6A 4G92C 3REJB 3REJD 4JJNB 4JJND 3UTAD 3UTAB 3AZJC 4WNNA 3X1SA 5B31B 5B40A 3AZMA 5AVBB 4YS3B 1P3LC 1WWIA 4XUJA 5B24C 1P3FB 3WTPE 2NZDA 3AYWB 3AYWD 3B6GA 3MVDA 5GT0B 1U35A 3WTPA 3MGSA 5AY8D 3AZKA 3WKJB 4G91B 4LD9B 3MGPB 3MGPD 4QLCB 3AZHB 4CSRB 5CHLB 3KWQA 4Z66A 5B1LB 5B1LD 4XUJC 3LELC 4H9QB 2F8NA 3TU4D 5DNNC 5BNXB 5B1MD 5GXQB 3X1UA 4J8UB 4J8UD 3W96B 4WU8C 3X1VB 3X1VD 3MVDC 5AVCD 2CV5B 3UT9A 3AZFB 3KXBC 4NE6A 3X1TB 3REKB 3REKD 3NQJB 5JRGB 3LJAB 3KUYA 1P3MC 1P3FA 3O62D 5GSUB 3UTAC 1HQ3B 3VH6T 2NQBB 3AZED 5JA4A 2FJ7D 1BH9A 5B31C 4QLCA 4CSRA 4HGAC 5AVBC 4YS3C 4Z2MG 3C1BB 5B2JB 3A6NB 5CPIA 1P3FC 3C1CB 5GT3D 5GT0C 4LD9C 4NE5A 3WKJC 5BS7C 4QLCC 3AZHC 5B2IA 4J8XB 4J8XD 1EQZB 5B1LC 1TZYA 5JRGA 3AZND 1KX4D 1P3BA 5BO0B 5GXQC 2PYOA 3W96C 4H9RB 3X1VC 3REIB 1JFIA 3AV2A 3UTBB 2CV5C 1Q9CA 4H9NB 4Z5TB 3AZFC 2CWEA 3X1TC 3AFAA 3REKC 5G49A 5JRGC 3LJAC 3MGQB 4KUDA 3MNND 1P3AA 3REHD 5GSUC 2PYOC 5B0YA 1HQ3C 1AOIB 3AZJD 3W97B 2YFVA 5E5AA 2NQBC 2YFWB 1P3IA 1P3GA 1F1EA 1P3LB 1P3LD 3C1BC 5B24D 5B2JC 3A6NC 1BFMA 3C1CC 5B33B 4R8PA 4YM6B 5CPKA 1HTAA 3MGRA 1KX3A 3X1SB 3LZ0A 5B40B 3AZMB 3AZMD 3AN2D 1P3IC 1P34A 4J8XC 5AV5A 4XUJB 4XUJD 3LELD 1EQZC 3AZGA 4WU9A 4X23A 5B31G 5DNMA 2NZDB 4WU8D 1M19A 3RELA 3REIC 3B6GB 3B6GD 3MVDD 1R4VA 3WTPB 3MGSB 3AZKB 1U35B 3UTBC 4J8WA 4Z5TC 3KXBD 3KWQB 3KWQD 4Z66B 3AZLA 4KGCA 2F8NB 4X23C 3MGQC 3X1UB 3VH5A 5AV6A 5B32A 4M6BA 1AOIC 3W97C 3LZ1A 3UT9B 5B31D 1B6WA 5AV8A 4KHAA 4HGAB 5KDMA 5AVBD 4YS3D 3KUYB 1B67A 1P3FD 5CP6A 3AV1A 5B33C 4YM6C 5JA4B 5GT0D 3X1SC 4LD9D 1BH9B 2HUEB 3WKJD 5B40C 4QLCD 3AZMC 3AZHD 4CAYA 1P3OA 2IO5B 5AV9A 5F99A 3B0CW 5CPIB 5GXQD 1ZLAA 4AWLB 4ZUXA 3WA9A 3W96D 2NZDC 5B0ZA 4XZQA 3B6GC 3AZIA 1U35C 3WTPC 3MGSC 3AZKC 2CV5D 5B2IB 3AZFD 4H9PA 3KWQC 1P3OC 3X1TD 4Z66C 1TZYB 2AROA 5JRGD 3LJAD 1P3BB 3X1UC 2PYOB 5GSUD 3VH5W 1ID3A 2PYOD 1HQ3D 1JFIB 3R45A 3AZIC 2NQBD 3AV2B 3UT9C 1F66A 4H9OA 3AFAB 3W99A 3V9RA 3C1BD 5G49B 5B2JD 1KX5A 3KUYC 3A6ND 3VH6A 4KUDB 1P3AB 3C1CD 5B0YB 4UUZA 4WV4B 2YFVB 5E5AB 2HUEC 4Z2MH 4NFTA 5FUGA 1P3ID 1P3GB 1P3IB 2IO5C 1EQZD 3W99C 1KX5C 5AY8A 5CPIC 4R8PB 1H3OA 5CPKB 4AWLC 3MGRB 3REID 1KX3B 3AN2A 3TU4A 3LZ0B 3LZ0D 5B1MA 3UTBD 3B6FB 4Z5TD 5B2IC 1P34B 3B0BA 5AV5B 3AZGB 1M1AA 5B32G 1TZYC 4X23B 5AVCA 4X23D 4WU9B 1M18A 3MGQD 1P3BC 5DNMB 5DNMD 4H9SA 1M19B 1M19D 3RELB 1TAFA 4E44A 5BT1C 1AOID 3W97D 4NE3A 3AV2C 4J8WB 4J8WD 3O62A 3AFAC 3AZLB 4KGCB 4KGCD 3AZEA 2HIOA 2FJ7A 4ZBJB 4KUDC 1P3AC 5B33D 4YM6D 5AV6B 5B32B 5B0YC 5AV6D 5E5AC 3X1SD 3LZ1B 3LZ1D 2F8NG 3B6FA 5B40D 5AV8B 4KHAB 5KDMB 1P3GC 2BYMA 1P3KA 5CPJA 4E45A 5CP6B 5CP6D 4R8PC 3AV1B 5CPKC 2NZDD 2BYKA 3MGRC 1KX3C 3AZNA 3WTPD 3MGSD 3AZKD 1U35D 1KX4A 3LZ0C 3B6FC 3W98A 4CAYB 1P34C 1P3OD 1P3OB 5AV5C 4Z66D 3B0CT 3AZGC 5AV9B 2F8ND 2RVQC 4WU9C 5F99B 5F99D 5CPJC 4DRAA 2LY8A 5DNMC 3X1UD 1ZLAD 1ZLAB 4ZUXB 3WA9B 1M19C 4WZSB 5B0ZB 3RELC 4XZQB 1ULYA 4XZQD 3AZIB 3AZID 1P3PB 3UT9D 4J8WC 3MNNA 4H9PB 4EO5B 3REHA 3AZLC 5C3IB 3AZJA 3NQUA 4KGCC 2AROB 2AROD 3KUYD 4ZBJC 1ID3B 5AV6C 5B32C 3R45B 5B24A 3LZ1C 1F66B 3WAAA 5AV8C 4H9OB 3W99B 3W99D 3V9RB 1KU5A 1KX5B 1KX5D 5CPID 5CP6C 3AV1C 1BH8A 3LELA 4UUZB 1P3PA 5DNNA 3WAAC 5FUGB 5B2ID 4DRBA 4WU8A 5AV9C 1TZYD 5AY8B 5F99C 1S32A 3KXBA 1P3BD 1H3OB 1ZLAC 4ZUXC 3WA9C 5B0ZC 4XZQC 5BT1D 3AN2B 4J8VA 1P3PC 3AV2D 1P3MA 5B1MB
chains in the Genus database with same CATH superfamily
3P5JB 4EO5C 3REJA 3UTAA 3AFAD 4JJNA 1M1AB 1M1AD 5C3IC 2AROC 5AVCB 1M18B 1M18D 5B31A 1S32C 4KUDD 1P3AD 5AVBA 4YS3A 1ID3C 1TAFB 5B0YD 5E5AD 4J8VC 1F66C 3O62B 1P3GD 1N1JB 3REJC 4JJNC 3AYWA 3AZEB 5GT0A 2HIOB 2HIOD 2FJ7B 3WKJA 4LD9A 5BS7A 3MGPA 3AZHA 2FFFB 1A7WA 1W2EA 4R8PD 5CPKD 5B1LA 3MGRD 1KX3D 4H9QA 5BNXA 3B6FD 5GXQA 1P34D 5GT3B 1Z2CB 2BYMB 3W96A 5AV5D 4J8UA 3X1VA 3AYWC 3AZGD 1P3KB 1P3KD 2RVQD 4WU9D 5AY8C 5CPJD 5CPJB 2CV5A 4G91C 3MGPC 3AZFA 3X1TA 3RELD 2Y2LA 2BYKB 3NQJA 3REKA 3AZNB 3B0DB 3LJAA 3TU4C 3AN2C 1KX4B 5B1MC 3W98B 3W98D 2G5HC 2DQNC 5GSUA 4J8UC 1N1JA 5BNVB 1HQ3A 3AZLD 1M1AC 2NQBA 5AVCC 1M18C 3VH6W 4H9SC 5B32D 3C1BA 5B2JA 2JE5A 2F8NK 3A6NA 3MNNB 5AV8D 3O62C 3C1CA 3REHB 4G92B 5GT3A 2Y2NA 3NQUB 3AZJB 2L5AA 3AZEC 2HIOC 2FJ7C 3AV1D 4J8XA 1EQZA 2F8NH 2ZY2A 5B24B 1WWSA 3WAAB 3WAAD 5BO0A 5GT3C 4H9RA 5BNVA 3REIA 5AV9D 4WNNB 1P3KC 3UTBA 4H9NA 4Z5TA 1BH8B 2JSSA 4ZUXD 3LELB 5B0ZD 3WA9D 3AZNC 3B0DC 1P3PD 5DNNB 5DNND 1KX4C 3MGQA 2J8PA 3W98C 4WU8B 2Y2HA 1AOIA 3W97A 3EPLA 3MVDB 2W8SA 3VH5T 1S32B 1S32D 3KXBB 3TU4B 2YFWA 1ID3D 1P3LA 3KSYA 4J8VB 4J8VD 1P3MB 1P3MD 1F66D 3MNNC 3REHC 5B33A 4YM6A 4G92C 3REJB 3REJD 4JJNB 4JJND 3UTAD 3UTAB 3AZJC 4WNNA 3X1SA 5B31B 5B40A 3AZMA 5AVBB 4YS3B 1P3LC 1WWIA 4XUJA 5B24C 1P3FB 3WTPE 2NZDA 3AYWB 3AYWD 3B6GA 3MVDA 5GT0B 1U35A 3WTPA 3MGSA 5AY8D 3AZKA 3WKJB 4G91B 4LD9B 3MGPB 3MGPD 4QLCB 3AZHB 4CSRB 5CHLB 3KWQA 4Z66A 5B1LB 5B1LD 4XUJC 3LELC 4H9QB 2G5IC 3TU4D 2F8NA 5DNNC 5BNXB 5B1MD 5GXQB 3X1UA 4J8UB 4J8UD 3W96B 4WU8C 3X1VB 3X1VD 3MVDC 5AVCD 2CV5B 3UT9A 3AZFB 3KXBC 4NE6A 3X1TB 3REKB 3REKD 3NQJB 2XD5A 5JRGB 3LJAB 3KUYA 1P3MC 1P3FA 3O62D 5GSUB 3UTAC 1HQ3B 3VH6T 2NQBB 3AZED 5JA4A 2FJ7D 1BH9A 5B31C 4QLCA 4CSRA 4HGAC 5AVBC 4YS3C 4Z2MG 3C1BB 5B2JB 3A6NB 5CPIA 1P3FC 3C1CB 2DF4C 5GT3D 3AL0C 5GT0C 4LD9C 4NE5A 3H0MC 5BS7C 3WKJC 4QLCC 3AZHC 5B2IA 4J8XB 4J8XD 2Y2PA 1EQZB 5B1LC 3KFUG 1TZYA 5JRGA 3AZND 1KX4D 1P3BA 5BO0B 5GXQC 2PYOA 3W96C 4H9RB 3X1VC 3REIB 1JFIA 3AV2A 3UTBB 2CV5C 1Q9CA 4H9NB 4Z5TB 3AZFC 2CWEA 3X1TC 3AFAA 3REKC 5G49A 5JRGC 3LJAC 3MGQB 4KUDA 3MNND 1P3AA 3REHD 5GSUC 2PYOC 5B0YA 1HQ3C 1AOIB 3AZJD 3W97B 2YFVA 5E5AA 2NQBC 2YFWB 1P3IA 1P3GA 1F1EA 1P3LB 1P3LD 3C1BC 5B24D 5B2JC 2ZY3A 2VQRA 3A6NC 1BFMA 3C1CC 5B33B 4R8PA 4YM6B 5CPKA 1HTAA 4DQYB 3MGRA 1KX3A 3X1SB 2BG1A 3LZ0A 5B40B 3AZMB 3AZMD 3A1KA 3AN2D 1P3IC 1P34A 4J8XC 5AV5A 4XUJB 4XUJD 3LELD 1EQZC 3AZGA 4WU9A 4X23A 5B31G 5DNMA 2NZDB 4WU8D 1M19A 3RELA 2Y2QA 3REIC 3B6GB 3B6GD 3MVDD 1R4VA 3WTPB 3MGSB 3AZKB 1U35B 3UTBC 4J8WA 2F2AC 4Z5TC 3KXBD 3KWQB 2Y2KA 3KWQD 4Z66B 3AZLA 4KGCA 2F8NB 3A1IA 4X23C 4WJ3C 2Y2JA 3MGQC 3X1UB 3F6TA 3VH5A 5AV6A 5B32A 4M6BA 1AOIC 3W97C 3LZ1A 3UT9B 5B31D 1B6WA 5AV8A 4KHAA 4HGAB 5KDMA 5AVBD 4YS3D 3H0RC 3KUYB 1B67A 1P3FD 5CP6A 3AV1A 5B33C 4YM6C 1T3UA 2UWXA 5JA4B 5GT0D 3X1SC 4LD9D 1BH9B 2HUEB 3WKJD 2XD1A 5B40C 4QLCD 3AZMC 3AZHD 4CAYA 1P3OA 2IO5B 5AV9A 5F99A 3B0CW 5CPIB 3IP4C 5GXQD 1ZLAA 4AWLB 4ZUXA 3WA9A 3W96D 2NZDC 5B0ZA 4XZQA 3B6GC 3AZIA 1U35C 3WTPC 3MGSC 3AZKC 2CV5D 5B2IB 3AZFD 4H9PA 3KWQC 1P3OC 3X1TD 4Z66C 1TZYB 2AROA 5JRGD 3LJAD 1P3BB 3X1UC 2Y2OA 2PYOB 5GSUD 3VH5W 1ID3A 2PYOD 1HQ3D 1JFIB 3R45A 3AZIC 2NQBD 3AV2B 3UT9C 1PZRA 1F66A 4H9OA 3AFAB 3W99A 3V9RA 3C1BD 5G49B 5B2JD 1KX5A 3KUYC 2RIQA 3VH6A 3A6ND 4KUDB 1P3AB 3C1CD 5B0YB 4UUZA 4WV4B 2YFVB 5E5AB 2HUEC 4Z2MH 4NFTA 5FUGA 1P3ID 1P3GB 1P3IB 2IO5C 1EQZD 3W99C 2Y2GA 2Y2MA 1KX5C 5AY8A 5CPIC 4R8PB 1H3OA 5CPKB 4AWLC 3MGRB 3REID 1KX3B 3AN2A 3TU4A 3LZ0B 3LZ0D 5B1MA 3UTBD 3B6FB 4Z5TD 5B2IC 1P34B 3B0BA 5AV5B 2ZM5A 3AZGB 1M1AA 2Y2IA 5B32G 3EPHA 1TZYC 4X23B 5AVCA 4X23D 4WU9B 1M18A 3MGQD 1P3BC 5DNMB 5DNMD 4H9SA 1M19B 1M19D 3RELB 1TAFA 4E44A 5BT1C 1AOID 3W97D 4NE3A 3AV2C 2ZY5A 4J8WB 4J8WD 3O62A 3AFAC 3AZLB 4KGCB 4KGCD 3AZEA 2HIOA 2FJ7A 4ZBJB 4KUDC 1P3AC 5B33D 4YM6D 5AV6B 5B32B 5B0YC 5AV6D 5E5AC 3X1SD 3LZ1B 3LZ1D 2F8NG 3B6FA 5B40D 5AV8B 4KHAB 5KDMB 1P3GC 2BYMA 3EG5B 1P3KA 5CPJA 4E45A 5CP6B 5CP6D 4R8PC 3AV1B 5CPKC 2NZDD 2BYKA 3MGRC 1KX3C 3EPKA 3AZNA 3WTPD 3MGSD 3AZKD 1U35D 1KX4A 3LZ0C 3B6FC 3W98A 4CAYB 1P34C 1P3OD 1P3OB 5AV5C 4Z66D 3B0CT 3AZGC 5AV9B 2F8ND 2RVQC 4WU9C 5F99B 5F99D 5CPJC 4DRAA 2JCHA 2LY8A 5DNMC 3X1UD 1ZLAD 1ZLAB 4ZUXB 3WA9B 1M19C 4WZSB 5B0ZB 3RELC 4XZQB 1ULYA 4XZQD 3FDDA 3AZIB 3AZID 1P3PB 3UT9D 4J8WC 3MNNA 4H9PB 4EO5B 3REHA 3AZLC 5C3IB 3AZJA 3NQUA 4KGCC 2AROB 2AROD 3KUYD 4ZBJC 4UPKA 1ID3B 5AV6C 5B32C 3R45B 5B24A 3LZ1C 2ZY4A 1F66B 3WAAA 5AV8C 4H9OB 3EPJA 3W99B 3W99D 3V9RB 1KU5A 1KX5B 1KX5D 5CPID 5CP6C 3AV1C 1BH8A 3LELA 4UUZB 1P3PA 5DNNA 3WAAC 5FUGB 5B2ID 4DRBA 4WU8A 5AV9C 1TZYD 5AY8B 5F99C 1S32A 3KXBA 1P3BD 1H3OB 1ZLAC 4ZUXC 3WA9C 5B0ZC 4XZQC 5BT1D 3H0LC 3AN2B 4J8VA 1P3PC 3AV2D 1P3MA 5B1MB
chains in the Genus database with same CATH topology
3P5JB 4EO5C 3REJA 3UTAA 3AFAD 4JJNA 1M1AB 1M1AD 5C3IC 2AROC 5AVCB 1M18B 1M18D 5B31A 1S32C 4KUDD 1P3AD 5AVBA 4YS3A 1ID3C 1TAFB 5B0YD 5E5AD 4J8VC 1F66C 3O62B 1P3GD 1N1JB 3REJC 4JJNC 3AYWA 3AZEB 5GT0A 2HIOB 2HIOD 2FJ7B 3WKJA 4LD9A 5BS7A 3MGPA 3AZHA 2FFFB 1A7WA 1W2EA 4R8PD 5CPKD 5B1LA 3MGRD 1KX3D 4H9QA 5BNXA 3B6FD 5GXQA 1P34D 5GT3B 1Z2CB 2BYMB 3W96A 5AV5D 4J8UA 3X1VA 3AYWC 3AZGD 1P3KB 1P3KD 2RVQD 4WU9D 5AY8C 5CPJD 5CPJB 2CV5A 4G91C 3MGPC 3AZFA 3X1TA 3RELD 2Y2LA 2BYKB 3NQJA 3REKA 3AZNB 3B0DB 3LJAA 3TU4C 3AN2C 1KX4B 5B1MC 3W98B 3W98D 2G5HC 2DQNC 5GSUA 4J8UC 1N1JA 5BNVB 1HQ3A 3AZLD 1M1AC 2NQBA 5AVCC 1M18C 3VH6W 4H9SC 5B32D 3C1BA 5B2JA 2JE5A 2F8NK 3A6NA 3MNNB 5AV8D 3O62C 3C1CA 3REHB 4G92B 5GT3A 2Y2NA 3NQUB 3AZJB 2L5AA 3AZEC 2HIOC 2FJ7C 3AV1D 4J8XA 1EQZA 2F8NH 2ZY2A 5B24B 1WWSA 3WAAB 3WAAD 5BO0A 5GT3C 4H9RA 5BNVA 3REIA 5AV9D 4WNNB 1P3KC 3UTBA 4H9NA 4Z5TA 1BH8B 2JSSA 4ZUXD 3LELB 5B0ZD 3WA9D 3AZNC 3B0DC 1P3PD 5DNNB 5DNND 1KX4C 3MGQA 2J8PA 3W98C 4WU8B 2Y2HA 1AOIA 3W97A 3EPLA 3MVDB 2W8SA 3VH5T 1S32B 1S32D 3KXBB 3TU4B 2YFWA 1ID3D 1P3LA 3KSYA 4J8VB 4J8VD 1P3MB 1P3MD 1F66D 3MNNC 3REHC 5B33A 4YM6A 4G92C 3REJB 3REJD 4JJNB 4JJND 3UTAD 3UTAB 3AZJC 4WNNA 3X1SA 5B31B 5B40A 3AZMA 5AVBB 4YS3B 1P3LC 1WWIA 4XUJA 5B24C 1P3FB 3WTPE 2NZDA 3AYWB 3AYWD 3B6GA 3MVDA 5GT0B 1U35A 3WTPA 3MGSA 5AY8D 3AZKA 3WKJB 4G91B 4LD9B 3MGPB 3MGPD 4QLCB 3AZHB 4CSRB 5CHLB 3KWQA 4Z66A 5B1LB 5B1LD 4XUJC 3LELC 4H9QB 2G5IC 3TU4D 2F8NA 5DNNC 5BNXB 5B1MD 5GXQB 3X1UA 4J8UB 4J8UD 3W96B 4WU8C 3X1VB 3X1VD 3MVDC 5AVCD 2CV5B 3UT9A 3AZFB 3KXBC 4NE6A 3X1TB 3REKB 3REKD 3NQJB 2XD5A 5JRGB 3LJAB 3KUYA 1P3MC 1P3FA 3O62D 5GSUB 3UTAC 1HQ3B 3VH6T 2NQBB 3AZED 5JA4A 2FJ7D 1BH9A 5B31C 4QLCA 4CSRA 4HGAC 5AVBC 4YS3C 4Z2MG 3C1BB 5B2JB 3A6NB 5CPIA 1P3FC 3C1CB 2DF4C 5GT3D 3AL0C 5GT0C 4LD9C 4NE5A 3H0MC 5BS7C 3WKJC 4QLCC 3AZHC 5B2IA 4J8XB 4J8XD 2Y2PA 1EQZB 5B1LC 3KFUG 1TZYA 5JRGA 3AZND 1KX4D 1P3BA 5BO0B 5GXQC 2PYOA 3W96C 4H9RB 3X1VC 3REIB 1JFIA 3AV2A 3UTBB 2CV5C 1Q9CA 4H9NB 4Z5TB 3AZFC 2CWEA 3X1TC 3AFAA 3REKC 5G49A 5JRGC 3LJAC 3MGQB 4KUDA 3MNND 1P3AA 3REHD 5GSUC 2PYOC 5B0YA 1HQ3C 1AOIB 3AZJD 3W97B 2YFVA 5E5AA 2NQBC 2YFWB 1P3IA 1P3GA 1F1EA 1P3LB 1P3LD 3C1BC 5B24D 5B2JC 2ZY3A 2VQRA 3A6NC 1BFMA 3C1CC 5B33B 4R8PA 4YM6B 5CPKA 1HTAA 4DQYB 3MGRA 1KX3A 3X1SB 2BG1A 3LZ0A 5B40B 3AZMB 3AZMD 3A1KA 3AN2D 1P3IC 1P34A 4J8XC 5AV5A 4XUJB 4XUJD 3LELD 1EQZC 3AZGA 4WU9A 4X23A 5B31G 5DNMA 2NZDB 4WU8D 1M19A 3RELA 2Y2QA 3REIC 3B6GB 3B6GD 3MVDD 1R4VA 3WTPB 3MGSB 3AZKB 1U35B 3UTBC 4J8WA 2F2AC 4Z5TC 3KXBD 3KWQB 2Y2KA 3KWQD 4Z66B 3AZLA 4KGCA 2F8NB 3A1IA 4X23C 4WJ3C 2Y2JA 3MGQC 3X1UB 3F6TA 3VH5A 5AV6A 5B32A 4M6BA 1AOIC 3W97C 3LZ1A 3UT9B 5B31D 1B6WA 5AV8A 4KHAA 4HGAB 5KDMA 5AVBD 4YS3D 3H0RC 3KUYB 1B67A 1P3FD 5CP6A 3AV1A 5B33C 4YM6C 1T3UA 2UWXA 5JA4B 5GT0D 3X1SC 4LD9D 1BH9B 2HUEB 3WKJD 2XD1A 5B40C 4QLCD 3AZMC 3AZHD 4CAYA 1P3OA 2IO5B 5AV9A 5F99A 3B0CW 5CPIB 3IP4C 5GXQD 1ZLAA 4AWLB 4ZUXA 3WA9A 3W96D 2NZDC 5B0ZA 4XZQA 3B6GC 3AZIA 1U35C 3WTPC 3MGSC 3AZKC 2CV5D 5B2IB 3AZFD 4H9PA 3KWQC 1P3OC 3X1TD 4Z66C 1TZYB 2AROA 5JRGD 3LJAD 1P3BB 3X1UC 2Y2OA 2PYOB 5GSUD 3VH5W 1ID3A 2PYOD 1HQ3D 1JFIB 3R45A 3AZIC 2NQBD 3AV2B 3UT9C 1PZRA 1F66A 4H9OA 3AFAB 3W99A 3V9RA 3C1BD 5G49B 5B2JD 1KX5A 3KUYC 2RIQA 3VH6A 3A6ND 4KUDB 1P3AB 3C1CD 5B0YB 4UUZA 4WV4B 2YFVB 5E5AB 2HUEC 4Z2MH 4NFTA 5FUGA 1P3ID 1P3GB 1P3IB 2IO5C 1EQZD 3W99C 2Y2GA 2Y2MA 1KX5C 5AY8A 5CPIC 4R8PB 1H3OA 5CPKB 4AWLC 3MGRB 3REID 1KX3B 3AN2A 3TU4A 3LZ0B 3LZ0D 5B1MA 3UTBD 3B6FB 4Z5TD 5B2IC 1P34B 3B0BA 5AV5B 2ZM5A 3AZGB 1M1AA 2Y2IA 5B32G 3EPHA 1TZYC 4X23B 5AVCA 4X23D 4WU9B 1M18A 3MGQD 1P3BC 5DNMB 5DNMD 4H9SA 1M19B 1M19D 3RELB 1TAFA 4E44A 5BT1C 1AOID 3W97D 4NE3A 3AV2C 2ZY5A 4J8WB 4J8WD 3O62A 3AFAC 3AZLB 4KGCB 4KGCD 3AZEA 2HIOA 2FJ7A 4ZBJB 4KUDC 1P3AC 5B33D 4YM6D 5AV6B 5B32B 5B0YC 5AV6D 5E5AC 3X1SD 3LZ1B 3LZ1D 2F8NG 3B6FA 5B40D 5AV8B 4KHAB 5KDMB 1P3GC 2BYMA 3EG5B 1P3KA 5CPJA 4E45A 5CP6B 5CP6D 4R8PC 3AV1B 5CPKC 2NZDD 2BYKA 3MGRC 1KX3C 3EPKA 3AZNA 3WTPD 3MGSD 3AZKD 1U35D 1KX4A 3LZ0C 3B6FC 3W98A 4CAYB 1P34C 1P3OD 1P3OB 5AV5C 4Z66D 3B0CT 3AZGC 5AV9B 2F8ND 2RVQC 4WU9C 5F99B 5F99D 5CPJC 4DRAA 2JCHA 2LY8A 5DNMC 3X1UD 1ZLAD 1ZLAB 4ZUXB 3WA9B 1M19C 4WZSB 5B0ZB 3RELC 4XZQB 1ULYA 4XZQD 3FDDA 3AZIB 3AZID 1P3PB 3UT9D 4J8WC 3MNNA 4H9PB 4EO5B 3REHA 3AZLC 5C3IB 3AZJA 3NQUA 4KGCC 2AROB 2AROD 3KUYD 4ZBJC 4UPKA 1ID3B 5AV6C 5B32C 3R45B 5B24A 3LZ1C 2ZY4A 1F66B 3WAAA 5AV8C 4H9OB 3EPJA 3W99B 3W99D 3V9RB 1KU5A 1KX5B 1KX5D 5CPID 5CP6C 3AV1C 1BH8A 3LELA 4UUZB 1P3PA 5DNNA 3WAAC 5FUGB 5B2ID 4DRBA 4WU8A 5AV9C 1TZYD 5AY8B 5F99C 1S32A 3KXBA 1P3BD 1H3OB 1ZLAC 4ZUXC 3WA9C 5B0ZC 4XZQC 5BT1D 3H0LC 3AN2B 4J8VA 1P3PC 3AV2D 1P3MA 5B1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EO5 C;  3REJ A;  3UTA A;  3AFA D;  4JJN A;  1M1A B;  1M1A D;  5C3I C;  2ARO C;  5AVC B;  1M18 B;  1M18 D;  5B31 A;  1S32 C;  4KUD D;  1P3A D;  5AVB A;  4YS3 A;  1ID3 C;  1TAF B;  5B0Y D;  5E5A D;  4J8V C;  1F66 C;  3O62 B;  1P3G D;  1N1J B;  3REJ C;  4JJN C;  3AYW A;  3AZE B;  5GT0 A;  2HIO B;  2HIO D;  2FJ7 B;  3WKJ A;  4LD9 A;  5BS7 A;  3MGP A;  3AZH A;  1A7W A;  4R8P D;  5CPK D;  5B1L A;  3MGR D;  1KX3 D;  4H9Q A;  5BNX A;  3B6F D;  5GXQ A;  1P34 D;  5GT3 B;  2BYM B;  3W96 A;  5AV5 D;  4J8U A;  3X1V A;  3AYW C;  3AZG D;  1P3K B;  1P3K D;  2RVQ D;  4WU9 D;  5AY8 C;  5CPJ D;  5CPJ B;  2CV5 A;  4G91 C;  3MGP C;  3AZF A;  3X1T A;  3REL D;  3REK A;  2BYK B;  3NQJ A;  3AZN B;  3B0D B;  3LJA A;  3TU4 C;  3AN2 C;  1KX4 B;  5B1M C;  3W98 B;  3W98 D;  5GSU A;  4J8U C;  1N1J A;  5BNV B;  1HQ3 A;  3AZL D;  1M1A C;  2NQB A;  5AVC C;  1M18 C;  3VH6 W;  4H9S C;  5B32 D;  3C1B A;  5B2J A;  2F8N K;  3A6N A;  3MNN B;  5AV8 D;  3O62 C;  3C1C A;  3REH B;  4G92 B;  5GT3 A;  3AZJ B;  3NQU B;  2L5A A;  3AZE C;  2HIO C;  2FJ7 C;  3AV1 D;  4J8X A;  1EQZ A;  2F8N H;  5B24 B;  1WWS A;  3WAA B;  3WAA D;  5BO0 A;  5GT3 C;  4H9R A;  5BNV A;  3REI A;  5AV9 D;  4WNN B;  1P3K C;  3UTB A;  4H9N A;  4Z5T A;  1BH8 B;  2JSS A;  4ZUX D;  3LEL B;  5B0Z D;  3WA9 D;  3AZN C;  3B0D C;  1P3P D;  5DNN B;  5DNN D;  1KX4 C;  3MGQ A;  3W98 C;  4WU8 B;  1AOI A;  3W97 A;  3MVD B;  3VH5 T;  1S32 B;  1S32 D;  3KXB B;  3TU4 B;  2YFW A;  1ID3 D;  1P3L A;  3KSY A;  4J8V B;  4J8V D;  1P3M B;  1P3M D;  1F66 D;  3MNN C;  3REH C;  5B33 A;  4YM6 A;  4G92 C;  3REJ B;  3REJ D;  4JJN B;  4JJN D;  3UTA D;  3UTA B;  3AZJ C;  4WNN A;  3X1S A;  5B31 B;  5B40 A;  3AZM A;  5AVB B;  4YS3 B;  1P3L C;  1WWI A;  4XUJ A;  5B24 C;  1P3F B;  3WTP E;  2NZD A;  3AYW B;  3AYW D;  3B6G A;  3MVD A;  5GT0 B;  1U35 A;  3WTP A;  3MGS A;  5AY8 D;  3AZK A;  3WKJ B;  4G91 B;  4LD9 B;  3MGP B;  3MGP D;  4QLC B;  3AZH B;  4CSR B;  5CHL B;  3KWQ A;  4Z66 A;  5B1L B;  5B1L D;  4XUJ C;  3LEL C;  4H9Q B;  2F8N A;  3TU4 D;  5DNN C;  5BNX B;  5B1M D;  5GXQ B;  3X1U A;  4J8U B;  4J8U D;  3W96 B;  4WU8 C;  3X1V B;  3X1V D;  3MVD C;  5AVC D;  2CV5 B;  3UT9 A;  3AZF B;  3KXB C;  4NE6 A;  3X1T B;  3REK B;  3REK D;  3NQJ B;  5JRG B;  3LJA B;  3KUY A;  1P3M C;  1P3F A;  3O62 D;  5GSU B;  3UTA C;  1HQ3 B;  3VH6 T;  2NQB B;  3AZE D;  5JA4 A;  2FJ7 D;  1BH9 A;  5B31 C;  4QLC A;  4CSR A;  4HGA C;  5AVB C;  4YS3 C;  4Z2M G;  3C1B B;  5B2J B;  3A6N B;  5CPI A;  1P3F C;  3C1C B;  5GT3 D;  5GT0 C;  4LD9 C;  4NE5 A;  3WKJ C;  5BS7 C;  4QLC C;  3AZH C;  5B2I A;  4J8X B;  4J8X D;  1EQZ B;  5B1L C;  1TZY A;  5JRG A;  3AZN D;  1KX4 D;  1P3B A;  5BO0 B;  5GXQ C;  2PYO A;  3W96 C;  4H9R B;  3X1V C;  3REI B;  1JFI A;  3AV2 A;  3UTB B;  2CV5 C;  1Q9C A;  4H9N B;  4Z5T B;  3AZF C;  2CWE A;  3X1T C;  3AFA A;  3REK C;  5G49 A;  5JRG C;  3LJA C;  3MGQ B;  4KUD A;  3MNN D;  1P3A A;  3REH D;  5GSU C;  2PYO C;  5B0Y A;  1HQ3 C;  1AOI B;  3AZJ D;  3W97 B;  2YFV A;  5E5A A;  2NQB C;  2YFW B;  1P3I A;  1P3G A;  1F1E A;  1P3L B;  1P3L D;  3C1B C;  5B24 D;  5B2J C;  3A6N C;  1BFM A;  3C1C C;  5B33 B;  4R8P A;  4YM6 B;  5CPK A;  1HTA A;  3MGR A;  1KX3 A;  3X1S B;  3LZ0 A;  5B40 B;  3AZM B;  3AZM D;  3AN2 D;  1P3I C;  1P34 A;  4J8X C;  5AV5 A;  4XUJ B;  4XUJ D;  3LEL D;  1EQZ C;  3AZG A;  4WU9 A;  4X23 A;  5B31 G;  5DNM A;  2NZD B;  4WU8 D;  1M19 A;  3REL A;  3REI C;  3B6G B;  3B6G D;  3MVD D;  1R4V A;  3WTP B;  3MGS B;  3AZK B;  1U35 B;  3UTB C;  4J8W A;  4Z5T C;  3KXB D;  3KWQ B;  3KWQ D;  4Z66 B;  3AZL A;  4KGC A;  2F8N B;  4X23 C;  3MGQ C;  3X1U B;  3VH5 A;  5AV6 A;  5B32 A;  4M6B A;  1AOI C;  3W97 C;  3LZ1 A;  3UT9 B;  5B31 D;  1B6W A;  5AV8 A;  4KHA A;  4HGA B;  5KDM A;  5AVB D;  4YS3 D;  3KUY B;  1B67 A;  1P3F D;  5CP6 A;  3AV1 A;  5B33 C;  4YM6 C;  5JA4 B;  5GT0 D;  3X1S C;  4LD9 D;  1BH9 B;  2HUE B;  3WKJ D;  5B40 C;  4QLC D;  3AZM C;  3AZH D;  4CAY A;  1P3O A;  2IO5 B;  5AV9 A;  5F99 A;  3B0C W;  5CPI B;  5GXQ D;  1ZLA A;  4AWL B;  4ZUX A;  3WA9 A;  3W96 D;  2NZD C;  5B0Z A;  4XZQ A;  3B6G C;  3AZI A;  1U35 C;  3WTP C;  3MGS C;  3AZK C;  2CV5 D;  5B2I B;  3AZF D;  4H9P A;  3KWQ C;  1P3O C;  3X1T D;  4Z66 C;  1TZY B;  2ARO A;  5JRG D;  3LJA D;  1P3B B;  3X1U C;  2PYO B;  5GSU D;  3VH5 W;  1ID3 A;  2PYO D;  1HQ3 D;  1JFI B;  3R45 A;  3AZI C;  2NQB D;  3AV2 B;  3UT9 C;  1F66 A;  4H9O A;  3AFA B;  3W99 A;  3V9R A;  3C1B D;  5G49 B;  5B2J D;  1KX5 A;  3KUY C;  3A6N D;  3VH6 A;  4KUD B;  1P3A B;  3C1C D;  5B0Y B;  4UUZ A;  4WV4 B;  2YFV B;  5E5A B;  2HUE C;  4Z2M H;  4NFT A;  5FUG A;  1P3I D;  1P3G B;  1P3I B;  2IO5 C;  1EQZ D;  3W99 C;  1KX5 C;  5AY8 A;  5CPI C;  4R8P B;  1H3O A;  5CPK B;  4AWL C;  3MGR B;  3REI D;  1KX3 B;  3AN2 A;  3TU4 A;  3LZ0 B;  3LZ0 D;  5B1M A;  3UTB D;  3B6F B;  4Z5T D;  5B2I C;  1P34 B;  3B0B A;  5AV5 B;  3AZG B;  1M1A A;  5B32 G;  1TZY C;  4X23 B;  5AVC A;  4X23 D;  4WU9 B;  1M18 A;  3MGQ D;  1P3B C;  5DNM B;  5DNM D;  4H9S A;  1M19 B;  1M19 D;  3REL B;  1TAF A;  4E44 A;  5BT1 C;  1AOI D;  3W97 D;  4NE3 A;  3AV2 C;  4J8W B;  4J8W D;  3O62 A;  3AFA C;  3AZL B;  4KGC B;  4KGC D;  3AZE A;  2HIO A;  2FJ7 A;  4ZBJ B;  4KUD C;  1P3A C;  5B33 D;  4YM6 D;  5AV6 B;  5B32 B;  5B0Y C;  5AV6 D;  5E5A C;  3X1S D;  3LZ1 B;  3LZ1 D;  2F8N G;  3B6F A;  5B40 D;  5AV8 B;  4KHA B;  5KDM B;  1P3G C;  2BYM A;  1P3K A;  5CPJ A;  4E45 A;  5CP6 B;  5CP6 D;  4R8P C;  3AV1 B;  5CPK C;  2NZD D;  2BYK A;  3MGR C;  1KX3 C;  3AZN A;  3WTP D;  3MGS D;  3AZK D;  1U35 D;  1KX4 A;  3LZ0 C;  3B6F C;  3W98 A;  4CAY B;  1P34 C;  1P3O D;  1P3O B;  5AV5 C;  4Z66 D;  3B0C T;  3AZG C;  5AV9 B;  2F8N D;  2RVQ C;  4WU9 C;  5F99 B;  5F99 D;  5CPJ C;  4DRA A;  2LY8 A;  5DNM C;  3X1U D;  1ZLA D;  1ZLA B;  4ZUX B;  3WA9 B;  1M19 C;  4WZS B;  5B0Z B;  3REL C;  4XZQ B;  1ULY A;  4XZQ D;  3AZI B;  3AZI D;  1P3P B;  3UT9 D;  4J8W C;  3MNN A;  4H9P B;  4EO5 B;  3REH A;  3AZL C;  5C3I B;  3AZJ A;  3NQU A;  4KGC C;  2ARO B;  2ARO D;  3KUY D;  4ZBJ C;  1ID3 B;  5AV6 C;  5B32 C;  3R45 B;  5B24 A;  3LZ1 C;  1F66 B;  3WAA A;  5AV8 C;  4H9O B;  3W99 B;  3W99 D;  3V9R B;  1KU5 A;  1KX5 B;  1KX5 D;  5CPI D;  5CP6 C;  3AV1 C;  1BH8 A;  3LEL A;  4UUZ B;  1P3P A;  5DNN A;  3WAA C;  5FUG B;  5B2I D;  4DRB A;  4WU8 A;  5AV9 C;  1TZY D;  5AY8 B;  5F99 C;  1S32 A;  3KXB A;  1P3B D;  1H3O B;  1ZLA C;  4ZUX C;  3WA9 C;  5B0Z C;  4XZQ C;  5BT1 D;  3AN2 B;  4J8V A;  1P3P C;  3AV2 D;  1P3M A;  5B1M B; 
#chains in the Genus database with same CATH topology
 3P5J B;  4EO5 C;  3REJ A;  3UTA A;  3AFA D;  4JJN A;  1M1A B;  1M1A D;  5C3I C;  2ARO C;  5AVC B;  1M18 B;  1M18 D;  5B31 A;  1S32 C;  4KUD D;  1P3A D;  5AVB A;  4YS3 A;  1ID3 C;  1TAF B;  5B0Y D;  5E5A D;  4J8V C;  1F66 C;  3O62 B;  1P3G D;  1N1J B;  3REJ C;  4JJN C;  3AYW A;  3AZE B;  5GT0 A;  2HIO B;  2HIO D;  2FJ7 B;  3WKJ A;  4LD9 A;  5BS7 A;  3MGP A;  3AZH A;  2FFF B;  1A7W A;  1W2E A;  4R8P D;  5CPK D;  5B1L A;  3MGR D;  1KX3 D;  4H9Q A;  5BNX A;  3B6F D;  5GXQ A;  1P34 D;  5GT3 B;  1Z2C B;  2BYM B;  3W96 A;  5AV5 D;  4J8U A;  3X1V A;  3AYW C;  3AZG D;  1P3K B;  1P3K D;  2RVQ D;  4WU9 D;  5AY8 C;  5CPJ D;  5CPJ B;  2CV5 A;  4G91 C;  3MGP C;  3AZF A;  3X1T A;  3REL D;  2Y2L A;  2BYK B;  3NQJ A;  3REK A;  3AZN B;  3B0D B;  3LJA A;  3TU4 C;  3AN2 C;  1KX4 B;  5B1M C;  3W98 B;  3W98 D;  2G5H C;  2DQN C;  5GSU A;  4J8U C;  1N1J A;  5BNV B;  1HQ3 A;  3AZL D;  1M1A C;  2NQB A;  5AVC C;  1M18 C;  3VH6 W;  4H9S C;  5B32 D;  3C1B A;  5B2J A;  2JE5 A;  2F8N K;  3A6N A;  3MNN B;  5AV8 D;  3O62 C;  3C1C A;  3REH B;  4G92 B;  5GT3 A;  2Y2N A;  3NQU B;  3AZJ B;  2L5A A;  3AZE C;  2HIO C;  2FJ7 C;  3AV1 D;  4J8X A;  1EQZ A;  2F8N H;  2ZY2 A;  5B24 B;  1WWS A;  3WAA B;  3WAA D;  5BO0 A;  5GT3 C;  4H9R A;  5BNV A;  3REI A;  5AV9 D;  4WNN B;  1P3K C;  3UTB A;  4H9N A;  4Z5T A;  1BH8 B;  2JSS A;  4ZUX D;  3LEL B;  5B0Z D;  3WA9 D;  3AZN C;  3B0D C;  1P3P D;  5DNN B;  5DNN D;  1KX4 C;  3MGQ A;  2J8P A;  3W98 C;  4WU8 B;  2Y2H A;  1AOI A;  3W97 A;  3EPL A;  3MVD B;  2W8S A;  3VH5 T;  1S32 B;  1S32 D;  3KXB B;  3TU4 B;  2YFW A;  1ID3 D;  1P3L A;  3KSY A;  4J8V B;  4J8V D;  1P3M B;  1P3M D;  1F66 D;  3MNN C;  3REH C;  5B33 A;  4YM6 A;  4G92 C;  3REJ B;  3REJ D;  4JJN B;  4JJN D;  3UTA D;  3UTA B;  3AZJ C;  4WNN A;  3X1S A;  5B31 B;  5B40 A;  3AZM A;  5AVB B;  4YS3 B;  1P3L C;  1WWI A;  4XUJ A;  5B24 C;  1P3F B;  3WTP E;  2NZD A;  3AYW B;  3AYW D;  3B6G A;  3MVD A;  5GT0 B;  1U35 A;  3WTP A;  3MGS A;  5AY8 D;  3AZK A;  3WKJ B;  4G91 B;  4LD9 B;  3MGP B;  3MGP D;  4QLC B;  3AZH B;  4CSR B;  5CHL B;  3KWQ A;  4Z66 A;  5B1L B;  5B1L D;  4XUJ C;  3LEL C;  4H9Q B;  2G5I C;  3TU4 D;  2F8N A;  5DNN C;  5BNX B;  5B1M D;  5GXQ B;  3X1U A;  4J8U B;  4J8U D;  3W96 B;  4WU8 C;  3X1V B;  3X1V D;  3MVD C;  5AVC D;  2CV5 B;  3UT9 A;  3AZF B;  3KXB C;  4NE6 A;  3X1T B;  3REK B;  3REK D;  3NQJ B;  2XD5 A;  5JRG B;  3LJA B;  3KUY A;  1P3M C;  1P3F A;  3O62 D;  5GSU B;  3UTA C;  1HQ3 B;  3VH6 T;  2NQB B;  3AZE D;  5JA4 A;  2FJ7 D;  1BH9 A;  5B31 C;  4QLC A;  4CSR A;  4HGA C;  5AVB C;  4YS3 C;  4Z2M G;  3C1B B;  5B2J B;  3A6N B;  5CPI A;  1P3F C;  3C1C B;  2DF4 C;  5GT3 D;  3AL0 C;  5GT0 C;  4LD9 C;  4NE5 A;  3H0M C;  5BS7 C;  3WKJ C;  4QLC C;  3AZH C;  5B2I A;  4J8X B;  4J8X D;  2Y2P A;  1EQZ B;  5B1L C;  3KFU G;  1TZY A;  5JRG A;  3AZN D;  1KX4 D;  1P3B A;  5BO0 B;  5GXQ C;  2PYO A;  3W96 C;  4H9R B;  3X1V C;  3REI B;  1JFI A;  3AV2 A;  3UTB B;  2CV5 C;  1Q9C A;  4H9N B;  4Z5T B;  3AZF C;  2CWE A;  3X1T C;  3AFA A;  3REK C;  5G49 A;  5JRG C;  3LJA C;  3MGQ B;  4KUD A;  3MNN D;  1P3A A;  3REH D;  5GSU C;  2PYO C;  5B0Y A;  1HQ3 C;  1AOI B;  3AZJ D;  3W97 B;  2YFV A;  5E5A A;  2NQB C;  2YFW B;  1P3I A;  1P3G A;  1F1E A;  1P3L B;  1P3L D;  3C1B C;  5B24 D;  5B2J C;  2ZY3 A;  2VQR A;  3A6N C;  1BFM A;  3C1C C;  5B33 B;  4R8P A;  4YM6 B;  5CPK A;  1HTA A;  4DQY B;  3MGR A;  1KX3 A;  3X1S B;  2BG1 A;  3LZ0 A;  5B40 B;  3AZM B;  3AZM D;  3A1K A;  3AN2 D;  1P3I C;  1P34 A;  4J8X C;  5AV5 A;  4XUJ B;  4XUJ D;  3LEL D;  1EQZ C;  3AZG A;  4WU9 A;  4X23 A;  5B31 G;  5DNM A;  2NZD B;  4WU8 D;  1M19 A;  3REL A;  2Y2Q A;  3REI C;  3B6G B;  3B6G D;  3MVD D;  1R4V A;  3WTP B;  3MGS B;  3AZK B;  1U35 B;  3UTB C;  4J8W A;  2F2A C;  4Z5T C;  3KXB D;  3KWQ B;  2Y2K A;  3KWQ D;  4Z66 B;  3AZL A;  4KGC A;  2F8N B;  3A1I A;  4X23 C;  4WJ3 C;  2Y2J A;  3MGQ C;  3X1U B;  3F6T A;  3VH5 A;  5AV6 A;  5B32 A;  4M6B A;  1AOI C;  3W97 C;  3LZ1 A;  3UT9 B;  5B31 D;  1B6W A;  5AV8 A;  4KHA A;  4HGA B;  5KDM A;  5AVB D;  4YS3 D;  3H0R C;  3KUY B;  1B67 A;  1P3F D;  5CP6 A;  3AV1 A;  5B33 C;  4YM6 C;  1T3U A;  2UWX A;  5JA4 B;  5GT0 D;  3X1S C;  4LD9 D;  1BH9 B;  2HUE B;  3WKJ D;  2XD1 A;  5B40 C;  4QLC D;  3AZM C;  3AZH D;  4CAY A;  1P3O A;  2IO5 B;  5AV9 A;  5F99 A;  3B0C W;  5CPI B;  3IP4 C;  5GXQ D;  1ZLA A;  4AWL B;  4ZUX A;  3WA9 A;  3W96 D;  2NZD C;  5B0Z A;  4XZQ A;  3B6G C;  3AZI A;  1U35 C;  3WTP C;  3MGS C;  3AZK C;  2CV5 D;  5B2I B;  3AZF D;  4H9P A;  3KWQ C;  1P3O C;  3X1T D;  4Z66 C;  1TZY B;  2ARO A;  5JRG D;  3LJA D;  1P3B B;  3X1U C;  2Y2O A;  2PYO B;  5GSU D;  3VH5 W;  1ID3 A;  2PYO D;  1HQ3 D;  1JFI B;  3R45 A;  3AZI C;  2NQB D;  3AV2 B;  3UT9 C;  1PZR A;  1F66 A;  4H9O A;  3AFA B;  3W99 A;  3V9R A;  3C1B D;  5G49 B;  5B2J D;  1KX5 A;  3KUY C;  2RIQ A;  3VH6 A;  3A6N D;  4KUD B;  1P3A B;  3C1C D;  5B0Y B;  4UUZ A;  4WV4 B;  2YFV B;  5E5A B;  2HUE C;  4Z2M H;  4NFT A;  5FUG A;  1P3I D;  1P3G B;  1P3I B;  2IO5 C;  1EQZ D;  3W99 C;  2Y2G A;  2Y2M A;  1KX5 C;  5AY8 A;  5CPI C;  4R8P B;  1H3O A;  5CPK B;  4AWL C;  3MGR B;  3REI D;  1KX3 B;  3AN2 A;  3TU4 A;  3LZ0 B;  3LZ0 D;  5B1M A;  3UTB D;  3B6F B;  4Z5T D;  5B2I C;  1P34 B;  3B0B A;  5AV5 B;  2ZM5 A;  3AZG B;  1M1A A;  2Y2I A;  5B32 G;  3EPH A;  1TZY C;  4X23 B;  5AVC A;  4X23 D;  4WU9 B;  1M18 A;  3MGQ D;  1P3B C;  5DNM B;  5DNM D;  4H9S A;  1M19 B;  1M19 D;  3REL B;  1TAF A;  4E44 A;  5BT1 C;  1AOI D;  3W97 D;  4NE3 A;  3AV2 C;  2ZY5 A;  4J8W B;  4J8W D;  3O62 A;  3AFA C;  3AZL B;  4KGC B;  4KGC D;  3AZE A;  2HIO A;  2FJ7 A;  4ZBJ B;  4KUD C;  1P3A C;  5B33 D;  4YM6 D;  5AV6 B;  5B32 B;  5B0Y C;  5AV6 D;  5E5A C;  3X1S D;  3LZ1 B;  3LZ1 D;  2F8N G;  3B6F A;  5B40 D;  5AV8 B;  4KHA B;  5KDM B;  1P3G C;  2BYM A;  3EG5 B;  1P3K A;  5CPJ A;  4E45 A;  5CP6 B;  5CP6 D;  4R8P C;  3AV1 B;  5CPK C;  2NZD D;  2BYK A;  3MGR C;  1KX3 C;  3EPK A;  3AZN A;  3WTP D;  3MGS D;  3AZK D;  1U35 D;  1KX4 A;  3LZ0 C;  3B6F C;  3W98 A;  4CAY B;  1P34 C;  1P3O D;  1P3O B;  5AV5 C;  4Z66 D;  3B0C T;  3AZG C;  5AV9 B;  2F8N D;  2RVQ C;  4WU9 C;  5F99 B;  5F99 D;  5CPJ C;  4DRA A;  2JCH A;  2LY8 A;  5DNM C;  3X1U D;  1ZLA D;  1ZLA B;  4ZUX B;  3WA9 B;  1M19 C;  4WZS B;  5B0Z B;  3REL C;  4XZQ B;  1ULY A;  4XZQ D;  3FDD A;  3AZI B;  3AZI D;  1P3P B;  3UT9 D;  4J8W C;  3MNN A;  4H9P B;  4EO5 B;  3REH A;  3AZL C;  5C3I B;  3AZJ A;  3NQU A;  4KGC C;  2ARO B;  2ARO D;  3KUY D;  4ZBJ C;  4UPK A;  1ID3 B;  5AV6 C;  5B32 C;  3R45 B;  5B24 A;  3LZ1 C;  2ZY4 A;  1F66 B;  3WAA A;  5AV8 C;  4H9O B;  3EPJ A;  3W99 B;  3W99 D;  3V9R B;  1KU5 A;  1KX5 B;  1KX5 D;  5CPI D;  5CP6 C;  3AV1 C;  1BH8 A;  3LEL A;  4UUZ B;  1P3P A;  5DNN A;  3WAA C;  5FUG B;  5B2I D;  4DRB A;  4WU8 A;  5AV9 C;  1TZY D;  5AY8 B;  5F99 C;  1S32 A;  3KXB A;  1P3B D;  1H3O B;  1ZLA C;  4ZUX C;  3WA9 C;  5B0Z C;  4XZQ C;  5BT1 D;  3H0L C;  3AN2 B;  4J8V A;  1P3P C;  3AV2 D;  1P3M A;  5B1M B; 
#chains in the Genus database with same CATH homology
 3P5J B;  4EO5 C;  3REJ A;  3UTA A;  3AFA D;  4JJN A;  1M1A B;  1M1A D;  5C3I C;  2ARO C;  5AVC B;  1M18 B;  1M18 D;  5B31 A;  1S32 C;  4KUD D;  1P3A D;  5AVB A;  4YS3 A;  1ID3 C;  1TAF B;  5B0Y D;  5E5A D;  4J8V C;  1F66 C;  3O62 B;  1P3G D;  1N1J B;  3REJ C;  4JJN C;  3AYW A;  3AZE B;  5GT0 A;  2HIO B;  2HIO D;  2FJ7 B;  3WKJ A;  4LD9 A;  5BS7 A;  3MGP A;  3AZH A;  2FFF B;  1A7W A;  1W2E A;  4R8P D;  5CPK D;  5B1L A;  3MGR D;  1KX3 D;  4H9Q A;  5BNX A;  3B6F D;  5GXQ A;  1P34 D;  5GT3 B;  1Z2C B;  2BYM B;  3W96 A;  5AV5 D;  4J8U A;  3X1V A;  3AYW C;  3AZG D;  1P3K B;  1P3K D;  2RVQ D;  4WU9 D;  5AY8 C;  5CPJ D;  5CPJ B;  2CV5 A;  4G91 C;  3MGP C;  3AZF A;  3X1T A;  3REL D;  2Y2L A;  2BYK B;  3NQJ A;  3REK A;  3AZN B;  3B0D B;  3LJA A;  3TU4 C;  3AN2 C;  1KX4 B;  5B1M C;  3W98 B;  3W98 D;  2G5H C;  2DQN C;  5GSU A;  4J8U C;  1N1J A;  5BNV B;  1HQ3 A;  3AZL D;  1M1A C;  2NQB A;  5AVC C;  1M18 C;  3VH6 W;  4H9S C;  5B32 D;  3C1B A;  5B2J A;  2JE5 A;  2F8N K;  3A6N A;  3MNN B;  5AV8 D;  3O62 C;  3C1C A;  3REH B;  4G92 B;  5GT3 A;  2Y2N A;  3NQU B;  3AZJ B;  2L5A A;  3AZE C;  2HIO C;  2FJ7 C;  3AV1 D;  4J8X A;  1EQZ A;  2F8N H;  2ZY2 A;  5B24 B;  1WWS A;  3WAA B;  3WAA D;  5BO0 A;  5GT3 C;  4H9R A;  5BNV A;  3REI A;  5AV9 D;  4WNN B;  1P3K C;  3UTB A;  4H9N A;  4Z5T A;  1BH8 B;  2JSS A;  4ZUX D;  3LEL B;  5B0Z D;  3WA9 D;  3AZN C;  3B0D C;  1P3P D;  5DNN B;  5DNN D;  1KX4 C;  3MGQ A;  2J8P A;  3W98 C;  4WU8 B;  2Y2H A;  1AOI A;  3W97 A;  3EPL A;  3MVD B;  2W8S A;  3VH5 T;  1S32 B;  1S32 D;  3KXB B;  3TU4 B;  2YFW A;  1ID3 D;  1P3L A;  3KSY A;  4J8V B;  4J8V D;  1P3M B;  1P3M D;  1F66 D;  3MNN C;  3REH C;  5B33 A;  4YM6 A;  4G92 C;  3REJ B;  3REJ D;  4JJN B;  4JJN D;  3UTA D;  3UTA B;  3AZJ C;  4WNN A;  3X1S A;  5B31 B;  5B40 A;  3AZM A;  5AVB B;  4YS3 B;  1P3L C;  1WWI A;  4XUJ A;  5B24 C;  1P3F B;  3WTP E;  2NZD A;  3AYW B;  3AYW D;  3B6G A;  3MVD A;  5GT0 B;  1U35 A;  3WTP A;  3MGS A;  5AY8 D;  3AZK A;  3WKJ B;  4G91 B;  4LD9 B;  3MGP B;  3MGP D;  4QLC B;  3AZH B;  4CSR B;  5CHL B;  3KWQ A;  4Z66 A;  5B1L B;  5B1L D;  4XUJ C;  3LEL C;  4H9Q B;  2G5I C;  3TU4 D;  2F8N A;  5DNN C;  5BNX B;  5B1M D;  5GXQ B;  3X1U A;  4J8U B;  4J8U D;  3W96 B;  4WU8 C;  3X1V B;  3X1V D;  3MVD C;  5AVC D;  2CV5 B;  3UT9 A;  3AZF B;  3KXB C;  4NE6 A;  3X1T B;  3REK B;  3REK D;  3NQJ B;  2XD5 A;  5JRG B;  3LJA B;  3KUY A;  1P3M C;  1P3F A;  3O62 D;  5GSU B;  3UTA C;  1HQ3 B;  3VH6 T;  2NQB B;  3AZE D;  5JA4 A;  2FJ7 D;  1BH9 A;  5B31 C;  4QLC A;  4CSR A;  4HGA C;  5AVB C;  4YS3 C;  4Z2M G;  3C1B B;  5B2J B;  3A6N B;  5CPI A;  1P3F C;  3C1C B;  2DF4 C;  5GT3 D;  3AL0 C;  5GT0 C;  4LD9 C;  4NE5 A;  3H0M C;  5BS7 C;  3WKJ C;  4QLC C;  3AZH C;  5B2I A;  4J8X B;  4J8X D;  2Y2P A;  1EQZ B;  5B1L C;  3KFU G;  1TZY A;  5JRG A;  3AZN D;  1KX4 D;  1P3B A;  5BO0 B;  5GXQ C;  2PYO A;  3W96 C;  4H9R B;  3X1V C;  3REI B;  1JFI A;  3AV2 A;  3UTB B;  2CV5 C;  1Q9C A;  4H9N B;  4Z5T B;  3AZF C;  2CWE A;  3X1T C;  3AFA A;  3REK C;  5G49 A;  5JRG C;  3LJA C;  3MGQ B;  4KUD A;  3MNN D;  1P3A A;  3REH D;  5GSU C;  2PYO C;  5B0Y A;  1HQ3 C;  1AOI B;  3AZJ D;  3W97 B;  2YFV A;  5E5A A;  2NQB C;  2YFW B;  1P3I A;  1P3G A;  1F1E A;  1P3L B;  1P3L D;  3C1B C;  5B24 D;  5B2J C;  2ZY3 A;  2VQR A;  3A6N C;  1BFM A;  3C1C C;  5B33 B;  4R8P A;  4YM6 B;  5CPK A;  1HTA A;  4DQY B;  3MGR A;  1KX3 A;  3X1S B;  2BG1 A;  3LZ0 A;  5B40 B;  3AZM B;  3AZM D;  3A1K A;  3AN2 D;  1P3I C;  1P34 A;  4J8X C;  5AV5 A;  4XUJ B;  4XUJ D;  3LEL D;  1EQZ C;  3AZG A;  4WU9 A;  4X23 A;  5B31 G;  5DNM A;  2NZD B;  4WU8 D;  1M19 A;  3REL A;  2Y2Q A;  3REI C;  3B6G B;  3B6G D;  3MVD D;  1R4V A;  3WTP B;  3MGS B;  3AZK B;  1U35 B;  3UTB C;  4J8W A;  2F2A C;  4Z5T C;  3KXB D;  3KWQ B;  2Y2K A;  3KWQ D;  4Z66 B;  3AZL A;  4KGC A;  2F8N B;  3A1I A;  4X23 C;  4WJ3 C;  2Y2J A;  3MGQ C;  3X1U B;  3F6T A;  3VH5 A;  5AV6 A;  5B32 A;  4M6B A;  1AOI C;  3W97 C;  3LZ1 A;  3UT9 B;  5B31 D;  1B6W A;  5AV8 A;  4KHA A;  4HGA B;  5KDM A;  5AVB D;  4YS3 D;  3H0R C;  3KUY B;  1B67 A;  1P3F D;  5CP6 A;  3AV1 A;  5B33 C;  4YM6 C;  1T3U A;  2UWX A;  5JA4 B;  5GT0 D;  3X1S C;  4LD9 D;  1BH9 B;  2HUE B;  3WKJ D;  2XD1 A;  5B40 C;  4QLC D;  3AZM C;  3AZH D;  4CAY A;  1P3O A;  2IO5 B;  5AV9 A;  5F99 A;  3B0C W;  5CPI B;  3IP4 C;  5GXQ D;  1ZLA A;  4AWL B;  4ZUX A;  3WA9 A;  3W96 D;  2NZD C;  5B0Z A;  4XZQ A;  3B6G C;  3AZI A;  1U35 C;  3WTP C;  3MGS C;  3AZK C;  2CV5 D;  5B2I B;  3AZF D;  4H9P A;  3KWQ C;  1P3O C;  3X1T D;  4Z66 C;  1TZY B;  2ARO A;  5JRG D;  3LJA D;  1P3B B;  3X1U C;  2Y2O A;  2PYO B;  5GSU D;  3VH5 W;  1ID3 A;  2PYO D;  1HQ3 D;  1JFI B;  3R45 A;  3AZI C;  2NQB D;  3AV2 B;  3UT9 C;  1PZR A;  1F66 A;  4H9O A;  3AFA B;  3W99 A;  3V9R A;  3C1B D;  5G49 B;  5B2J D;  1KX5 A;  3KUY C;  2RIQ A;  3VH6 A;  3A6N D;  4KUD B;  1P3A B;  3C1C D;  5B0Y B;  4UUZ A;  4WV4 B;  2YFV B;  5E5A B;  2HUE C;  4Z2M H;  4NFT A;  5FUG A;  1P3I D;  1P3G B;  1P3I B;  2IO5 C;  1EQZ D;  3W99 C;  2Y2G A;  2Y2M A;  1KX5 C;  5AY8 A;  5CPI C;  4R8P B;  1H3O A;  5CPK B;  4AWL C;  3MGR B;  3REI D;  1KX3 B;  3AN2 A;  3TU4 A;  3LZ0 B;  3LZ0 D;  5B1M A;  3UTB D;  3B6F B;  4Z5T D;  5B2I C;  1P34 B;  3B0B A;  5AV5 B;  2ZM5 A;  3AZG B;  1M1A A;  2Y2I A;  5B32 G;  3EPH A;  1TZY C;  4X23 B;  5AVC A;  4X23 D;  4WU9 B;  1M18 A;  3MGQ D;  1P3B C;  5DNM B;  5DNM D;  4H9S A;  1M19 B;  1M19 D;  3REL B;  1TAF A;  4E44 A;  5BT1 C;  1AOI D;  3W97 D;  4NE3 A;  3AV2 C;  2ZY5 A;  4J8W B;  4J8W D;  3O62 A;  3AFA C;  3AZL B;  4KGC B;  4KGC D;  3AZE A;  2HIO A;  2FJ7 A;  4ZBJ B;  4KUD C;  1P3A C;  5B33 D;  4YM6 D;  5AV6 B;  5B32 B;  5B0Y C;  5AV6 D;  5E5A C;  3X1S D;  3LZ1 B;  3LZ1 D;  2F8N G;  3B6F A;  5B40 D;  5AV8 B;  4KHA B;  5KDM B;  1P3G C;  2BYM A;  3EG5 B;  1P3K A;  5CPJ A;  4E45 A;  5CP6 B;  5CP6 D;  4R8P C;  3AV1 B;  5CPK C;  2NZD D;  2BYK A;  3MGR C;  1KX3 C;  3EPK A;  3AZN A;  3WTP D;  3MGS D;  3AZK D;  1U35 D;  1KX4 A;  3LZ0 C;  3B6F C;  3W98 A;  4CAY B;  1P34 C;  1P3O D;  1P3O B;  5AV5 C;  4Z66 D;  3B0C T;  3AZG C;  5AV9 B;  2F8N D;  2RVQ C;  4WU9 C;  5F99 B;  5F99 D;  5CPJ C;  4DRA A;  2JCH A;  2LY8 A;  5DNM C;  3X1U D;  1ZLA D;  1ZLA B;  4ZUX B;  3WA9 B;  1M19 C;  4WZS B;  5B0Z B;  3REL C;  4XZQ B;  1ULY A;  4XZQ D;  3FDD A;  3AZI B;  3AZI D;  1P3P B;  3UT9 D;  4J8W C;  3MNN A;  4H9P B;  4EO5 B;  3REH A;  3AZL C;  5C3I B;  3AZJ A;  3NQU A;  4KGC C;  2ARO B;  2ARO D;  3KUY D;  4ZBJ C;  4UPK A;  1ID3 B;  5AV6 C;  5B32 C;  3R45 B;  5B24 A;  3LZ1 C;  2ZY4 A;  1F66 B;  3WAA A;  5AV8 C;  4H9O B;  3EPJ A;  3W99 B;  3W99 D;  3V9R B;  1KU5 A;  1KX5 B;  1KX5 D;  5CPI D;  5CP6 C;  3AV1 C;  1BH8 A;  3LEL A;  4UUZ B;  1P3P A;  5DNN A;  3WAA C;  5FUG B;  5B2I D;  4DRB A;  4WU8 A;  5AV9 C;  1TZY D;  5AY8 B;  5F99 C;  1S32 A;  3KXB A;  1P3B D;  1H3O B;  1ZLA C;  4ZUX C;  3WA9 C;  5B0Z C;  4XZQ C;  5BT1 D;  3H0L C;  3AN2 B;  4J8V A;  1P3P C;  3AV2 D;  1P3M A;  5B1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...