3W96B

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96B00
3AZMA 5KDMB 3KWQC 3W96A 3KXBC 3W99D 2L5AA 4YS3C 4AWLB 2NQBA 1P34C 3B6FA 4KHAB 5CPIC 3AZLB 1KX3D 3C1CC 1BH8A 2HIOC 5AVCB 5AVBC 4KGCA 5CP6D 5DNNC 5B31C 3AZGA 3AZEC 1KX5B 4KGCD 1P3OC 3C1BC 3UT9B 5B0YC 1P3BC 3W98C 3KUYD 5B1LB 3TU4B 1ZLAC 2CV5B 3WA9C 3X1TB 4X23B 3MGQC 1M19B 5DNMB 4Z66D 3LZ0D 3AZJA 3AZMB 3B6GA 5AV6D 1S32A 3W96B 3WKJC 1P3IA 3MGPD 1M19D 5B40D 2NQBB 3B6FB 5B1MD 1B6WA 1Q9CA 4XZQD 4YM6B 1ID3B 4WU8C 1BH8B 3MGSC 5AVBA 3AYWA 4Z5TB 3MVDD 5B31A 2FJ7D 3AZGB 2IO5C 3MGRA 3UTBC 5F99C 2NZDA 5B24A 5GT3A 3REKB 3B0BA 1P3OA 1ULYA 5GT0D 3C1BA 3X1UD 3LELA 3AZHD 2YFVA 4KUDA 5AY8B 3W97D 4ZBJB 3AN2A 1M1AD 4AWLC 4ZUXD 1F66A 4JJND 1P3LA 5AVCC 5BO0A 3AZJB 3B6GB 3UTAD 1S32B 3WKJA 4WNNA 1P3IB 1P3PA 1P3MD 1EQZD 1KX5C 3UT9C 3REHB 4J8XA 3NQJA 3KWQD 5C3IB 2F8ND 3KXBD 5B1LC 4YS3D 3TU4C 3AYWB 1P34D 5CPID 1JFIA 2CV5C 5GXQA 3X1TC 4X23C 3MGRB 3C1CD 1M19C 5BNXA 1A7WA 5DNMC 5AVBD 2NZDB 4XZQC 5B24B 5GT3B 4KUDB 3LELB 3AZMC 5B31D 3W96C 4WZSB 5JA4A 3AN2B 2NQBC 3B6FC 3AZED 1P3FA 5B0ZB 3REIA 1P3OD 1F66B 3C1BD 4KUDD 1B67A 5B0YD 3AZLA 1P3LB 4G92B 3VH6A 2PYOA 5AVCA 3W98D 1HQ3B 5BO0B 3AN2D 4UUZA 4E45A 4Z5TC 1ZLAD 3O62A 3WA9D 3AZGC 5BNVA 4H9NA 1P3PB 4H9QB 3REKC 3AV2A 4J8XB 3MNNA 5AY8C 3WKJD 4ZBJC 5B1LA 3TU4A 5B33B 3WAAA 5B31G 1JFIB 4WU8D 5GXQB 1M18B 3X1TA 3AV1A 4J8XD 5BNXB 3MGSD 5CHLB 3RELB 3AZJC 3B6GC 1S32C 4LD9B 1P3IC 5JA4B 3LZ1B 3UTBD 1P3FB 4J8UB 5F99D 3A6NA 1ID3A 4YM6A 3REIB 3REHC 3AZFA 5C3IC 2PYOB 1F1EA 4UUZB 3AYWC 4Z5TA 3O62B 3REID 3AFAA 5GSUA 3AZLD 4Z2MH 5BNVB 5B2IA 4H9NB 3MGRC 1TAFA 5AVCD 2RVQC 2NZDC 5B24C 3B0CW 5GT3C 3REKA 4KUDC 3X1VA 3LELC 3AV2B 3MNNB 5AY8A 4H9SA 3B0CT 3AN2C 4H9RB 3AZNA 1KX5D 4NE5A 3WAAB 5B0ZC 1F66C 3UT9D 3X1SA 3AV1B 3AV2D 5B32A 1P3LC 4G92C 4NFTA 1HQ3C 5B1LD 3TU4D 4WU9A 2CV5D 5AV8B 5CPKA 3X1TD 4X23D 5DNMD 1P3PC 3A6NB 1N1JA 1P3KA 3AZMD 3REHA 5FUGB 4J8XC 3AZFB 3W96D 2NQBD 5E5AA 3B6FD 5B33C 4G91B 1ID3D 4YM6D 3AFAB 5GSUB 2AROA 4E44A 5GXQC 5B2IB 1M18C 1TAFB 1P3AB 4Z5TD 3RELC 3LJAA 3X1VB 3AFAD 3AZGD 4DRAA 1HTAA 4LD9C 3LZ1C 3AZNB 1P3FC 4J8UC 4XUJB 5B0ZA 3REIC 3REKD 3AZLC 3X1SB 1KU5A 1U35A 5B32B 5AY8D 2PYOC 1HQ3A 5AV9A 4WU9B 3O62C 5CPKB 4EO5B 2LY8A 1N1JB 4H9QA 4Z2MG 1P3KB 3AZJD 3AV2C 3B6GD 3MNNC 1S32D 1P3ID 4NE6A 4QLCA 5E5AB 5B33A 1KX4B 3WAAC 2AROB 1TZYA 3AZKA 4J8VA 3REHD 3AV1C 1M18A 1R4VA 1BFMA 3AYWD 1BH9A 3RELA 3LJAB 5CPJA 4NE3A 1AOIA 5AV8C 4LD9A 3MGRD 4R8PA 3LZ1A 2RVQD 3WTPA 4J8UA 3A6NC 5B24D 1ID3C 5GT3D 4YM6C 2NZDD 3LJAD 3LELD 1U35B 3AZFC 5G49B 5JRGB 2BYMA 5AV9B 4G91C 5B0ZD 3AFAC 5GSUC 1F66D 3V9RA 5B2IC 3W99A 1U35D 1P3LD 3WTPE 1HQ3D 1P3AC 3X1VC 1KX3A 4J8WA 5BS7A 4H9SC 3VH6T 4QLCB 4H9RA 1P3PD 5CP6A 3AZNC 4XUJC 1TZYB 3MGQB 4J8VB 3AZKB 3X1SC 5B32C 5B33D 1BH9B 4WU9C 5CPJB 1AOIB 4H9PA 5AV8A 5GXQD 5CPKC 1M18D 3KUYA 5AV5B 4R8PB 4EO5C 3WTPB 3REJB 1P3KC 3RELD 1WWSA 5FUGA 4Z66A 4LD9D 3LZ1D 2BYMB 5E5AC 1P3FD 3LZ0A 4J8UD 5BT1D 5AV6A 2AROC 3V9RB 5B2JA 3W99B 3R45A 2PYOD 5B1MA 3NQUA 1P3AA 3LJAC 3O62D 1KX3B 4J8WB 3AZIA 1H3OA 5CP6B 3MVDA 2FJ7A 4XUJA 4J8WD 1U35C 3MNND 1WWIA 5JRGC 5GT0A 5AV9C 3AZHA 3X1UA 3WAAD 4H9PB 2BYKA 3W97A 3AV1D 3KUYB 1M1AA 4ZUXA 2JSSA 3KSYA 4JJNA 5AV8D 4Z66B 4QLCC 3VH5A 1P3GA 3LZ0B 1KX4A 3A6ND 4M6BA 5AV6B 3UTAA 1TZYC 5B2JB 4J8VC 3MGPB 3AZKC 3R45B 5B40B 3AZFD 1EQZA 1P3MA 5B1MB 3NQUB 4XZQB 4CSRA 5CPJC 1AOIC 3KWQA 3AZIB 1H3OB 5GSUD 2F8NA 3KXBA 5B2JD 5B2ID 5AV5C 4YS3A 4R8PC 1P34A 5CPIA 3WTPC 3MVDB 2FJ7B 1P3AD 5BT1C 3REJC 3X1VD 3C1CA 3AZID 3VH5W 2HIOA 2F8NH 5G49A 5JRGA 4KGCB 5GT0B 3AZHB 3AZND 3X1UB 3VH5T 2YFWA 5DNNA 4XUJD 2BYKB 3W97B 3X1SD 3W99C 1M1AB 5B32D 4ZUXB 3AZEA 4H9OA 2HUEB 5B0YA 4WU9D 4JJNB 1P3BA 1KX3C 4J8WC 5CPKD 5BS7C 4DRBA 3W98A 1P3GB 1ZLAA 5CP6C 3WA9A 3UTAB 1P3KD 3MGQA 3B0DB 4HGAB 1EQZB 1P3MB 5E5AD 4CSRB 1P3GD 1KX4D 4CAYA 3KWQB 2F8NB 2AROD 3KXBB 3KUYC 5AV5A 4YS3B 1P34B 5CPIB 4WU8A 3REJA 4WV4B 5B32G 3C1CB 2HIOB 4Z66C 3MGSA 5AVBB 3LZ0C 2YFWB 5DNNB 5B31B 5AV6C 5B2JC 2F8NK 3MGPC 5B40C 3UTBA 2HIOD 3AZEB 5B1MC 5JRGD 5F99A 4H9OB 1P3OB 5AV9D 3C1BB 5B0YB 1P3BB 2YFVB 5DNND 5KDMA 3AZIC 3W98B 1ZLAB 4KHAA 3MVDC 3WA9B 2FJ7C 1P3BD 2CWEA 4QLCD 4KGCC 5GT0C 3AZHC 3X1UC 4CAYB 2F8NG 3WKJB 3W97C 1TZYD 4WNNB 3MGQD 4J8VD 3AZKD 1M1AC 4ZUXC 1KX5A 4WU8B 3UT9A 2HUEC 4JJNC 5CPJD 3NQJB 1AOID 3MGSB 5AV5D 4R8PD 1P3GC 3WTPD 1KX4C 2CV5A 3VH6W 3UTAC 3REJD 2IO5B 4X23A 3B0DC 4HGAC 3MGPA 5B40A 1M19A 3UTBB 5DNMA 1P3MC 1EQZC 5F99B 4XZQA
chains in the Genus database with same CATH superfamily
3AZMA 5KDMB 3KWQC 3W96A 3KXBC 3W99D 2L5AA 4YS3C 4AWLB 2NQBA 1P34C 3B6FA 5F99B 4KHAB 5CPIC 3AZLB 1KX3D 3C1CC 1BH8A 2HIOC 5AVCB 5AVBC 2DQNC 4KGCA 5CP6D 5DNNC 5B31C 3AZGA 3AZEC 1KX5B 3IP4C 4KGCD 1P3OC 3C1BC 3UT9B 5B0YC 1P3BC 2G5IC 3W98C 3KUYD 5B1LB 3TU4B 1ZLAC 2CV5B 3WA9C 3F6TA 3X1TB 4X23B 3MGQC 1M19B 5DNMB 4Z66D 1Z2CB 3LZ0D 3AZJA 3AZMB 3B6GA 5AV6D 2ZY4A 1S32A 3WKJC 3W96B 1P3IA 3MGPD 1M19D 5B40D 2NQBB 3B6FB 5B1MD 1B6WA 1Q9CA 4XZQD 4YM6B 1ID3B 4WU8C 1BH8B 3MGSC 2XD1A 5AVBA 3AYWA 4Z5TB 3MVDD 5B31A 2FJ7D 3AZGB 2IO5C 3MGRA 2UWXA 3UTBC 5F99C 2NZDA 5B24A 5GT3A 3REKB 3B0BA 1P3OA 1ULYA 5GT0D 3C1BA 3X1UD 3LELA 2FFFB 2YFVA 3AZHD 4KUDA 5AY8B 3W97D 4ZBJB 3AN2A 1M1AD 4AWLC 4ZUXD 1F66A 4JJND 1P3LA 5AVCC 5BO0A 3AZJB 3B6GB 3UTAD 1S32B 3WKJA 4WNNA 1P3IB 1P3PA 1P3MD 1EQZD 1KX5C 3UT9C 3REHB 4J8XA 3NQJA 3KWQD 5C3IB 2F8ND 3KXBD 5B1LC 4YS3D 3TU4C 3AYWB 1P34D 5CPID 1JFIA 2CV5C 3EPKA 3H0RC 5GXQA 3X1TC 4X23C 3MGRB 3C1CD 1M19C 5BNXA 1A7WA 5DNMC 3EPLA 5AVBD 2NZDB 4XZQC 5B24B 5GT3B 4KUDB 3LELB 3AZMC 5B31D 3W96C 4WZSB 5JA4A 3AN2B 2NQBC 3B6FC 3AZED 1P3FA 5B0ZB 3REIA 1P3OD 2BG1A 2Y2NA 3C1BD 1F66B 1B67A 5B0YD 3AZLA 4KUDD 1P3LB 4G92B 3VH6A 2PYOA 5AVCA 3W98D 1HQ3B 5BO0B 3AN2D 4UUZA 4E45A 4Z5TC 1ZLAD 3O62A 3WA9D 3AZGC 5BNVA 4H9NA 1P3PB 2DF4C 1PZRA 4H9QB 3REKC 3AV2A 4J8XB 3MNNA 5AY8C 3WKJD 4ZBJC 5B1LA 3TU4A 2ZY3A 5B33B 3WAAA 5B31G 1JFIB 4WU8D 5GXQB 1M18B 3X1TA 3AV1A 4J8XD 5BNXB 3MGSD 5CHLB 3EPHA 3RELB 3AZJC 1W2EA 3B6GC 1S32C 4LD9B 1P3IC 5JA4B 3LZ1B 3UTBD 1P3FB 4J8UB 5F99D 3A6NA 2Y2HA 1ID3A 4YM6A 3REIB 3REHC 3AZFA 5C3IC 2PYOB 1F1EA 4UUZB 3AYWC 4Z5TA 3O62B 3REID 3AFAA 5GSUA 3AZLD 4Z2MH 5BNVB 5B2IA 4H9NB 3MGRC 1TAFA 5AVCD 2RVQC 2NZDC 5B24C 3B0CW 5GT3C 3REKA 4KUDC 3X1VA 3LELC 3AV2B 3MNNB 5AY8A 4H9SA 3B0CT 3AN2C 4H9RB 3AZNA 1KX5D 4NE5A 3WAAB 5B0ZC 2Y2PA 1F66C 3UT9D 3X1SA 3AV1B 3AV2D 5B32A 1P3LC 4G92C 2Y2JA 2W8SA 4NFTA 1HQ3C 5B1LD 3TU4D 4WU9A 2Y2MA 2CV5D 5AV8B 5CPKA 3X1TD 4X23D 3P5JB 5DNMD 1P3PC 3A6NB 1N1JA 1P3KA 3AZMD 3FDDA 3REHA 5FUGB 4J8XC 3AZFB 3W96D 2NQBD 5E5AA 3B6FD 5B33C 4G91B 1ID3D 4YM6D 3AFAB 5GSUB 2AROA 4E44A 5GXQC 5B2IB 1M18C 1TAFB 2F2AC 4UPKA 1P3AB 4Z5TD 3RELC 3LJAA 3X1VB 3AFAD 3AZGD 4DRAA 1HTAA 4LD9C 3LZ1C 3AZNB 1P3FC 4J8UC 4XUJB 5B0ZA 3REIC 3REKD 3AZLC 3X1SB 1KU5A 1U35A 5B32B 5AY8D 2PYOC 1HQ3A 5AV9A 4WU9B 3O62C 5CPKB 4EO5B 2LY8A 1N1JB 2J8PA 2ZY2A 4H9QA 4Z2MG 1P3KB 3AZJD 3AV2C 3B6GD 3MNNC 1S32D 1P3ID 4NE6A 4QLCA 5E5AB 5B33A 1KX4B 3WAAC 2AROB 1TZYA 3AZKA 4J8VA 3REHD 3AV1C 1M18A 1R4VA 1BFMA 3AYWD 2XD5A 1BH9A 3RELA 3LJAB 5CPJA 4NE3A 1AOIA 5AV8C 4LD9A 3MGRD 4R8PA 3LZ1A 2RVQD 3WTPA 4J8UA 3A6NC 5B24D 1ID3C 5GT3D 4YM6C 2NZDD 3LJAD 3LELD 1U35B 3AZFC 5G49B 5JRGB 2BYMA 5AV9B 4G91C 5B0ZD 3AFAC 5GSUC 1F66D 3V9RA 5B2IC 3W99A 1U35D 1P3LD 3WTPE 1HQ3D 1P3AC 2VQRA 3X1VC 1KX3A 4J8WA 5BS7A 4H9SC 4QLCB 4H9RA 1P3PD 5CP6A 3AZNC 4XUJC 1TZYB 3MGQB 4J8VB 4DQYB 3AZKB 3X1SC 5B32C 2Y2QA 5B33D 1BH9B 4WU9C 5CPJB 1AOIB 4H9PA 5AV8A 5GXQD 5CPKC 1M18D 3KUYA 5AV5B 4R8PB 4EO5C 3WTPB 3REJB 1P3KC 3RELD 1WWSA 5FUGA 4Z66A 4LD9D 3LZ1D 2BYMB 5E5AC 1P3FD 2ZY5A 3LZ0A 4J8UD 5BT1D 5AV6A 2AROC 3V9RB 5B2JA 3W99B 3R45A 2PYOD 5B1MA 3NQUA 1P3AA 3LJAC 3O62D 1KX3B 4J8WB 3AZIA 1H3OA 2JE5A 5CP6B 3MVDA 2FJ7A 4XUJA 4J8WD 1U35C 3MNND 1WWIA 2ZM5A 5JRGC 5GT0A 5AV9C 3AZHA 3X1UA 3WAAD 4H9PB 2BYKA 3W97A 3AV1D 3KUYB 1M1AA 4ZUXA 2JSSA 3KSYA 4WJ3C 4JJNA 5AV8D 4Z66B 4QLCC 3VH5A 1P3GA 3LZ0B 1KX4A 3A6ND 2Y2IA 3KFUG 4M6BA 5AV6B 3UTAA 1TZYC 5B2JB 4J8VC 3MGPB 3AZKC 2Y2OA 3R45B 5B40B 3AZFD 1P3MA 1EQZA 5B1MB 3NQUB 4XZQB 4CSRA 5CPJC 1AOIC 3KWQA 3AZIB 1H3OB 5GSUD 2F8NA 3KXBA 5B2JD 5B2ID 5AV5C 4YS3A 4R8PC 1P34A 5CPIA 3WTPC 3MVDB 2FJ7B 1P3AD 5BT1C 3REJC 3X1VD 3C1CA 3AZID 3VH5W 2HIOA 2F8NH 5G49A 5JRGA 1T3UA 4KGCB 5GT0B 3AZHB 3AZND 3X1UB 3VH5T 2YFWA 5DNNA 3H0LC 4XUJD 2BYKB 3W97B 3X1SD 3W99C 1M1AB 5B32D 4ZUXB 3AZEA 4H9OA 2HUEB 5B0YA 4WU9D 4JJNB 1P3BA 1KX3C 4J8WC 5CPKD 5BS7C 4DRBA 3W98A 1P3GB 1ZLAA 5CP6C 3WA9A 3UTAB 1P3KD 3MGQA 3B0DB 4HGAB 1EQZB 1P3MB 5E5AD 4CSRB 1P3GD 1KX4D 4CAYA 3KWQB 3H0MC 2F8NB 2AROD 3KXBB 3KUYC 3A1IA 5AV5A 4YS3B 1P34B 5CPIB 4WU8A 3REJA 4WV4B 5B32G 3C1CB 2HIOB 4Z66C 3MGSA 5AVBB 3LZ0C 2YFWB 5DNNB 5B31B 5AV6C 2Y2LA 5B2JC 2F8NK 3MGPC 5B40C 3UTBA 2HIOD 2Y2KA 3AZEB 5B1MC 5JRGD 5F99A 4H9OB 1P3OB 5AV9D 3C1BB 5B0YB 1P3BB 2YFVB 5DNND 5KDMA 3AZIC 3W98B 1ZLAB 4KHAA 2RIQA 3MVDC 3WA9B 2FJ7C 1P3BD 2Y2GA 2CWEA 4QLCD 4KGCC 3A1KA 5GT0C 3AZHC 3X1UC 4CAYB 2G5HC 2F8NG 3WKJB 3W97C 1TZYD 4WNNB 3MGQD 4J8VD 3AZKD 1M1AC 4ZUXC 1KX5A 3EPJA 4WU8B 2JCHA 3UT9A 2HUEC 4JJNC 5CPJD 3NQJB 1AOID 3AL0C 3MGSB 5AV5D 4R8PD 3EG5B 1P3GC 3WTPD 1KX4C 2CV5A 3VH6W 3UTAC 3REJD 2IO5B 4X23A 3B0DC 4HGAC 3MGPA 5B40A 1M19A 3UTBB 5DNMA 1P3MC 1EQZC 3VH6T 4XZQA
chains in the Genus database with same CATH topology
3AZMA 5KDMB 3KWQC 3W96A 3KXBC 3W99D 2L5AA 4YS3C 4AWLB 2NQBA 1P34C 3B6FA 5F99B 4KHAB 5CPIC 3AZLB 1KX3D 3C1CC 1BH8A 2HIOC 5AVCB 5AVBC 2DQNC 4KGCA 5CP6D 5DNNC 5B31C 3AZGA 3AZEC 1KX5B 3IP4C 4KGCD 1P3OC 3C1BC 3UT9B 5B0YC 1P3BC 2G5IC 3W98C 3KUYD 5B1LB 3TU4B 1ZLAC 2CV5B 3WA9C 3F6TA 3X1TB 4X23B 3MGQC 1M19B 5DNMB 4Z66D 1Z2CB 3LZ0D 3AZJA 3AZMB 3B6GA 5AV6D 2ZY4A 1S32A 3WKJC 3W96B 1P3IA 3MGPD 1M19D 5B40D 2NQBB 3B6FB 5B1MD 1B6WA 1Q9CA 4XZQD 4YM6B 1ID3B 4WU8C 1BH8B 3MGSC 2XD1A 5AVBA 3AYWA 4Z5TB 3MVDD 5B31A 2FJ7D 3AZGB 2IO5C 3MGRA 2UWXA 3UTBC 5F99C 2NZDA 5B24A 5GT3A 3REKB 3B0BA 1P3OA 1ULYA 5GT0D 3C1BA 3X1UD 3LELA 2FFFB 2YFVA 3AZHD 4KUDA 5AY8B 3W97D 4ZBJB 3AN2A 1M1AD 4AWLC 4ZUXD 1F66A 4JJND 1P3LA 5AVCC 5BO0A 3AZJB 3B6GB 3UTAD 1S32B 3WKJA 4WNNA 1P3IB 1P3PA 1P3MD 1EQZD 1KX5C 3UT9C 3REHB 4J8XA 3NQJA 3KWQD 5C3IB 2F8ND 3KXBD 5B1LC 4YS3D 3TU4C 3AYWB 1P34D 5CPID 1JFIA 2CV5C 3EPKA 3H0RC 5GXQA 3X1TC 4X23C 3MGRB 3C1CD 1M19C 5BNXA 1A7WA 5DNMC 3EPLA 5AVBD 2NZDB 4XZQC 5B24B 5GT3B 4KUDB 3LELB 3AZMC 5B31D 3W96C 4WZSB 5JA4A 3AN2B 2NQBC 3B6FC 3AZED 1P3FA 5B0ZB 3REIA 1P3OD 2BG1A 2Y2NA 3C1BD 1F66B 1B67A 5B0YD 3AZLA 4KUDD 1P3LB 4G92B 3VH6A 2PYOA 5AVCA 3W98D 1HQ3B 5BO0B 3AN2D 4UUZA 4E45A 4Z5TC 1ZLAD 3O62A 3WA9D 3AZGC 5BNVA 4H9NA 1P3PB 2DF4C 1PZRA 4H9QB 3REKC 3AV2A 4J8XB 3MNNA 5AY8C 3WKJD 4ZBJC 5B1LA 3TU4A 2ZY3A 5B33B 3WAAA 5B31G 1JFIB 4WU8D 5GXQB 1M18B 3X1TA 3AV1A 4J8XD 5BNXB 3MGSD 5CHLB 3EPHA 3RELB 3AZJC 1W2EA 3B6GC 1S32C 4LD9B 1P3IC 5JA4B 3LZ1B 3UTBD 1P3FB 4J8UB 5F99D 3A6NA 2Y2HA 1ID3A 4YM6A 3REIB 3REHC 3AZFA 5C3IC 2PYOB 1F1EA 4UUZB 3AYWC 4Z5TA 3O62B 3REID 3AFAA 5GSUA 3AZLD 4Z2MH 5BNVB 5B2IA 4H9NB 3MGRC 1TAFA 5AVCD 2RVQC 2NZDC 5B24C 3B0CW 5GT3C 3REKA 4KUDC 3X1VA 3LELC 3AV2B 3MNNB 5AY8A 4H9SA 3B0CT 3AN2C 4H9RB 3AZNA 1KX5D 4NE5A 3WAAB 5B0ZC 2Y2PA 1F66C 3UT9D 3X1SA 3AV1B 3AV2D 5B32A 1P3LC 4G92C 2Y2JA 2W8SA 4NFTA 1HQ3C 5B1LD 3TU4D 4WU9A 2Y2MA 2CV5D 5AV8B 5CPKA 3X1TD 4X23D 3P5JB 5DNMD 1P3PC 3A6NB 1N1JA 1P3KA 3AZMD 3FDDA 3REHA 5FUGB 4J8XC 3AZFB 3W96D 2NQBD 5E5AA 3B6FD 5B33C 4G91B 1ID3D 4YM6D 3AFAB 5GSUB 2AROA 4E44A 5GXQC 5B2IB 1M18C 1TAFB 2F2AC 4UPKA 1P3AB 4Z5TD 3RELC 3LJAA 3X1VB 3AFAD 3AZGD 4DRAA 1HTAA 4LD9C 3LZ1C 3AZNB 1P3FC 4J8UC 4XUJB 5B0ZA 3REIC 3REKD 3AZLC 3X1SB 1KU5A 1U35A 5B32B 5AY8D 2PYOC 1HQ3A 5AV9A 4WU9B 3O62C 5CPKB 4EO5B 2LY8A 1N1JB 2J8PA 2ZY2A 4H9QA 4Z2MG 1P3KB 3AZJD 3AV2C 3B6GD 3MNNC 1S32D 1P3ID 4NE6A 4QLCA 5E5AB 5B33A 1KX4B 3WAAC 2AROB 1TZYA 3AZKA 4J8VA 3REHD 3AV1C 1M18A 1R4VA 1BFMA 3AYWD 2XD5A 1BH9A 3RELA 3LJAB 5CPJA 4NE3A 1AOIA 5AV8C 4LD9A 3MGRD 4R8PA 3LZ1A 2RVQD 3WTPA 4J8UA 3A6NC 5B24D 1ID3C 5GT3D 4YM6C 2NZDD 3LJAD 3LELD 1U35B 3AZFC 5G49B 5JRGB 2BYMA 5AV9B 4G91C 5B0ZD 3AFAC 5GSUC 1F66D 3V9RA 5B2IC 3W99A 1U35D 1P3LD 3WTPE 1HQ3D 1P3AC 2VQRA 3X1VC 1KX3A 4J8WA 5BS7A 4H9SC 4QLCB 4H9RA 1P3PD 5CP6A 3AZNC 4XUJC 1TZYB 3MGQB 4J8VB 4DQYB 3AZKB 3X1SC 5B32C 2Y2QA 5B33D 1BH9B 4WU9C 5CPJB 1AOIB 4H9PA 5AV8A 5GXQD 5CPKC 1M18D 3KUYA 5AV5B 4R8PB 4EO5C 3WTPB 3REJB 1P3KC 3RELD 1WWSA 5FUGA 4Z66A 4LD9D 3LZ1D 2BYMB 5E5AC 1P3FD 2ZY5A 3LZ0A 4J8UD 5BT1D 5AV6A 2AROC 3V9RB 5B2JA 3W99B 3R45A 2PYOD 5B1MA 3NQUA 1P3AA 3LJAC 3O62D 1KX3B 4J8WB 3AZIA 1H3OA 2JE5A 5CP6B 3MVDA 2FJ7A 4XUJA 4J8WD 1U35C 3MNND 1WWIA 2ZM5A 5JRGC 5GT0A 5AV9C 3AZHA 3X1UA 3WAAD 4H9PB 2BYKA 3W97A 3AV1D 3KUYB 1M1AA 4ZUXA 2JSSA 3KSYA 4WJ3C 4JJNA 5AV8D 4Z66B 4QLCC 3VH5A 1P3GA 3LZ0B 1KX4A 3A6ND 2Y2IA 3KFUG 4M6BA 5AV6B 3UTAA 1TZYC 5B2JB 4J8VC 3MGPB 3AZKC 2Y2OA 3R45B 5B40B 3AZFD 1P3MA 1EQZA 5B1MB 3NQUB 4XZQB 4CSRA 5CPJC 1AOIC 3KWQA 3AZIB 1H3OB 5GSUD 2F8NA 3KXBA 5B2JD 5B2ID 5AV5C 4YS3A 4R8PC 1P34A 5CPIA 3WTPC 3MVDB 2FJ7B 1P3AD 5BT1C 3REJC 3X1VD 3C1CA 3AZID 3VH5W 2HIOA 2F8NH 5G49A 5JRGA 1T3UA 4KGCB 5GT0B 3AZHB 3AZND 3X1UB 3VH5T 2YFWA 5DNNA 3H0LC 4XUJD 2BYKB 3W97B 3X1SD 3W99C 1M1AB 5B32D 4ZUXB 3AZEA 4H9OA 2HUEB 5B0YA 4WU9D 4JJNB 1P3BA 1KX3C 4J8WC 5CPKD 5BS7C 4DRBA 3W98A 1P3GB 1ZLAA 5CP6C 3WA9A 3UTAB 1P3KD 3MGQA 3B0DB 4HGAB 1EQZB 1P3MB 5E5AD 4CSRB 1P3GD 1KX4D 4CAYA 3KWQB 3H0MC 2F8NB 2AROD 3KXBB 3KUYC 3A1IA 5AV5A 4YS3B 1P34B 5CPIB 4WU8A 3REJA 4WV4B 5B32G 3C1CB 2HIOB 4Z66C 3MGSA 5AVBB 3LZ0C 2YFWB 5DNNB 5B31B 5AV6C 2Y2LA 5B2JC 2F8NK 3MGPC 5B40C 3UTBA 2HIOD 2Y2KA 3AZEB 5B1MC 5JRGD 5F99A 4H9OB 1P3OB 5AV9D 3C1BB 5B0YB 1P3BB 2YFVB 5DNND 5KDMA 3AZIC 3W98B 1ZLAB 4KHAA 2RIQA 3MVDC 3WA9B 2FJ7C 1P3BD 2Y2GA 2CWEA 4QLCD 4KGCC 3A1KA 5GT0C 3AZHC 3X1UC 4CAYB 2G5HC 2F8NG 3WKJB 3W97C 1TZYD 4WNNB 3MGQD 4J8VD 3AZKD 1M1AC 4ZUXC 1KX5A 3EPJA 4WU8B 2JCHA 3UT9A 2HUEC 4JJNC 5CPJD 3NQJB 1AOID 3AL0C 3MGSB 5AV5D 4R8PD 3EG5B 1P3GC 3WTPD 1KX4C 2CV5A 3VH6W 3UTAC 3REJD 2IO5B 4X23A 3B0DC 4HGAC 3MGPA 5B40A 1M19A 3UTBB 5DNMA 1P3MC 1EQZC 3VH6T 4XZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZM A;  5KDM B;  3KWQ C;  3W96 A;  3KXB C;  3W99 D;  2L5A A;  4YS3 C;  4AWL B;  2NQB A;  1P34 C;  3B6F A;  4KHA B;  5CPI C;  3AZL B;  1KX3 D;  3C1C C;  1BH8 A;  2HIO C;  5AVC B;  5AVB C;  4KGC A;  5CP6 D;  5DNN C;  5B31 C;  3AZG A;  3AZE C;  1KX5 B;  4KGC D;  1P3O C;  3C1B C;  3UT9 B;  5B0Y C;  1P3B C;  3W98 C;  3KUY D;  5B1L B;  3TU4 B;  1ZLA C;  2CV5 B;  3WA9 C;  3X1T B;  4X23 B;  3MGQ C;  1M19 B;  5DNM B;  4Z66 D;  3LZ0 D;  3AZJ A;  3AZM B;  3B6G A;  5AV6 D;  1S32 A;  3W96 B;  3WKJ C;  1P3I A;  3MGP D;  1M19 D;  5B40 D;  2NQB B;  3B6F B;  5B1M D;  1B6W A;  1Q9C A;  4XZQ D;  4YM6 B;  1ID3 B;  4WU8 C;  1BH8 B;  3MGS C;  5AVB A;  3AYW A;  4Z5T B;  3MVD D;  5B31 A;  2FJ7 D;  3AZG B;  2IO5 C;  3MGR A;  3UTB C;  5F99 C;  2NZD A;  5B24 A;  5GT3 A;  3REK B;  3B0B A;  1P3O A;  1ULY A;  5GT0 D;  3C1B A;  3X1U D;  3LEL A;  3AZH D;  2YFV A;  4KUD A;  5AY8 B;  3W97 D;  4ZBJ B;  3AN2 A;  1M1A D;  4AWL C;  4ZUX D;  1F66 A;  4JJN D;  1P3L A;  5AVC C;  5BO0 A;  3AZJ B;  3B6G B;  3UTA D;  1S32 B;  3WKJ A;  4WNN A;  1P3I B;  1P3P A;  1P3M D;  1EQZ D;  1KX5 C;  3UT9 C;  3REH B;  4J8X A;  3NQJ A;  3KWQ D;  5C3I B;  2F8N D;  3KXB D;  5B1L C;  4YS3 D;  3TU4 C;  3AYW B;  1P34 D;  5CPI D;  1JFI A;  2CV5 C;  5GXQ A;  3X1T C;  4X23 C;  3MGR B;  3C1C D;  1M19 C;  5BNX A;  1A7W A;  5DNM C;  5AVB D;  2NZD B;  4XZQ C;  5B24 B;  5GT3 B;  4KUD B;  3LEL B;  3AZM C;  5B31 D;  3W96 C;  4WZS B;  5JA4 A;  3AN2 B;  2NQB C;  3B6F C;  3AZE D;  1P3F A;  5B0Z B;  3REI A;  1P3O D;  1F66 B;  3C1B D;  4KUD D;  1B67 A;  5B0Y D;  3AZL A;  1P3L B;  4G92 B;  3VH6 A;  2PYO A;  5AVC A;  3W98 D;  1HQ3 B;  5BO0 B;  3AN2 D;  4UUZ A;  4E45 A;  4Z5T C;  1ZLA D;  3O62 A;  3WA9 D;  3AZG C;  5BNV A;  4H9N A;  1P3P B;  4H9Q B;  3REK C;  3AV2 A;  4J8X B;  3MNN A;  5AY8 C;  3WKJ D;  4ZBJ C;  5B1L A;  3TU4 A;  5B33 B;  3WAA A;  5B31 G;  1JFI B;  4WU8 D;  5GXQ B;  1M18 B;  3X1T A;  3AV1 A;  4J8X D;  5BNX B;  3MGS D;  5CHL B;  3REL B;  3AZJ C;  3B6G C;  1S32 C;  4LD9 B;  1P3I C;  5JA4 B;  3LZ1 B;  3UTB D;  1P3F B;  4J8U B;  5F99 D;  3A6N A;  1ID3 A;  4YM6 A;  3REI B;  3REH C;  3AZF A;  5C3I C;  2PYO B;  1F1E A;  4UUZ B;  3AYW C;  4Z5T A;  3O62 B;  3REI D;  3AFA A;  5GSU A;  3AZL D;  4Z2M H;  5BNV B;  5B2I A;  4H9N B;  3MGR C;  1TAF A;  5AVC D;  2RVQ C;  2NZD C;  5B24 C;  3B0C W;  5GT3 C;  3REK A;  4KUD C;  3X1V A;  3LEL C;  3AV2 B;  3MNN B;  5AY8 A;  4H9S A;  3B0C T;  3AN2 C;  4H9R B;  3AZN A;  1KX5 D;  4NE5 A;  3WAA B;  5B0Z C;  1F66 C;  3UT9 D;  3X1S A;  3AV1 B;  3AV2 D;  5B32 A;  1P3L C;  4G92 C;  4NFT A;  1HQ3 C;  5B1L D;  3TU4 D;  4WU9 A;  2CV5 D;  5AV8 B;  5CPK A;  3X1T D;  4X23 D;  5DNM D;  1P3P C;  3A6N B;  1N1J A;  1P3K A;  3AZM D;  3REH A;  5FUG B;  4J8X C;  3AZF B;  3W96 D;  2NQB D;  5E5A A;  3B6F D;  5B33 C;  4G91 B;  1ID3 D;  4YM6 D;  3AFA B;  5GSU B;  2ARO A;  4E44 A;  5GXQ C;  5B2I B;  1M18 C;  1TAF B;  1P3A B;  4Z5T D;  3REL C;  3LJA A;  3X1V B;  3AFA D;  3AZG D;  4DRA A;  1HTA A;  4LD9 C;  3LZ1 C;  3AZN B;  1P3F C;  4J8U C;  4XUJ B;  5B0Z A;  3REI C;  3REK D;  3AZL C;  3X1S B;  1KU5 A;  1U35 A;  5B32 B;  5AY8 D;  2PYO C;  1HQ3 A;  5AV9 A;  4WU9 B;  3O62 C;  5CPK B;  4EO5 B;  2LY8 A;  1N1J B;  4H9Q A;  4Z2M G;  1P3K B;  3AZJ D;  3AV2 C;  3B6G D;  3MNN C;  1S32 D;  1P3I D;  4NE6 A;  4QLC A;  5E5A B;  5B33 A;  1KX4 B;  3WAA C;  2ARO B;  1TZY A;  3AZK A;  4J8V A;  3REH D;  3AV1 C;  1M18 A;  1R4V A;  1BFM A;  3AYW D;  1BH9 A;  3REL A;  3LJA B;  5CPJ A;  4NE3 A;  1AOI A;  5AV8 C;  4LD9 A;  3MGR D;  4R8P A;  3LZ1 A;  2RVQ D;  3WTP A;  4J8U A;  3A6N C;  5B24 D;  1ID3 C;  5GT3 D;  4YM6 C;  2NZD D;  3LJA D;  3LEL D;  1U35 B;  3AZF C;  5G49 B;  5JRG B;  2BYM A;  5AV9 B;  4G91 C;  5B0Z D;  3AFA C;  5GSU C;  1F66 D;  3V9R A;  5B2I C;  3W99 A;  1U35 D;  1P3L D;  3WTP E;  1HQ3 D;  1P3A C;  3X1V C;  1KX3 A;  4J8W A;  5BS7 A;  4H9S C;  3VH6 T;  4QLC B;  4H9R A;  1P3P D;  5CP6 A;  3AZN C;  4XUJ C;  1TZY B;  3MGQ B;  4J8V B;  3AZK B;  3X1S C;  5B32 C;  5B33 D;  1BH9 B;  4WU9 C;  5CPJ B;  1AOI B;  4H9P A;  5AV8 A;  5GXQ D;  5CPK C;  1M18 D;  3KUY A;  5AV5 B;  4R8P B;  4EO5 C;  3WTP B;  3REJ B;  1P3K C;  3REL D;  1WWS A;  5FUG A;  4Z66 A;  4LD9 D;  3LZ1 D;  2BYM B;  5E5A C;  1P3F D;  3LZ0 A;  4J8U D;  5BT1 D;  5AV6 A;  2ARO C;  3V9R B;  5B2J A;  3W99 B;  3R45 A;  2PYO D;  5B1M A;  3NQU A;  1P3A A;  3LJA C;  3O62 D;  1KX3 B;  4J8W B;  3AZI A;  1H3O A;  5CP6 B;  3MVD A;  2FJ7 A;  4XUJ A;  4J8W D;  1U35 C;  3MNN D;  1WWI A;  5JRG C;  5GT0 A;  5AV9 C;  3AZH A;  3X1U A;  3WAA D;  4H9P B;  2BYK A;  3W97 A;  3AV1 D;  3KUY B;  1M1A A;  4ZUX A;  2JSS A;  3KSY A;  4JJN A;  5AV8 D;  4Z66 B;  4QLC C;  3VH5 A;  1P3G A;  3LZ0 B;  1KX4 A;  3A6N D;  4M6B A;  5AV6 B;  3UTA A;  1TZY C;  5B2J B;  4J8V C;  3MGP B;  3AZK C;  3R45 B;  5B40 B;  3AZF D;  1EQZ A;  1P3M A;  5B1M B;  3NQU B;  4XZQ B;  4CSR A;  5CPJ C;  1AOI C;  3KWQ A;  3AZI B;  1H3O B;  5GSU D;  2F8N A;  3KXB A;  5B2J D;  5B2I D;  5AV5 C;  4YS3 A;  4R8P C;  1P34 A;  5CPI A;  3WTP C;  3MVD B;  2FJ7 B;  1P3A D;  5BT1 C;  3REJ C;  3X1V D;  3C1C A;  3AZI D;  3VH5 W;  2HIO A;  2F8N H;  5G49 A;  5JRG A;  4KGC B;  5GT0 B;  3AZH B;  3AZN D;  3X1U B;  3VH5 T;  2YFW A;  5DNN A;  4XUJ D;  2BYK B;  3W97 B;  3X1S D;  3W99 C;  1M1A B;  5B32 D;  4ZUX B;  3AZE A;  4H9O A;  2HUE B;  5B0Y A;  4WU9 D;  4JJN B;  1P3B A;  1KX3 C;  4J8W C;  5CPK D;  5BS7 C;  4DRB A;  3W98 A;  1P3G B;  1ZLA A;  5CP6 C;  3WA9 A;  3UTA B;  1P3K D;  3MGQ A;  3B0D B;  4HGA B;  1EQZ B;  1P3M B;  5E5A D;  4CSR B;  1P3G D;  1KX4 D;  4CAY A;  3KWQ B;  2F8N B;  2ARO D;  3KXB B;  3KUY C;  5AV5 A;  4YS3 B;  1P34 B;  5CPI B;  4WU8 A;  3REJ A;  4WV4 B;  5B32 G;  3C1C B;  2HIO B;  4Z66 C;  3MGS A;  5AVB B;  3LZ0 C;  2YFW B;  5DNN B;  5B31 B;  5AV6 C;  5B2J C;  2F8N K;  3MGP C;  5B40 C;  3UTB A;  2HIO D;  3AZE B;  5B1M C;  5JRG D;  5F99 A;  4H9O B;  1P3O B;  5AV9 D;  3C1B B;  5B0Y B;  1P3B B;  2YFV B;  5DNN D;  5KDM A;  3AZI C;  3W98 B;  1ZLA B;  4KHA A;  3MVD C;  3WA9 B;  2FJ7 C;  1P3B D;  2CWE A;  4QLC D;  4KGC C;  5GT0 C;  3AZH C;  3X1U C;  4CAY B;  2F8N G;  3WKJ B;  3W97 C;  1TZY D;  4WNN B;  3MGQ D;  4J8V D;  3AZK D;  1M1A C;  4ZUX C;  1KX5 A;  4WU8 B;  3UT9 A;  2HUE C;  4JJN C;  5CPJ D;  3NQJ B;  1AOI D;  3MGS B;  5AV5 D;  4R8P D;  1P3G C;  3WTP D;  1KX4 C;  2CV5 A;  3VH6 W;  3UTA C;  3REJ D;  2IO5 B;  4X23 A;  3B0D C;  4HGA C;  3MGP A;  5B40 A;  1M19 A;  3UTB B;  5DNM A;  1P3M C;  1EQZ C;  5F99 B;  4XZQ A; 
#chains in the Genus database with same CATH topology
 3AZM A;  5KDM B;  3KWQ C;  3W96 A;  3KXB C;  3W99 D;  2L5A A;  4YS3 C;  4AWL B;  2NQB A;  1P34 C;  3B6F A;  5F99 B;  4KHA B;  5CPI C;  3AZL B;  1KX3 D;  3C1C C;  1BH8 A;  2HIO C;  5AVC B;  5AVB C;  2DQN C;  4KGC A;  5CP6 D;  5DNN C;  5B31 C;  3AZG A;  3AZE C;  1KX5 B;  3IP4 C;  4KGC D;  1P3O C;  3C1B C;  3UT9 B;  5B0Y C;  1P3B C;  2G5I C;  3W98 C;  3KUY D;  5B1L B;  3TU4 B;  1ZLA C;  2CV5 B;  3WA9 C;  3F6T A;  3X1T B;  4X23 B;  3MGQ C;  1M19 B;  5DNM B;  4Z66 D;  1Z2C B;  3LZ0 D;  3AZJ A;  3AZM B;  3B6G A;  5AV6 D;  2ZY4 A;  1S32 A;  3WKJ C;  3W96 B;  1P3I A;  3MGP D;  1M19 D;  5B40 D;  2NQB B;  3B6F B;  5B1M D;  1B6W A;  1Q9C A;  4XZQ D;  4YM6 B;  1ID3 B;  4WU8 C;  1BH8 B;  3MGS C;  2XD1 A;  5AVB A;  3AYW A;  4Z5T B;  3MVD D;  5B31 A;  2FJ7 D;  3AZG B;  2IO5 C;  3MGR A;  2UWX A;  3UTB C;  5F99 C;  2NZD A;  5B24 A;  5GT3 A;  3REK B;  3B0B A;  1P3O A;  1ULY A;  5GT0 D;  3C1B A;  3X1U D;  3LEL A;  2FFF B;  2YFV A;  3AZH D;  4KUD A;  5AY8 B;  3W97 D;  4ZBJ B;  3AN2 A;  1M1A D;  4AWL C;  4ZUX D;  1F66 A;  4JJN D;  1P3L A;  5AVC C;  5BO0 A;  3AZJ B;  3B6G B;  3UTA D;  1S32 B;  3WKJ A;  4WNN A;  1P3I B;  1P3P A;  1P3M D;  1EQZ D;  1KX5 C;  3UT9 C;  3REH B;  4J8X A;  3NQJ A;  3KWQ D;  5C3I B;  2F8N D;  3KXB D;  5B1L C;  4YS3 D;  3TU4 C;  3AYW B;  1P34 D;  5CPI D;  1JFI A;  2CV5 C;  3EPK A;  3H0R C;  5GXQ A;  3X1T C;  4X23 C;  3MGR B;  3C1C D;  1M19 C;  5BNX A;  1A7W A;  5DNM C;  3EPL A;  5AVB D;  2NZD B;  4XZQ C;  5B24 B;  5GT3 B;  4KUD B;  3LEL B;  3AZM C;  5B31 D;  3W96 C;  4WZS B;  5JA4 A;  3AN2 B;  2NQB C;  3B6F C;  3AZE D;  1P3F A;  5B0Z B;  3REI A;  1P3O D;  2BG1 A;  2Y2N A;  3C1B D;  1F66 B;  1B67 A;  5B0Y D;  3AZL A;  4KUD D;  1P3L B;  4G92 B;  3VH6 A;  2PYO A;  5AVC A;  3W98 D;  1HQ3 B;  5BO0 B;  3AN2 D;  4UUZ A;  4E45 A;  4Z5T C;  1ZLA D;  3O62 A;  3WA9 D;  3AZG C;  5BNV A;  4H9N A;  1P3P B;  2DF4 C;  1PZR A;  4H9Q B;  3REK C;  3AV2 A;  4J8X B;  3MNN A;  5AY8 C;  3WKJ D;  4ZBJ C;  5B1L A;  3TU4 A;  2ZY3 A;  5B33 B;  3WAA A;  5B31 G;  1JFI B;  4WU8 D;  5GXQ B;  1M18 B;  3X1T A;  3AV1 A;  4J8X D;  5BNX B;  3MGS D;  5CHL B;  3EPH A;  3REL B;  3AZJ C;  1W2E A;  3B6G C;  1S32 C;  4LD9 B;  1P3I C;  5JA4 B;  3LZ1 B;  3UTB D;  1P3F B;  4J8U B;  5F99 D;  3A6N A;  2Y2H A;  1ID3 A;  4YM6 A;  3REI B;  3REH C;  3AZF A;  5C3I C;  2PYO B;  1F1E A;  4UUZ B;  3AYW C;  4Z5T A;  3O62 B;  3REI D;  3AFA A;  5GSU A;  3AZL D;  4Z2M H;  5BNV B;  5B2I A;  4H9N B;  3MGR C;  1TAF A;  5AVC D;  2RVQ C;  2NZD C;  5B24 C;  3B0C W;  5GT3 C;  3REK A;  4KUD C;  3X1V A;  3LEL C;  3AV2 B;  3MNN B;  5AY8 A;  4H9S A;  3B0C T;  3AN2 C;  4H9R B;  3AZN A;  1KX5 D;  4NE5 A;  3WAA B;  5B0Z C;  2Y2P A;  1F66 C;  3UT9 D;  3X1S A;  3AV1 B;  3AV2 D;  5B32 A;  1P3L C;  4G92 C;  2Y2J A;  2W8S A;  4NFT A;  1HQ3 C;  5B1L D;  3TU4 D;  4WU9 A;  2Y2M A;  2CV5 D;  5AV8 B;  5CPK A;  3X1T D;  4X23 D;  3P5J B;  5DNM D;  1P3P C;  3A6N B;  1N1J A;  1P3K A;  3AZM D;  3FDD A;  3REH A;  5FUG B;  4J8X C;  3AZF B;  3W96 D;  2NQB D;  5E5A A;  3B6F D;  5B33 C;  4G91 B;  1ID3 D;  4YM6 D;  3AFA B;  5GSU B;  2ARO A;  4E44 A;  5GXQ C;  5B2I B;  1M18 C;  1TAF B;  2F2A C;  4UPK A;  1P3A B;  4Z5T D;  3REL C;  3LJA A;  3X1V B;  3AFA D;  3AZG D;  4DRA A;  1HTA A;  4LD9 C;  3LZ1 C;  3AZN B;  1P3F C;  4J8U C;  4XUJ B;  5B0Z A;  3REI C;  3REK D;  3AZL C;  3X1S B;  1KU5 A;  1U35 A;  5B32 B;  5AY8 D;  2PYO C;  1HQ3 A;  5AV9 A;  4WU9 B;  3O62 C;  5CPK B;  4EO5 B;  2LY8 A;  1N1J B;  2J8P A;  2ZY2 A;  4H9Q A;  4Z2M G;  1P3K B;  3AZJ D;  3AV2 C;  3B6G D;  3MNN C;  1S32 D;  1P3I D;  4NE6 A;  4QLC A;  5E5A B;  5B33 A;  1KX4 B;  3WAA C;  2ARO B;  1TZY A;  3AZK A;  4J8V A;  3REH D;  3AV1 C;  1M18 A;  1R4V A;  1BFM A;  3AYW D;  2XD5 A;  1BH9 A;  3REL A;  3LJA B;  5CPJ A;  4NE3 A;  1AOI A;  5AV8 C;  4LD9 A;  3MGR D;  4R8P A;  3LZ1 A;  2RVQ D;  3WTP A;  4J8U A;  3A6N C;  5B24 D;  1ID3 C;  5GT3 D;  4YM6 C;  2NZD D;  3LJA D;  3LEL D;  1U35 B;  3AZF C;  5G49 B;  5JRG B;  2BYM A;  5AV9 B;  4G91 C;  5B0Z D;  3AFA C;  5GSU C;  1F66 D;  3V9R A;  5B2I C;  3W99 A;  1U35 D;  1P3L D;  3WTP E;  1HQ3 D;  1P3A C;  2VQR A;  3X1V C;  1KX3 A;  4J8W A;  5BS7 A;  4H9S C;  4QLC B;  4H9R A;  1P3P D;  5CP6 A;  3AZN C;  4XUJ C;  1TZY B;  3MGQ B;  4J8V B;  4DQY B;  3AZK B;  3X1S C;  5B32 C;  2Y2Q A;  5B33 D;  1BH9 B;  4WU9 C;  5CPJ B;  1AOI B;  4H9P A;  5AV8 A;  5GXQ D;  5CPK C;  1M18 D;  3KUY A;  5AV5 B;  4R8P B;  4EO5 C;  3WTP B;  3REJ B;  1P3K C;  3REL D;  1WWS A;  5FUG A;  4Z66 A;  4LD9 D;  3LZ1 D;  2BYM B;  5E5A C;  1P3F D;  2ZY5 A;  3LZ0 A;  4J8U D;  5BT1 D;  5AV6 A;  2ARO C;  3V9R B;  5B2J A;  3W99 B;  3R45 A;  2PYO D;  5B1M A;  3NQU A;  1P3A A;  3LJA C;  3O62 D;  1KX3 B;  4J8W B;  3AZI A;  1H3O A;  2JE5 A;  5CP6 B;  3MVD A;  2FJ7 A;  4XUJ A;  4J8W D;  1U35 C;  3MNN D;  1WWI A;  2ZM5 A;  5JRG C;  5GT0 A;  5AV9 C;  3AZH A;  3X1U A;  3WAA D;  4H9P B;  2BYK A;  3W97 A;  3AV1 D;  3KUY B;  1M1A A;  4ZUX A;  2JSS A;  3KSY A;  4WJ3 C;  4JJN A;  5AV8 D;  4Z66 B;  4QLC C;  3VH5 A;  1P3G A;  3LZ0 B;  1KX4 A;  3A6N D;  2Y2I A;  3KFU G;  4M6B A;  5AV6 B;  3UTA A;  1TZY C;  5B2J B;  4J8V C;  3MGP B;  3AZK C;  2Y2O A;  3R45 B;  5B40 B;  3AZF D;  1P3M A;  1EQZ A;  5B1M B;  3NQU B;  4XZQ B;  4CSR A;  5CPJ C;  1AOI C;  3KWQ A;  3AZI B;  1H3O B;  5GSU D;  2F8N A;  3KXB A;  5B2J D;  5B2I D;  5AV5 C;  4YS3 A;  4R8P C;  1P34 A;  5CPI A;  3WTP C;  3MVD B;  2FJ7 B;  1P3A D;  5BT1 C;  3REJ C;  3X1V D;  3C1C A;  3AZI D;  3VH5 W;  2HIO A;  2F8N H;  5G49 A;  5JRG A;  1T3U A;  4KGC B;  5GT0 B;  3AZH B;  3AZN D;  3X1U B;  3VH5 T;  2YFW A;  5DNN A;  3H0L C;  4XUJ D;  2BYK B;  3W97 B;  3X1S D;  3W99 C;  1M1A B;  5B32 D;  4ZUX B;  3AZE A;  4H9O A;  2HUE B;  5B0Y A;  4WU9 D;  4JJN B;  1P3B A;  1KX3 C;  4J8W C;  5CPK D;  5BS7 C;  4DRB A;  3W98 A;  1P3G B;  1ZLA A;  5CP6 C;  3WA9 A;  3UTA B;  1P3K D;  3MGQ A;  3B0D B;  4HGA B;  1EQZ B;  1P3M B;  5E5A D;  4CSR B;  1P3G D;  1KX4 D;  4CAY A;  3KWQ B;  3H0M C;  2F8N B;  2ARO D;  3KXB B;  3KUY C;  3A1I A;  5AV5 A;  4YS3 B;  1P34 B;  5CPI B;  4WU8 A;  3REJ A;  4WV4 B;  5B32 G;  3C1C B;  2HIO B;  4Z66 C;  3MGS A;  5AVB B;  3LZ0 C;  2YFW B;  5DNN B;  5B31 B;  5AV6 C;  2Y2L A;  5B2J C;  2F8N K;  3MGP C;  5B40 C;  3UTB A;  2HIO D;  2Y2K A;  3AZE B;  5B1M C;  5JRG D;  5F99 A;  4H9O B;  1P3O B;  5AV9 D;  3C1B B;  5B0Y B;  1P3B B;  2YFV B;  5DNN D;  5KDM A;  3AZI C;  3W98 B;  1ZLA B;  4KHA A;  2RIQ A;  3MVD C;  3WA9 B;  2FJ7 C;  1P3B D;  2Y2G A;  2CWE A;  4QLC D;  4KGC C;  3A1K A;  5GT0 C;  3AZH C;  3X1U C;  4CAY B;  2G5H C;  2F8N G;  3WKJ B;  3W97 C;  1TZY D;  4WNN B;  3MGQ D;  4J8V D;  3AZK D;  1M1A C;  4ZUX C;  1KX5 A;  3EPJ A;  4WU8 B;  2JCH A;  3UT9 A;  2HUE C;  4JJN C;  5CPJ D;  3NQJ B;  1AOI D;  3AL0 C;  3MGS B;  5AV5 D;  4R8P D;  3EG5 B;  1P3G C;  3WTP D;  1KX4 C;  2CV5 A;  3VH6 W;  3UTA C;  3REJ D;  2IO5 B;  4X23 A;  3B0D C;  4HGA C;  3MGP A;  5B40 A;  1M19 A;  3UTB B;  5DNM A;  1P3M C;  1EQZ C;  3VH6 T;  4XZQ A; 
#chains in the Genus database with same CATH homology
 3AZM A;  5KDM B;  3KWQ C;  3W96 A;  3KXB C;  3W99 D;  2L5A A;  4YS3 C;  4AWL B;  2NQB A;  1P34 C;  3B6F A;  5F99 B;  4KHA B;  5CPI C;  3AZL B;  1KX3 D;  3C1C C;  1BH8 A;  2HIO C;  5AVC B;  5AVB C;  2DQN C;  4KGC A;  5CP6 D;  5DNN C;  5B31 C;  3AZG A;  3AZE C;  1KX5 B;  3IP4 C;  4KGC D;  1P3O C;  3C1B C;  3UT9 B;  5B0Y C;  1P3B C;  2G5I C;  3W98 C;  3KUY D;  5B1L B;  3TU4 B;  1ZLA C;  2CV5 B;  3WA9 C;  3F6T A;  3X1T B;  4X23 B;  3MGQ C;  1M19 B;  5DNM B;  4Z66 D;  1Z2C B;  3LZ0 D;  3AZJ A;  3AZM B;  3B6G A;  5AV6 D;  2ZY4 A;  1S32 A;  3WKJ C;  3W96 B;  1P3I A;  3MGP D;  1M19 D;  5B40 D;  2NQB B;  3B6F B;  5B1M D;  1B6W A;  1Q9C A;  4XZQ D;  4YM6 B;  1ID3 B;  4WU8 C;  1BH8 B;  3MGS C;  2XD1 A;  5AVB A;  3AYW A;  4Z5T B;  3MVD D;  5B31 A;  2FJ7 D;  3AZG B;  2IO5 C;  3MGR A;  2UWX A;  3UTB C;  5F99 C;  2NZD A;  5B24 A;  5GT3 A;  3REK B;  3B0B A;  1P3O A;  1ULY A;  5GT0 D;  3C1B A;  3X1U D;  3LEL A;  2FFF B;  2YFV A;  3AZH D;  4KUD A;  5AY8 B;  3W97 D;  4ZBJ B;  3AN2 A;  1M1A D;  4AWL C;  4ZUX D;  1F66 A;  4JJN D;  1P3L A;  5AVC C;  5BO0 A;  3AZJ B;  3B6G B;  3UTA D;  1S32 B;  3WKJ A;  4WNN A;  1P3I B;  1P3P A;  1P3M D;  1EQZ D;  1KX5 C;  3UT9 C;  3REH B;  4J8X A;  3NQJ A;  3KWQ D;  5C3I B;  2F8N D;  3KXB D;  5B1L C;  4YS3 D;  3TU4 C;  3AYW B;  1P34 D;  5CPI D;  1JFI A;  2CV5 C;  3EPK A;  3H0R C;  5GXQ A;  3X1T C;  4X23 C;  3MGR B;  3C1C D;  1M19 C;  5BNX A;  1A7W A;  5DNM C;  3EPL A;  5AVB D;  2NZD B;  4XZQ C;  5B24 B;  5GT3 B;  4KUD B;  3LEL B;  3AZM C;  5B31 D;  3W96 C;  4WZS B;  5JA4 A;  3AN2 B;  2NQB C;  3B6F C;  3AZE D;  1P3F A;  5B0Z B;  3REI A;  1P3O D;  2BG1 A;  2Y2N A;  3C1B D;  1F66 B;  1B67 A;  5B0Y D;  3AZL A;  4KUD D;  1P3L B;  4G92 B;  3VH6 A;  2PYO A;  5AVC A;  3W98 D;  1HQ3 B;  5BO0 B;  3AN2 D;  4UUZ A;  4E45 A;  4Z5T C;  1ZLA D;  3O62 A;  3WA9 D;  3AZG C;  5BNV A;  4H9N A;  1P3P B;  2DF4 C;  1PZR A;  4H9Q B;  3REK C;  3AV2 A;  4J8X B;  3MNN A;  5AY8 C;  3WKJ D;  4ZBJ C;  5B1L A;  3TU4 A;  2ZY3 A;  5B33 B;  3WAA A;  5B31 G;  1JFI B;  4WU8 D;  5GXQ B;  1M18 B;  3X1T A;  3AV1 A;  4J8X D;  5BNX B;  3MGS D;  5CHL B;  3EPH A;  3REL B;  3AZJ C;  1W2E A;  3B6G C;  1S32 C;  4LD9 B;  1P3I C;  5JA4 B;  3LZ1 B;  3UTB D;  1P3F B;  4J8U B;  5F99 D;  3A6N A;  2Y2H A;  1ID3 A;  4YM6 A;  3REI B;  3REH C;  3AZF A;  5C3I C;  2PYO B;  1F1E A;  4UUZ B;  3AYW C;  4Z5T A;  3O62 B;  3REI D;  3AFA A;  5GSU A;  3AZL D;  4Z2M H;  5BNV B;  5B2I A;  4H9N B;  3MGR C;  1TAF A;  5AVC D;  2RVQ C;  2NZD C;  5B24 C;  3B0C W;  5GT3 C;  3REK A;  4KUD C;  3X1V A;  3LEL C;  3AV2 B;  3MNN B;  5AY8 A;  4H9S A;  3B0C T;  3AN2 C;  4H9R B;  3AZN A;  1KX5 D;  4NE5 A;  3WAA B;  5B0Z C;  2Y2P A;  1F66 C;  3UT9 D;  3X1S A;  3AV1 B;  3AV2 D;  5B32 A;  1P3L C;  4G92 C;  2Y2J A;  2W8S A;  4NFT A;  1HQ3 C;  5B1L D;  3TU4 D;  4WU9 A;  2Y2M A;  2CV5 D;  5AV8 B;  5CPK A;  3X1T D;  4X23 D;  3P5J B;  5DNM D;  1P3P C;  3A6N B;  1N1J A;  1P3K A;  3AZM D;  3FDD A;  3REH A;  5FUG B;  4J8X C;  3AZF B;  3W96 D;  2NQB D;  5E5A A;  3B6F D;  5B33 C;  4G91 B;  1ID3 D;  4YM6 D;  3AFA B;  5GSU B;  2ARO A;  4E44 A;  5GXQ C;  5B2I B;  1M18 C;  1TAF B;  2F2A C;  4UPK A;  1P3A B;  4Z5T D;  3REL C;  3LJA A;  3X1V B;  3AFA D;  3AZG D;  4DRA A;  1HTA A;  4LD9 C;  3LZ1 C;  3AZN B;  1P3F C;  4J8U C;  4XUJ B;  5B0Z A;  3REI C;  3REK D;  3AZL C;  3X1S B;  1KU5 A;  1U35 A;  5B32 B;  5AY8 D;  2PYO C;  1HQ3 A;  5AV9 A;  4WU9 B;  3O62 C;  5CPK B;  4EO5 B;  2LY8 A;  1N1J B;  2J8P A;  2ZY2 A;  4H9Q A;  4Z2M G;  1P3K B;  3AZJ D;  3AV2 C;  3B6G D;  3MNN C;  1S32 D;  1P3I D;  4NE6 A;  4QLC A;  5E5A B;  5B33 A;  1KX4 B;  3WAA C;  2ARO B;  1TZY A;  3AZK A;  4J8V A;  3REH D;  3AV1 C;  1M18 A;  1R4V A;  1BFM A;  3AYW D;  2XD5 A;  1BH9 A;  3REL A;  3LJA B;  5CPJ A;  4NE3 A;  1AOI A;  5AV8 C;  4LD9 A;  3MGR D;  4R8P A;  3LZ1 A;  2RVQ D;  3WTP A;  4J8U A;  3A6N C;  5B24 D;  1ID3 C;  5GT3 D;  4YM6 C;  2NZD D;  3LJA D;  3LEL D;  1U35 B;  3AZF C;  5G49 B;  5JRG B;  2BYM A;  5AV9 B;  4G91 C;  5B0Z D;  3AFA C;  5GSU C;  1F66 D;  3V9R A;  5B2I C;  3W99 A;  1U35 D;  1P3L D;  3WTP E;  1HQ3 D;  1P3A C;  2VQR A;  3X1V C;  1KX3 A;  4J8W A;  5BS7 A;  4H9S C;  4QLC B;  4H9R A;  1P3P D;  5CP6 A;  3AZN C;  4XUJ C;  1TZY B;  3MGQ B;  4J8V B;  4DQY B;  3AZK B;  3X1S C;  5B32 C;  2Y2Q A;  5B33 D;  1BH9 B;  4WU9 C;  5CPJ B;  1AOI B;  4H9P A;  5AV8 A;  5GXQ D;  5CPK C;  1M18 D;  3KUY A;  5AV5 B;  4R8P B;  4EO5 C;  3WTP B;  3REJ B;  1P3K C;  3REL D;  1WWS A;  5FUG A;  4Z66 A;  4LD9 D;  3LZ1 D;  2BYM B;  5E5A C;  1P3F D;  2ZY5 A;  3LZ0 A;  4J8U D;  5BT1 D;  5AV6 A;  2ARO C;  3V9R B;  5B2J A;  3W99 B;  3R45 A;  2PYO D;  5B1M A;  3NQU A;  1P3A A;  3LJA C;  3O62 D;  1KX3 B;  4J8W B;  3AZI A;  1H3O A;  2JE5 A;  5CP6 B;  3MVD A;  2FJ7 A;  4XUJ A;  4J8W D;  1U35 C;  3MNN D;  1WWI A;  2ZM5 A;  5JRG C;  5GT0 A;  5AV9 C;  3AZH A;  3X1U A;  3WAA D;  4H9P B;  2BYK A;  3W97 A;  3AV1 D;  3KUY B;  1M1A A;  4ZUX A;  2JSS A;  3KSY A;  4WJ3 C;  4JJN A;  5AV8 D;  4Z66 B;  4QLC C;  3VH5 A;  1P3G A;  3LZ0 B;  1KX4 A;  3A6N D;  2Y2I A;  3KFU G;  4M6B A;  5AV6 B;  3UTA A;  1TZY C;  5B2J B;  4J8V C;  3MGP B;  3AZK C;  2Y2O A;  3R45 B;  5B40 B;  3AZF D;  1P3M A;  1EQZ A;  5B1M B;  3NQU B;  4XZQ B;  4CSR A;  5CPJ C;  1AOI C;  3KWQ A;  3AZI B;  1H3O B;  5GSU D;  2F8N A;  3KXB A;  5B2J D;  5B2I D;  5AV5 C;  4YS3 A;  4R8P C;  1P34 A;  5CPI A;  3WTP C;  3MVD B;  2FJ7 B;  1P3A D;  5BT1 C;  3REJ C;  3X1V D;  3C1C A;  3AZI D;  3VH5 W;  2HIO A;  2F8N H;  5G49 A;  5JRG A;  1T3U A;  4KGC B;  5GT0 B;  3AZH B;  3AZN D;  3X1U B;  3VH5 T;  2YFW A;  5DNN A;  3H0L C;  4XUJ D;  2BYK B;  3W97 B;  3X1S D;  3W99 C;  1M1A B;  5B32 D;  4ZUX B;  3AZE A;  4H9O A;  2HUE B;  5B0Y A;  4WU9 D;  4JJN B;  1P3B A;  1KX3 C;  4J8W C;  5CPK D;  5BS7 C;  4DRB A;  3W98 A;  1P3G B;  1ZLA A;  5CP6 C;  3WA9 A;  3UTA B;  1P3K D;  3MGQ A;  3B0D B;  4HGA B;  1EQZ B;  1P3M B;  5E5A D;  4CSR B;  1P3G D;  1KX4 D;  4CAY A;  3KWQ B;  3H0M C;  2F8N B;  2ARO D;  3KXB B;  3KUY C;  3A1I A;  5AV5 A;  4YS3 B;  1P34 B;  5CPI B;  4WU8 A;  3REJ A;  4WV4 B;  5B32 G;  3C1C B;  2HIO B;  4Z66 C;  3MGS A;  5AVB B;  3LZ0 C;  2YFW B;  5DNN B;  5B31 B;  5AV6 C;  2Y2L A;  5B2J C;  2F8N K;  3MGP C;  5B40 C;  3UTB A;  2HIO D;  2Y2K A;  3AZE B;  5B1M C;  5JRG D;  5F99 A;  4H9O B;  1P3O B;  5AV9 D;  3C1B B;  5B0Y B;  1P3B B;  2YFV B;  5DNN D;  5KDM A;  3AZI C;  3W98 B;  1ZLA B;  4KHA A;  2RIQ A;  3MVD C;  3WA9 B;  2FJ7 C;  1P3B D;  2Y2G A;  2CWE A;  4QLC D;  4KGC C;  3A1K A;  5GT0 C;  3AZH C;  3X1U C;  4CAY B;  2G5H C;  2F8N G;  3WKJ B;  3W97 C;  1TZY D;  4WNN B;  3MGQ D;  4J8V D;  3AZK D;  1M1A C;  4ZUX C;  1KX5 A;  3EPJ A;  4WU8 B;  2JCH A;  3UT9 A;  2HUE C;  4JJN C;  5CPJ D;  3NQJ B;  1AOI D;  3AL0 C;  3MGS B;  5AV5 D;  4R8P D;  3EG5 B;  1P3G C;  3WTP D;  1KX4 C;  2CV5 A;  3VH6 W;  3UTA C;  3REJ D;  2IO5 B;  4X23 A;  3B0D C;  4HGA C;  3MGP A;  5B40 A;  1M19 A;  3UTB B;  5DNM A;  1P3M C;  1EQZ C;  3VH6 T;  4XZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...