3REHB

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehB00
3AZFC 4QLCB 4X23A 3O62D 3NQJA 3O62C 5B0ZA 3C1BD 3W97B 3WA9A 1ID3A 3AZJB 3X1VD 3WTPB 1P3FD 3X1VC 3AFAD 1P3FC 3UTAA 3AFAC 1U35D 3UTBB 5JA4A 1U35C 3WKJA 2YFWA 1P3ID 5B40A 3C1BB 3UTAC 1P3IC 3NQUB 3VH5T 4JJND 3WKJD 4JJNC 3WKJC 3B6GB 3AZKB 3X1VB 1M1AB 3AZMB 4LD9A 5AV8D 1R4VA 3MNNB 1EQZB 5AV8C 1BH9A 4LD9D 2AROA 3LJAA 4KUDD 4LD9C 5B1MD 3KXBA 4G92B 4KUDC 3LELA 5B1MC 4NFTA 4AWLC 5BO0B 3LJAC 3AYWD 1P3LA 3AYWC 1P3KA 3R45B 3REIA 3X1UA 4ZBJC 3AZLD 4J8XA 1P3KD 3X1TD 3AZLC 5B0YB 4CAYB 1P3KC 3X1TC 1F1EA 3REIC 3AV1B 3AZND 5B31G 5DNMA 4Z66A 3AZNC 3B6FB 1P3PD 4ZUXD 5AVCA 3AYWB 4EO5C 1KX3A 1P3PC 4ZUXC 1KX3D 3AZIA 1P3OB 4DRAA 1M19A 4CSRB 1KX3C 3W99A 4J8UB 1P3MB 5GSUD 4H9RA 4H9SC 5GT0D 3LZ1D 3KUYD 1ZLAA 5GSUC 3KUYC 1P34B 5GT0C 3LZ1C 5B2IB 2IO5C 2CV5B 5AY8A 5KDMB 1TZYD 4Z5TA 4R8PB 3REHA 1TZYC 3MGRA 5AV5D 3MVDB 5B33D 5E5AD 3MGRD 5GT3D 5AV5C 5B33C 5E5AC 3MGRC 3WAAD 5GT3C 4YM6B 3AZHA 1BFMA 3WAAC 2NZDD 5AV6D 5AV9D 3V9RB 5B2JA 5B32G 5AV9C 5AV6C 2NZDC 3X1SD 3X1SC 3AN2D 2PYOA 3AN2C 2NQBD 2F8NH 2F8NG 2NQBC 5AV5B 4KGCA 5GT3B 4H9OA 1S32D 2PYOC 3AV2A 2JSSA 1S32C 4XZQA 5AV6B 1B67A 4G91C 3AZEB 2FJ7A 5CHLB 4E45A 3MGSD 3AN2B 3UT9A 1WWSA 3MGSC 2FJ7D 4E44A 1JFIA 5BNXB 5CPIB 1KX4D 2FJ7C 4UUZA 1HTAA 1KX4C 5B24D 5F99A 1KX5B 1S32B 5B24C 5JRGB 1KU5A 1P3AA 1P3GB 3KWQB 5G49A 3W98D 5DNND 3W98C 5DNNC 1P3AD 3MGSB 4QLCA 1P3AC 1WWIA 1KX4B 5B24B 4X23D 3AZJA 4X23C 1M18A 5B0ZD 1F66A 3WA9D 3AZFB 3WTPA 5B0ZC 3WA9C 1ID3D 2YFVA 4NE5A 5C3IC 1M18D 1ID3C 1M18C 1F66C 4DRBA 5CPJA 3AZGA 4H9NA 3O62B 3UTAD 3MGPA 4J8VA 4X23B 1AOIA 5CPJC 5B40D 2BYKB 3W96A 3WA9B 5B40C 3AZKA 5C3IB 1M1AA 4J8VC 1P3FB 3AZMA 3AFAB 3W96D 3VH6A 3W96C 3MNNA 1U35B 1EQZA 3LZ0A 4KHAB 5CP6A 3UTAB 1P3IB 5JA4B 4JJNB 3WKJB 2AROD 5CP6C 3LJAD 4WU8A 3KXBD 2AROC 4J8WA 3LELD 3KXBC 3C1CA 3LELC 1P3LD 1A7WA 5AV8B 5GXQA 5B31A 5CPKA 1P3LC 3B0CW 4LD9B 5B0YA 3VH6W 5AVBA 3REID 3X1UD 4KUDB 5B31D 5B1MB 4J8XD 3X1UC 3AV1A 5B31C 1BH9B 4AWLB 4YS3A 2HUEC 4J8XC 5AVBD 3LJAB 3B6FA 5AVBC 4YS3D 3LELB 4WNNA 5DNMD 4YS3C 4Z66D 4ZBJB 5DNMC 5AVCD 4Z66C 1P3LB 1P3OA 5AVCC 4CSRA 2HIOA 3AZLB 1P3KB 3X1TB 4J8UA 3REIB 3X1UB 3AZID 1M19D 2F8NK 2HUEB 4WZSB 3W99D 1P34A 3AZIC 4H9PB 1M19C 3AZNB 3W99C 5B2IA 2CV5A 4EO5B 3REJA 4R8PA 1P3PB 4ZUXB 1ZLAD 3KSYA 1ZLAC 4Z66B 5AY8D 5B32A 4Z5TD 3MVDA 5AY8C 3REHD 1TAFA 4Z5TC 5FUGA 3REJC 1KX3B 3REHC 3RELA 5B32D 4WV4B 3WTPE 1P3BA 5B32C 1H3OB 5GSUB 3KUYB 5GT0B 3V9RA 3LZ1B 1M19B 2F8NA 3A6NA 2IO5B 3AZHD 1N1JB 3AZHC 4H9RB 1TZYB 4WU9A 2F8ND 1P3BC 5B2JD 3A6ND 1ZLAB 5B2JC 3A6NC 5B33B 5E5AB 2PYOD 3MGRB 4WU9C 3WAAB 4KGCD 4H9QA 5AV9B 3REKA 3AZEA 2NZDB 4KGCC 3AV2D 3X1SB 2BYMA 3AV2C 4XZQD 4NE6A 1HQ3A 4XZQC 5BNXA 5CPIA 2NQBB 3MGQA 3UT9D 2LY8A 1BH8B 3TU4A 1KX5A 2PYOB 3UT9C 1HQ3C 5JRGA 4XUJA 5BNVB 4G91B 5B1LA 3MGQC 3KWQA 1P3GA 3TU4D 5F99D 3VH5A 4H9OB 4XUJD 3TU4C 5F99C 4XUJC 2FJ7B 4Z2MG 4Z2MH 4QLCD 3W97A 4QLCC 1JFIB 5BT1C 3AZFA 4HGAC 5F99B 3W98B 5DNNB 3AZJD 1F66D 1P3AB 3AZJC 3WTPD 3UTBA 5G49B 3VH5W 5BS7A 3WTPC 3O62A 3UTBD 3C1BA 3UTBC 3NQUA 5CPJD 3AZGD 5BS7C 3NQJB 2BYKA 3AZGC 3MGPD 5B0ZB 4HGAB 3B6GA 4J8VD 3X1VA 3MGPC 3C1BC 4NE3A 1P3FA 1ID3B 1AOID 3AFAA 1M18B 1AOIC 1F66B 3B6GD 3AZKD 1U35A 4M6BA 1M1AD 3B6GC 3AZKC 2YFVB 3AZMD 4KHAA 1M1AC 1P3IA 3AZMC 3MNND 1EQZD 3LZ0D 3MNNC 5CPJB 3AZGB 4JJNA 1EQZC 5CP6D 4H9NB 3LZ0C 2YFWB 5B40B 5BO0A 3MGPB 4J8VB 4G92C 1AOIB 3W96B 4WU8D 3R45A 5AV8A 4J8WD 4WU8C 4J8WC 3C1CD 4CAYA 3C1CC 4KUDA 5GXQD 5B1MA 5CPKD 3LZ0B 5GXQC 5CPKC 5CP6B 5B0YD 1Q9CA 2AROB 5B0YC 1ULYA 3AYWA 3KXBB 3AV1D 3AV1C 3B6FD 4WU8B 4J8WB 3B6FC 3AZLA 3C1CB 3X1TA 1B6WA 1P3MA 5GXQB 1P3OD 5B31B 5CPKB 2HIOD 4J8XB 1P3OC 4H9PA 3AZNA 2HIOC 5AVBB 4J8UD 1P3MD 5KDMA 1P3PA 4ZUXA 4J8UC 2RVQD 1P3MC 1P34D 4YS3B 2RVQC 3B0CT 1P34C 5B2ID 2L5AA 2CV5D 5DNMB 3VH6T 3REJD 5B2IC 4R8PD 2CV5C 5AVCB 4R8PC 4WNNB 4YM6A 4H9SA 3MVDD 1H3OA 5GSUA 3KUYA 5GT0A 3LZ1A 3MVDC 3AZIB 2HIOB 3RELD 3W99B 4YM6D 3RELC 1N1JA 1P3BD 4YM6C 1TZYA 3B0DC 5AY8B 3REJB 4Z5TB 5AV5A 4WU9D 5B33A 5E5AA 3REHB 5GT3A 3WAAA 5B32B 3B0BA 2NZDA 5AV6A 5AV9A 1TAFB 5FUGB 3RELB 3X1SA 3AZHB 3B0DB 1P3BB 3AZED 3REKD 3AN2A 2F8NB 5B2JB 3A6NB 3AZEC 3REKC 2NQBA 4WU9B 1HQ3D 1BH8A 5CPID 1S32A 3MGQD 5BNVA 5CPIC 1KX5D 4KGCB 5JRGD 1KX5C 3AV2B 5JRGC 5B1LD 3MGSA 3KWQD 1P3GD 4XZQB 4H9QB 5B1LC 3REKB 1P3GC 3KWQC 2CWEA 1KX4A 2BYMB 3UT9B 1HQ3B 5B24A 5BT1D 3MGQB 4UUZB 3W97D 3W97C 3W98A 3TU4B 5DNNA 4XUJB 3AZFD 5B1LB
chains in the Genus database with same CATH superfamily
3AZFC 4QLCB 4X23A 3O62D 3NQJA 3O62C 5B0ZA 3C1BD 3W97B 3WA9A 1ID3A 3AZJB 4WJ3C 3X1VD 3WTPB 1P3FD 3X1VC 3AFAD 1P3FC 3UTAA 3AFAC 1U35D 3UTBB 5JA4A 1U35C 3WKJA 2YFWA 1P3ID 5B40A 3C1BB 3UTAC 1P3IC 3NQUB 3VH5T 4JJND 3WKJD 4JJNC 3WKJC 3EPKA 3B6GB 3AZKB 3X1VB 1M1AB 3AZMB 4LD9A 5AV8D 1R4VA 3MNNB 2FFFB 1EQZB 5AV8C 1BH9A 4LD9D 2AROA 3LJAA 4KUDD 4LD9C 2VQRA 5B1MD 3KXBA 4G92B 4KUDC 3LELA 5B1MC 4NFTA 4AWLC 5BO0B 3LJAC 3AYWD 1P3LA 3AYWC 1P3KA 3R45B 2Y2JA 3REIA 3X1UA 4ZBJC 3AZLD 4J8XA 2BG1A 1P3KD 3X1TD 3AZLC 5B0YB 4CAYB 1P3KC 3X1TC 1F1EA 3REIC 3AV1B 2G5HC 3AZND 5B31G 5DNMA 4Z66A 3AZNC 3B6FB 1P3PD 4ZUXD 5AVCA 3AYWB 4EO5C 1KX3A 1P3PC 4ZUXC 3F6TA 1KX3D 3AZIA 1P3OB 4DRAA 1M19A 4CSRB 1KX3C 3W99A 4J8UB 1P3MB 5GSUD 4H9RA 4H9SC 5GT0D 3LZ1D 3KUYD 1ZLAA 5GSUC 3KUYC 1P34B 5GT0C 3LZ1C 5B2IB 2IO5C 2CV5B 5AY8A 5KDMB 1TZYD 4Z5TA 4R8PB 3REHA 1TZYC 3MGRA 1T3UA 5AV5D 3MVDB 5B33D 5E5AD 3MGRD 5GT3D 5AV5C 2ZY2A 5B33C 5E5AC 3MGRC 3WAAD 5GT3C 4YM6B 3AZHA 1BFMA 3WAAC 2NZDD 5AV6D 5AV9D 3V9RB 5B2JA 5B32G 5AV9C 5AV6C 2NZDC 3X1SD 3AL0C 3X1SC 3AN2D 2PYOA 3AN2C 2NQBD 2F8NH 2F8NG 2NQBC 5AV5B 4KGCA 2ZY5A 5GT3B 4H9OA 1S32D 3H0MC 2PYOC 3AV2A 2JSSA 1S32C 4XZQA 5AV6B 1B67A 4G91C 3AZEB 2FJ7A 5CHLB 4E45A 3MGSD 3AN2B 3UT9A 1WWSA 3MGSC 2FJ7D 4E44A 1JFIA 5BNXB 5CPIB 1KX4D 2FJ7C 4UUZA 1HTAA 2Y2PA 1KX4C 5B24D 5F99A 1KX5B 1S32B 5B24C 5JRGB 3A1KA 2DQNC 1KU5A 1P3AA 1P3GB 3KWQB 5G49A 3W98D 5DNND 2JCHA 3W98C 5DNNC 1P3AD 3MGSB 2XD5A 4QLCA 1P3AC 1WWIA 3KFUG 1KX4B 2G5IC 5B24B 4X23D 3AZJA 4X23C 1M18A 5B0ZD 1F66A 3WA9D 1Z2CB 3WTPA 3AZFB 5B0ZC 2Y2MA 3WA9C 1ID3D 2YFVA 4NE5A 5C3IC 1M18D 1ID3C 1M18C 1F66C 4DRBA 5CPJA 3AZGA 4H9NA 3O62B 3UTAD 3MGPA 4DQYB 4J8VA 4X23B 1AOIA 5CPJC 5B40D 2BYKB 3IP4C 3W96A 3WA9B 5B40C 3AZKA 5C3IB 1M1AA 4J8VC 1P3FB 3AZMA 3AFAB 3W96D 3VH6A 3W96C 3MNNA 1U35B 1EQZA 3LZ0A 4KHAB 5CP6A 3UTAB 1P3IB 5JA4B 4JJNB 3WKJB 2AROD 5CP6C 3LJAD 4WU8A 3KXBD 2AROC 4J8WA 3LELD 3KXBC 2UWXA 3LELC 3C1CA 1P3LD 1A7WA 5AV8B 5GXQA 5B31A 5CPKA 1P3LC 3B0CW 4LD9B 5B0YA 3VH6W 5AVBA 3REID 3X1UD 4KUDB 5B31D 5B1MB 4J8XD 3X1UC 3AV1A 5B31C 1BH9B 4AWLB 4YS3A 2HUEC 4J8XC 5AVBD 3LJAB 3B6FA 5AVBC 4YS3D 3LELB 4WNNA 5DNMD 4YS3C 4Z66D 4ZBJB 5DNMC 5AVCD 4Z66C 1P3LB 1P3OA 5AVCC 4CSRA 2HIOA 3AZLB 2J8PA 1P3KB 3X1TB 4J8UA 3EG5B 3H0RC 3X1UB 3H0LC 3REIB 3AZID 1M19D 2F8NK 2HUEB 4WZSB 3W99D 1P34A 3AZIC 4H9PB 3P5JB 1M19C 3AZNB 3W99C 5B2IA 2CV5A 2RIQA 4EO5B 3REJA 4R8PA 1P3PB 4ZUXB 1ZLAD 3KSYA 1ZLAC 4Z66B 5AY8D 5B32A 4Z5TD 3MVDA 5AY8C 3REHD 1TAFA 4Z5TC 5FUGA 3REJC 1KX3B 3REHC 3RELA 5B32D 4WV4B 3WTPE 1P3BA 5B32C 1H3OB 5GSUB 2Y2QA 5GT0B 3V9RA 3LZ1B 3KUYB 1M19B 3A6NA 2F8NA 2IO5B 3AZHD 1N1JB 3AZHC 4H9RB 1TZYB 4WU9A 2F8ND 1P3BC 5B2JD 3A6ND 1ZLAB 5B2JC 3A6NC 3EPLA 2ZY3A 3FDDA 5B33B 5E5AB 2PYOD 3MGRB 4WU9C 3WAAB 2W8SA 4KGCD 4H9QA 5AV9B 3REKA 3AZEA 2NZDB 4KGCC 3AV2D 2F2AC 3X1SB 2BYMA 3AV2C 4XZQD 4NE6A 1HQ3A 4XZQC 5BNXA 5CPIA 2NQBB 3MGQA 3UT9D 2LY8A 4UPKA 1BH8B 3TU4A 1KX5A 2PYOB 3UT9C 1HQ3C 5JRGA 4XUJA 5BNVB 4G91B 5B1LA 3MGQC 3KWQA 1P3GA 3TU4D 5F99D 3VH5A 4H9OB 4XUJD 3TU4C 5F99C 2Y2OA 4XUJC 2FJ7B 2Y2IA 4Z2MG 4Z2MH 4QLCD 3W97A 4QLCC 1JFIB 5BT1C 3AZFA 2JE5A 4HGAC 5F99B 3W98B 3EPJA 5DNNB 3AZJD 2Y2GA 1F66D 1P3AB 3AZJC 3WTPD 3UTBA 5G49B 3VH5W 5BS7A 3WTPC 3O62A 3UTBD 3C1BA 3UTBC 3NQUA 5CPJD 3AZGD 5BS7C 3NQJB 2BYKA 3AZGC 3MGPD 5B0ZB 4HGAB 3B6GA 4J8VD 3X1VA 3MGPC 3C1BC 4NE3A 1P3FA 1ID3B 1AOID 3AFAA 1M18B 1AOIC 1F66B 3B6GD 3AZKD 1U35A 4M6BA 1M1AD 3B6GC 2Y2HA 3AZKC 2YFVB 3AZMD 4KHAA 1M1AC 1P3IA 3AZMC 3MNND 1EQZD 3LZ0D 3MNNC 5CPJB 3AZGB 4JJNA 1EQZC 5CP6D 4H9NB 3LZ0C 2YFWB 5B40B 5BO0A 3MGPB 4J8VB 4G92C 1AOIB 3W96B 1PZRA 4WU8D 3R45A 5AV8A 4J8WD 3EPHA 2ZM5A 4WU8C 4J8WC 3C1CD 4CAYA 3C1CC 4KUDA 5GXQD 5B1MA 5CPKD 3LZ0B 5GXQC 5CPKC 5CP6B 5B0YD 1Q9CA 2AROB 5B0YC 2Y2KA 1ULYA 3AYWA 3KXBB 3AV1D 3AV1C 3B6FD 4WU8B 4J8WB 3B6FC 3AZLA 3C1CB 3X1TA 1B6WA 1P3MA 5GXQB 1P3OD 5B31B 5CPKB 2HIOD 4J8XB 1P3OC 4H9PA 3AZNA 2HIOC 5AVBB 4J8UD 1P3MD 2XD1A 5KDMA 1P3PA 4ZUXA 4J8UC 2RVQD 1P3MC 1P34D 4YS3B 2RVQC 3B0CT 2DF4C 5B2ID 2L5AA 2CV5D 5DNMB 1P34C 3VH6T 3REJD 5B2IC 4R8PD 2CV5C 5AVCB 4R8PC 4WNNB 4YM6A 4H9SA 3MVDD 1H3OA 5GSUA 3KUYA 5GT0A 3LZ1A 3MVDC 3AZIB 2HIOB 3RELD 3W99B 4YM6D 3A1IA 3RELC 1N1JA 1P3BD 4YM6C 1TZYA 3B0DC 5AY8B 3REJB 4Z5TB 5AV5A 4WU9D 5B33A 5E5AA 3REHB 5GT3A 3WAAA 2Y2LA 5B32B 3B0BA 2NZDA 5AV6A 5AV9A 1TAFB 5FUGB 3RELB 3X1SA 3AZHB 3B0DB 1P3BB 3AZED 3REKD 3AN2A 2F8NB 5B2JB 3A6NB 3AZEC 3REKC 2NQBA 4WU9B 1HQ3D 1BH8A 5CPID 1S32A 3MGQD 5BNVA 5CPIC 1KX5D 4KGCB 5JRGD 1KX5C 3AV2B 5JRGC 5B1LD 3MGSA 3KWQD 1P3GD 4XZQB 4H9QB 2ZY4A 5B1LC 3REKB 1P3GC 3KWQC 2Y2NA 2CWEA 1W2EA 1KX4A 2BYMB 3UT9B 1HQ3B 5B24A 5BT1D 3MGQB 4UUZB 3W97D 3W97C 3W98A 3TU4B 5DNNA 4XUJB 3AZFD 5B1LB
chains in the Genus database with same CATH topology
3AZFC 4QLCB 4X23A 3O62D 3NQJA 3O62C 5B0ZA 3C1BD 3W97B 3WA9A 1ID3A 3AZJB 4WJ3C 3X1VD 3WTPB 1P3FD 3X1VC 3AFAD 1P3FC 3UTAA 3AFAC 1U35D 3UTBB 5JA4A 1U35C 3WKJA 2YFWA 1P3ID 5B40A 3C1BB 3UTAC 1P3IC 3NQUB 3VH5T 4JJND 3WKJD 4JJNC 3WKJC 3EPKA 3B6GB 3AZKB 3X1VB 1M1AB 3AZMB 4LD9A 5AV8D 1R4VA 3MNNB 2FFFB 1EQZB 5AV8C 1BH9A 4LD9D 2AROA 3LJAA 4KUDD 4LD9C 2VQRA 5B1MD 3KXBA 4G92B 4KUDC 3LELA 5B1MC 4NFTA 4AWLC 5BO0B 3LJAC 3AYWD 1P3LA 3AYWC 1P3KA 3R45B 2Y2JA 3REIA 3X1UA 4ZBJC 3AZLD 4J8XA 2BG1A 1P3KD 3X1TD 3AZLC 5B0YB 4CAYB 1P3KC 3X1TC 1F1EA 3REIC 3AV1B 2G5HC 3AZND 5B31G 5DNMA 4Z66A 3AZNC 3B6FB 1P3PD 4ZUXD 5AVCA 3AYWB 4EO5C 1KX3A 1P3PC 4ZUXC 3F6TA 1KX3D 3AZIA 1P3OB 4DRAA 1M19A 4CSRB 1KX3C 3W99A 4J8UB 1P3MB 5GSUD 4H9RA 4H9SC 5GT0D 3LZ1D 3KUYD 1ZLAA 5GSUC 3KUYC 1P34B 5GT0C 3LZ1C 5B2IB 2IO5C 2CV5B 5AY8A 5KDMB 1TZYD 4Z5TA 4R8PB 3REHA 1TZYC 3MGRA 1T3UA 5AV5D 3MVDB 5B33D 5E5AD 3MGRD 5GT3D 5AV5C 2ZY2A 5B33C 5E5AC 3MGRC 3WAAD 5GT3C 4YM6B 3AZHA 1BFMA 3WAAC 2NZDD 5AV6D 5AV9D 3V9RB 5B2JA 5B32G 5AV9C 5AV6C 2NZDC 3X1SD 3AL0C 3X1SC 3AN2D 2PYOA 3AN2C 2NQBD 2F8NH 2F8NG 2NQBC 5AV5B 4KGCA 2ZY5A 5GT3B 4H9OA 1S32D 3H0MC 2PYOC 3AV2A 2JSSA 1S32C 4XZQA 5AV6B 1B67A 4G91C 3AZEB 2FJ7A 5CHLB 4E45A 3MGSD 3AN2B 3UT9A 1WWSA 3MGSC 2FJ7D 4E44A 1JFIA 5BNXB 5CPIB 1KX4D 2FJ7C 4UUZA 1HTAA 2Y2PA 1KX4C 5B24D 5F99A 1KX5B 1S32B 5B24C 5JRGB 3A1KA 2DQNC 1KU5A 1P3AA 1P3GB 3KWQB 5G49A 3W98D 5DNND 2JCHA 3W98C 5DNNC 1P3AD 3MGSB 2XD5A 4QLCA 1P3AC 1WWIA 3KFUG 1KX4B 2G5IC 5B24B 4X23D 3AZJA 4X23C 1M18A 5B0ZD 1F66A 3WA9D 1Z2CB 3WTPA 3AZFB 5B0ZC 2Y2MA 3WA9C 1ID3D 2YFVA 4NE5A 5C3IC 1M18D 1ID3C 1M18C 1F66C 4DRBA 5CPJA 3AZGA 4H9NA 3O62B 3UTAD 3MGPA 4DQYB 4J8VA 4X23B 1AOIA 5CPJC 5B40D 2BYKB 3IP4C 3W96A 3WA9B 5B40C 3AZKA 5C3IB 1M1AA 4J8VC 1P3FB 3AZMA 3AFAB 3W96D 3VH6A 3W96C 3MNNA 1U35B 1EQZA 3LZ0A 4KHAB 5CP6A 3UTAB 1P3IB 5JA4B 4JJNB 3WKJB 2AROD 5CP6C 3LJAD 4WU8A 3KXBD 2AROC 4J8WA 3LELD 3KXBC 2UWXA 3LELC 3C1CA 1P3LD 1A7WA 5AV8B 5GXQA 5B31A 5CPKA 1P3LC 3B0CW 4LD9B 5B0YA 3VH6W 5AVBA 3REID 3X1UD 4KUDB 5B31D 5B1MB 4J8XD 3X1UC 3AV1A 5B31C 1BH9B 4AWLB 4YS3A 2HUEC 4J8XC 5AVBD 3LJAB 3B6FA 5AVBC 4YS3D 3LELB 4WNNA 5DNMD 4YS3C 4Z66D 4ZBJB 5DNMC 5AVCD 4Z66C 1P3LB 1P3OA 5AVCC 4CSRA 2HIOA 3AZLB 2J8PA 1P3KB 3X1TB 4J8UA 3EG5B 3H0RC 3X1UB 3H0LC 3REIB 3AZID 1M19D 2F8NK 2HUEB 4WZSB 3W99D 1P34A 3AZIC 4H9PB 3P5JB 1M19C 3AZNB 3W99C 5B2IA 2CV5A 2RIQA 4EO5B 3REJA 4R8PA 1P3PB 4ZUXB 1ZLAD 3KSYA 1ZLAC 4Z66B 5AY8D 5B32A 4Z5TD 3MVDA 5AY8C 3REHD 1TAFA 4Z5TC 5FUGA 3REJC 1KX3B 3REHC 3RELA 5B32D 4WV4B 3WTPE 1P3BA 5B32C 1H3OB 5GSUB 2Y2QA 5GT0B 3V9RA 3LZ1B 3KUYB 1M19B 3A6NA 2F8NA 2IO5B 3AZHD 1N1JB 3AZHC 4H9RB 1TZYB 4WU9A 2F8ND 1P3BC 5B2JD 3A6ND 1ZLAB 5B2JC 3A6NC 3EPLA 2ZY3A 3FDDA 5B33B 5E5AB 2PYOD 3MGRB 4WU9C 3WAAB 2W8SA 4KGCD 4H9QA 5AV9B 3REKA 3AZEA 2NZDB 4KGCC 3AV2D 2F2AC 3X1SB 2BYMA 3AV2C 4XZQD 4NE6A 1HQ3A 4XZQC 5BNXA 5CPIA 2NQBB 3MGQA 3UT9D 2LY8A 4UPKA 1BH8B 3TU4A 1KX5A 2PYOB 3UT9C 1HQ3C 5JRGA 4XUJA 5BNVB 4G91B 5B1LA 3MGQC 3KWQA 1P3GA 3TU4D 5F99D 3VH5A 4H9OB 4XUJD 3TU4C 5F99C 2Y2OA 4XUJC 2FJ7B 2Y2IA 4Z2MG 4Z2MH 4QLCD 3W97A 4QLCC 1JFIB 5BT1C 3AZFA 2JE5A 4HGAC 5F99B 3W98B 3EPJA 5DNNB 3AZJD 2Y2GA 1F66D 1P3AB 3AZJC 3WTPD 3UTBA 5G49B 3VH5W 5BS7A 3WTPC 3O62A 3UTBD 3C1BA 3UTBC 3NQUA 5CPJD 3AZGD 5BS7C 3NQJB 2BYKA 3AZGC 3MGPD 5B0ZB 4HGAB 3B6GA 4J8VD 3X1VA 3MGPC 3C1BC 4NE3A 1P3FA 1ID3B 1AOID 3AFAA 1M18B 1AOIC 1F66B 3B6GD 3AZKD 1U35A 4M6BA 1M1AD 3B6GC 2Y2HA 3AZKC 2YFVB 3AZMD 4KHAA 1M1AC 1P3IA 3AZMC 3MNND 1EQZD 3LZ0D 3MNNC 5CPJB 3AZGB 4JJNA 1EQZC 5CP6D 4H9NB 3LZ0C 2YFWB 5B40B 5BO0A 3MGPB 4J8VB 4G92C 1AOIB 3W96B 1PZRA 4WU8D 3R45A 5AV8A 4J8WD 3EPHA 2ZM5A 4WU8C 4J8WC 3C1CD 4CAYA 3C1CC 4KUDA 5GXQD 5B1MA 5CPKD 3LZ0B 5GXQC 5CPKC 5CP6B 5B0YD 1Q9CA 2AROB 5B0YC 2Y2KA 1ULYA 3AYWA 3KXBB 3AV1D 3AV1C 3B6FD 4WU8B 4J8WB 3B6FC 3AZLA 3C1CB 3X1TA 1B6WA 1P3MA 5GXQB 1P3OD 5B31B 5CPKB 2HIOD 4J8XB 1P3OC 4H9PA 3AZNA 2HIOC 5AVBB 4J8UD 1P3MD 2XD1A 5KDMA 1P3PA 4ZUXA 4J8UC 2RVQD 1P3MC 1P34D 4YS3B 2RVQC 3B0CT 2DF4C 5B2ID 2L5AA 2CV5D 5DNMB 1P34C 3VH6T 3REJD 5B2IC 4R8PD 2CV5C 5AVCB 4R8PC 4WNNB 4YM6A 4H9SA 3MVDD 1H3OA 5GSUA 3KUYA 5GT0A 3LZ1A 3MVDC 3AZIB 2HIOB 3RELD 3W99B 4YM6D 3A1IA 3RELC 1N1JA 1P3BD 4YM6C 1TZYA 3B0DC 5AY8B 3REJB 4Z5TB 5AV5A 4WU9D 5B33A 5E5AA 3REHB 5GT3A 3WAAA 2Y2LA 5B32B 3B0BA 2NZDA 5AV6A 5AV9A 1TAFB 5FUGB 3RELB 3X1SA 3AZHB 3B0DB 1P3BB 3AZED 3REKD 3AN2A 2F8NB 5B2JB 3A6NB 3AZEC 3REKC 2NQBA 4WU9B 1HQ3D 1BH8A 5CPID 1S32A 3MGQD 5BNVA 5CPIC 1KX5D 4KGCB 5JRGD 1KX5C 3AV2B 5JRGC 5B1LD 3MGSA 3KWQD 1P3GD 4XZQB 4H9QB 2ZY4A 5B1LC 3REKB 1P3GC 3KWQC 2Y2NA 2CWEA 1W2EA 1KX4A 2BYMB 3UT9B 1HQ3B 5B24A 5BT1D 3MGQB 4UUZB 3W97D 3W97C 3W98A 3TU4B 5DNNA 4XUJB 3AZFD 5B1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF C;  4QLC B;  4X23 A;  3O62 D;  3NQJ A;  3O62 C;  5B0Z A;  3C1B D;  3W97 B;  3WA9 A;  1ID3 A;  3AZJ B;  3X1V D;  3WTP B;  1P3F D;  3X1V C;  3AFA D;  1P3F C;  3UTA A;  3AFA C;  1U35 D;  3UTB B;  5JA4 A;  1U35 C;  3WKJ A;  2YFW A;  1P3I D;  5B40 A;  3C1B B;  3UTA C;  1P3I C;  3NQU B;  3VH5 T;  4JJN D;  3WKJ D;  4JJN C;  3WKJ C;  3B6G B;  3AZK B;  3X1V B;  1M1A B;  3AZM B;  4LD9 A;  5AV8 D;  1R4V A;  3MNN B;  1EQZ B;  5AV8 C;  1BH9 A;  4LD9 D;  2ARO A;  3LJA A;  4KUD D;  4LD9 C;  5B1M D;  3KXB A;  4G92 B;  4KUD C;  3LEL A;  5B1M C;  4NFT A;  4AWL C;  5BO0 B;  3LJA C;  3AYW D;  1P3L A;  3AYW C;  1P3K A;  3R45 B;  3REI A;  3X1U A;  4ZBJ C;  3AZL D;  4J8X A;  1P3K D;  3X1T D;  3AZL C;  5B0Y B;  4CAY B;  1P3K C;  3X1T C;  1F1E A;  3REI C;  3AV1 B;  3AZN D;  5B31 G;  5DNM A;  4Z66 A;  3AZN C;  3B6F B;  1P3P D;  4ZUX D;  5AVC A;  3AYW B;  4EO5 C;  1KX3 A;  1P3P C;  4ZUX C;  1KX3 D;  3AZI A;  1P3O B;  4DRA A;  1M19 A;  4CSR B;  1KX3 C;  3W99 A;  4J8U B;  1P3M B;  5GSU D;  4H9R A;  4H9S C;  5GT0 D;  3LZ1 D;  3KUY D;  1ZLA A;  5GSU C;  3KUY C;  1P34 B;  5GT0 C;  3LZ1 C;  5B2I B;  2IO5 C;  2CV5 B;  5AY8 A;  5KDM B;  1TZY D;  4Z5T A;  4R8P B;  3REH A;  1TZY C;  3MGR A;  5AV5 D;  3MVD B;  5B33 D;  5E5A D;  3MGR D;  5GT3 D;  5AV5 C;  5B33 C;  5E5A C;  3MGR C;  3WAA D;  5GT3 C;  4YM6 B;  3AZH A;  1BFM A;  3WAA C;  2NZD D;  5AV6 D;  5AV9 D;  3V9R B;  5B2J A;  5B32 G;  5AV9 C;  5AV6 C;  2NZD C;  3X1S D;  3X1S C;  3AN2 D;  2PYO A;  3AN2 C;  2NQB D;  2F8N H;  2F8N G;  2NQB C;  5AV5 B;  4KGC A;  5GT3 B;  4H9O A;  1S32 D;  2PYO C;  3AV2 A;  2JSS A;  1S32 C;  4XZQ A;  5AV6 B;  1B67 A;  4G91 C;  3AZE B;  2FJ7 A;  5CHL B;  4E45 A;  3MGS D;  3AN2 B;  3UT9 A;  1WWS A;  3MGS C;  2FJ7 D;  4E44 A;  1JFI A;  5BNX B;  5CPI B;  1KX4 D;  2FJ7 C;  4UUZ A;  1HTA A;  1KX4 C;  5B24 D;  5F99 A;  1KX5 B;  1S32 B;  5B24 C;  5JRG B;  1KU5 A;  1P3A A;  1P3G B;  3KWQ B;  5G49 A;  3W98 D;  5DNN D;  3W98 C;  5DNN C;  1P3A D;  3MGS B;  4QLC A;  1P3A C;  1WWI A;  1KX4 B;  5B24 B;  4X23 D;  3AZJ A;  4X23 C;  1M18 A;  5B0Z D;  1F66 A;  3WA9 D;  3AZF B;  3WTP A;  5B0Z C;  3WA9 C;  1ID3 D;  2YFV A;  4NE5 A;  5C3I C;  1M18 D;  1ID3 C;  1M18 C;  1F66 C;  4DRB A;  5CPJ A;  3AZG A;  4H9N A;  3O62 B;  3UTA D;  3MGP A;  4J8V A;  4X23 B;  1AOI A;  5CPJ C;  5B40 D;  2BYK B;  3W96 A;  3WA9 B;  5B40 C;  3AZK A;  5C3I B;  1M1A A;  4J8V C;  1P3F B;  3AZM A;  3AFA B;  3W96 D;  3VH6 A;  3W96 C;  3MNN A;  1U35 B;  1EQZ A;  3LZ0 A;  4KHA B;  5CP6 A;  3UTA B;  1P3I B;  5JA4 B;  4JJN B;  3WKJ B;  2ARO D;  5CP6 C;  3LJA D;  4WU8 A;  3KXB D;  2ARO C;  4J8W A;  3LEL D;  3KXB C;  3C1C A;  3LEL C;  1P3L D;  1A7W A;  5AV8 B;  5GXQ A;  5B31 A;  5CPK A;  1P3L C;  3B0C W;  4LD9 B;  5B0Y A;  3VH6 W;  5AVB A;  3REI D;  3X1U D;  4KUD B;  5B31 D;  5B1M B;  4J8X D;  3X1U C;  3AV1 A;  5B31 C;  1BH9 B;  4AWL B;  4YS3 A;  2HUE C;  4J8X C;  5AVB D;  3LJA B;  3B6F A;  5AVB C;  4YS3 D;  3LEL B;  4WNN A;  5DNM D;  4YS3 C;  4Z66 D;  4ZBJ B;  5DNM C;  5AVC D;  4Z66 C;  1P3L B;  1P3O A;  5AVC C;  4CSR A;  2HIO A;  3AZL B;  1P3K B;  3X1T B;  4J8U A;  3REI B;  3X1U B;  3AZI D;  1M19 D;  2F8N K;  2HUE B;  4WZS B;  3W99 D;  1P34 A;  3AZI C;  4H9P B;  1M19 C;  3AZN B;  3W99 C;  5B2I A;  2CV5 A;  4EO5 B;  3REJ A;  4R8P A;  1P3P B;  4ZUX B;  1ZLA D;  3KSY A;  1ZLA C;  4Z66 B;  5AY8 D;  5B32 A;  4Z5T D;  3MVD A;  5AY8 C;  3REH D;  1TAF A;  4Z5T C;  5FUG A;  3REJ C;  1KX3 B;  3REH C;  3REL A;  5B32 D;  4WV4 B;  3WTP E;  1P3B A;  5B32 C;  1H3O B;  5GSU B;  3KUY B;  5GT0 B;  3V9R A;  3LZ1 B;  1M19 B;  2F8N A;  3A6N A;  2IO5 B;  3AZH D;  1N1J B;  3AZH C;  4H9R B;  1TZY B;  4WU9 A;  2F8N D;  1P3B C;  5B2J D;  3A6N D;  1ZLA B;  5B2J C;  3A6N C;  5B33 B;  5E5A B;  2PYO D;  3MGR B;  4WU9 C;  3WAA B;  4KGC D;  4H9Q A;  5AV9 B;  3REK A;  3AZE A;  2NZD B;  4KGC C;  3AV2 D;  3X1S B;  2BYM A;  3AV2 C;  4XZQ D;  4NE6 A;  1HQ3 A;  4XZQ C;  5BNX A;  5CPI A;  2NQB B;  3MGQ A;  3UT9 D;  2LY8 A;  1BH8 B;  3TU4 A;  1KX5 A;  2PYO B;  3UT9 C;  1HQ3 C;  5JRG A;  4XUJ A;  5BNV B;  4G91 B;  5B1L A;  3MGQ C;  3KWQ A;  1P3G A;  3TU4 D;  5F99 D;  3VH5 A;  4H9O B;  4XUJ D;  3TU4 C;  5F99 C;  4XUJ C;  2FJ7 B;  4Z2M G;  4Z2M H;  4QLC D;  3W97 A;  4QLC C;  1JFI B;  5BT1 C;  3AZF A;  4HGA C;  5F99 B;  3W98 B;  5DNN B;  3AZJ D;  1F66 D;  1P3A B;  3AZJ C;  3WTP D;  3UTB A;  5G49 B;  3VH5 W;  5BS7 A;  3WTP C;  3O62 A;  3UTB D;  3C1B A;  3UTB C;  3NQU A;  5CPJ D;  3AZG D;  5BS7 C;  3NQJ B;  2BYK A;  3AZG C;  3MGP D;  5B0Z B;  4HGA B;  3B6G A;  4J8V D;  3X1V A;  3MGP C;  3C1B C;  4NE3 A;  1P3F A;  1ID3 B;  1AOI D;  3AFA A;  1M18 B;  1AOI C;  1F66 B;  3B6G D;  3AZK D;  1U35 A;  4M6B A;  1M1A D;  3B6G C;  3AZK C;  2YFV B;  3AZM D;  4KHA A;  1M1A C;  1P3I A;  3AZM C;  3MNN D;  1EQZ D;  3LZ0 D;  3MNN C;  5CPJ B;  3AZG B;  4JJN A;  1EQZ C;  5CP6 D;  4H9N B;  3LZ0 C;  2YFW B;  5B40 B;  5BO0 A;  3MGP B;  4J8V B;  4G92 C;  1AOI B;  3W96 B;  4WU8 D;  3R45 A;  5AV8 A;  4J8W D;  4WU8 C;  4J8W C;  3C1C D;  4CAY A;  3C1C C;  4KUD A;  5GXQ D;  5B1M A;  5CPK D;  3LZ0 B;  5GXQ C;  5CPK C;  5CP6 B;  5B0Y D;  1Q9C A;  2ARO B;  5B0Y C;  1ULY A;  3AYW A;  3KXB B;  3AV1 D;  3AV1 C;  3B6F D;  4WU8 B;  4J8W B;  3B6F C;  3AZL A;  3C1C B;  3X1T A;  1B6W A;  1P3M A;  5GXQ B;  1P3O D;  5B31 B;  5CPK B;  2HIO D;  4J8X B;  1P3O C;  4H9P A;  3AZN A;  2HIO C;  5AVB B;  4J8U D;  1P3M D;  5KDM A;  1P3P A;  4ZUX A;  4J8U C;  2RVQ D;  1P3M C;  1P34 D;  4YS3 B;  2RVQ C;  3B0C T;  1P34 C;  5B2I D;  2L5A A;  2CV5 D;  5DNM B;  3VH6 T;  3REJ D;  5B2I C;  4R8P D;  2CV5 C;  5AVC B;  4R8P C;  4WNN B;  4YM6 A;  4H9S A;  3MVD D;  1H3O A;  5GSU A;  3KUY A;  5GT0 A;  3LZ1 A;  3MVD C;  3AZI B;  2HIO B;  3REL D;  3W99 B;  4YM6 D;  3REL C;  1N1J A;  1P3B D;  4YM6 C;  1TZY A;  3B0D C;  5AY8 B;  3REJ B;  4Z5T B;  5AV5 A;  4WU9 D;  5B33 A;  5E5A A;  3REH B;  5GT3 A;  3WAA A;  5B32 B;  3B0B A;  2NZD A;  5AV6 A;  5AV9 A;  1TAF B;  5FUG B;  3REL B;  3X1S A;  3AZH B;  3B0D B;  1P3B B;  3AZE D;  3REK D;  3AN2 A;  2F8N B;  5B2J B;  3A6N B;  3AZE C;  3REK C;  2NQB A;  4WU9 B;  1HQ3 D;  1BH8 A;  5CPI D;  1S32 A;  3MGQ D;  5BNV A;  5CPI C;  1KX5 D;  4KGC B;  5JRG D;  1KX5 C;  3AV2 B;  5JRG C;  5B1L D;  3MGS A;  3KWQ D;  1P3G D;  4XZQ B;  4H9Q B;  5B1L C;  3REK B;  1P3G C;  3KWQ C;  2CWE A;  1KX4 A;  2BYM B;  3UT9 B;  1HQ3 B;  5B24 A;  5BT1 D;  3MGQ B;  4UUZ B;  3W97 D;  3W97 C;  3W98 A;  3TU4 B;  5DNN A;  4XUJ B;  3AZF D;  5B1L B; 
#chains in the Genus database with same CATH topology
 3AZF C;  4QLC B;  4X23 A;  3O62 D;  3NQJ A;  3O62 C;  5B0Z A;  3C1B D;  3W97 B;  3WA9 A;  1ID3 A;  3AZJ B;  4WJ3 C;  3X1V D;  3WTP B;  1P3F D;  3X1V C;  3AFA D;  1P3F C;  3UTA A;  3AFA C;  1U35 D;  3UTB B;  5JA4 A;  1U35 C;  3WKJ A;  2YFW A;  1P3I D;  5B40 A;  3C1B B;  3UTA C;  1P3I C;  3NQU B;  3VH5 T;  4JJN D;  3WKJ D;  4JJN C;  3WKJ C;  3EPK A;  3B6G B;  3AZK B;  3X1V B;  1M1A B;  3AZM B;  4LD9 A;  5AV8 D;  1R4V A;  3MNN B;  2FFF B;  1EQZ B;  5AV8 C;  1BH9 A;  4LD9 D;  2ARO A;  3LJA A;  4KUD D;  4LD9 C;  2VQR A;  5B1M D;  3KXB A;  4G92 B;  4KUD C;  3LEL A;  5B1M C;  4NFT A;  4AWL C;  5BO0 B;  3LJA C;  3AYW D;  1P3L A;  3AYW C;  1P3K A;  3R45 B;  2Y2J A;  3REI A;  3X1U A;  4ZBJ C;  3AZL D;  4J8X A;  2BG1 A;  1P3K D;  3X1T D;  3AZL C;  5B0Y B;  4CAY B;  1P3K C;  3X1T C;  1F1E A;  3REI C;  3AV1 B;  2G5H C;  3AZN D;  5B31 G;  5DNM A;  4Z66 A;  3AZN C;  3B6F B;  1P3P D;  4ZUX D;  5AVC A;  3AYW B;  4EO5 C;  1KX3 A;  1P3P C;  4ZUX C;  3F6T A;  1KX3 D;  3AZI A;  1P3O B;  4DRA A;  1M19 A;  4CSR B;  1KX3 C;  3W99 A;  4J8U B;  1P3M B;  5GSU D;  4H9R A;  4H9S C;  5GT0 D;  3LZ1 D;  3KUY D;  1ZLA A;  5GSU C;  3KUY C;  1P34 B;  5GT0 C;  3LZ1 C;  5B2I B;  2IO5 C;  2CV5 B;  5AY8 A;  5KDM B;  1TZY D;  4Z5T A;  4R8P B;  3REH A;  1TZY C;  3MGR A;  1T3U A;  5AV5 D;  3MVD B;  5B33 D;  5E5A D;  3MGR D;  5GT3 D;  5AV5 C;  2ZY2 A;  5B33 C;  5E5A C;  3MGR C;  3WAA D;  5GT3 C;  4YM6 B;  3AZH A;  1BFM A;  3WAA C;  2NZD D;  5AV6 D;  5AV9 D;  3V9R B;  5B2J A;  5B32 G;  5AV9 C;  5AV6 C;  2NZD C;  3X1S D;  3AL0 C;  3X1S C;  3AN2 D;  2PYO A;  3AN2 C;  2NQB D;  2F8N H;  2F8N G;  2NQB C;  5AV5 B;  4KGC A;  2ZY5 A;  5GT3 B;  4H9O A;  1S32 D;  3H0M C;  2PYO C;  3AV2 A;  2JSS A;  1S32 C;  4XZQ A;  5AV6 B;  1B67 A;  4G91 C;  3AZE B;  2FJ7 A;  5CHL B;  4E45 A;  3MGS D;  3AN2 B;  3UT9 A;  1WWS A;  3MGS C;  2FJ7 D;  4E44 A;  1JFI A;  5BNX B;  5CPI B;  1KX4 D;  2FJ7 C;  4UUZ A;  1HTA A;  2Y2P A;  1KX4 C;  5B24 D;  5F99 A;  1KX5 B;  1S32 B;  5B24 C;  5JRG B;  3A1K A;  2DQN C;  1KU5 A;  1P3A A;  1P3G B;  3KWQ B;  5G49 A;  3W98 D;  5DNN D;  2JCH A;  3W98 C;  5DNN C;  1P3A D;  3MGS B;  2XD5 A;  4QLC A;  1P3A C;  1WWI A;  3KFU G;  1KX4 B;  2G5I C;  5B24 B;  4X23 D;  3AZJ A;  4X23 C;  1M18 A;  5B0Z D;  1F66 A;  3WA9 D;  1Z2C B;  3WTP A;  3AZF B;  5B0Z C;  2Y2M A;  3WA9 C;  1ID3 D;  2YFV A;  4NE5 A;  5C3I C;  1M18 D;  1ID3 C;  1M18 C;  1F66 C;  4DRB A;  5CPJ A;  3AZG A;  4H9N A;  3O62 B;  3UTA D;  3MGP A;  4DQY B;  4J8V A;  4X23 B;  1AOI A;  5CPJ C;  5B40 D;  2BYK B;  3IP4 C;  3W96 A;  3WA9 B;  5B40 C;  3AZK A;  5C3I B;  1M1A A;  4J8V C;  1P3F B;  3AZM A;  3AFA B;  3W96 D;  3VH6 A;  3W96 C;  3MNN A;  1U35 B;  1EQZ A;  3LZ0 A;  4KHA B;  5CP6 A;  3UTA B;  1P3I B;  5JA4 B;  4JJN B;  3WKJ B;  2ARO D;  5CP6 C;  3LJA D;  4WU8 A;  3KXB D;  2ARO C;  4J8W A;  3LEL D;  3KXB C;  2UWX A;  3LEL C;  3C1C A;  1P3L D;  1A7W A;  5AV8 B;  5GXQ A;  5B31 A;  5CPK A;  1P3L C;  3B0C W;  4LD9 B;  5B0Y A;  3VH6 W;  5AVB A;  3REI D;  3X1U D;  4KUD B;  5B31 D;  5B1M B;  4J8X D;  3X1U C;  3AV1 A;  5B31 C;  1BH9 B;  4AWL B;  4YS3 A;  2HUE C;  4J8X C;  5AVB D;  3LJA B;  3B6F A;  5AVB C;  4YS3 D;  3LEL B;  4WNN A;  5DNM D;  4YS3 C;  4Z66 D;  4ZBJ B;  5DNM C;  5AVC D;  4Z66 C;  1P3L B;  1P3O A;  5AVC C;  4CSR A;  2HIO A;  3AZL B;  2J8P A;  1P3K B;  3X1T B;  4J8U A;  3EG5 B;  3H0R C;  3X1U B;  3H0L C;  3REI B;  3AZI D;  1M19 D;  2F8N K;  2HUE B;  4WZS B;  3W99 D;  1P34 A;  3AZI C;  4H9P B;  3P5J B;  1M19 C;  3AZN B;  3W99 C;  5B2I A;  2CV5 A;  2RIQ A;  4EO5 B;  3REJ A;  4R8P A;  1P3P B;  4ZUX B;  1ZLA D;  3KSY A;  1ZLA C;  4Z66 B;  5AY8 D;  5B32 A;  4Z5T D;  3MVD A;  5AY8 C;  3REH D;  1TAF A;  4Z5T C;  5FUG A;  3REJ C;  1KX3 B;  3REH C;  3REL A;  5B32 D;  4WV4 B;  3WTP E;  1P3B A;  5B32 C;  1H3O B;  5GSU B;  2Y2Q A;  5GT0 B;  3V9R A;  3LZ1 B;  3KUY B;  1M19 B;  3A6N A;  2F8N A;  2IO5 B;  3AZH D;  1N1J B;  3AZH C;  4H9R B;  1TZY B;  4WU9 A;  2F8N D;  1P3B C;  5B2J D;  3A6N D;  1ZLA B;  5B2J C;  3A6N C;  3EPL A;  2ZY3 A;  3FDD A;  5B33 B;  5E5A B;  2PYO D;  3MGR B;  4WU9 C;  3WAA B;  2W8S A;  4KGC D;  4H9Q A;  5AV9 B;  3REK A;  3AZE A;  2NZD B;  4KGC C;  3AV2 D;  2F2A C;  3X1S B;  2BYM A;  3AV2 C;  4XZQ D;  4NE6 A;  1HQ3 A;  4XZQ C;  5BNX A;  5CPI A;  2NQB B;  3MGQ A;  3UT9 D;  2LY8 A;  4UPK A;  1BH8 B;  3TU4 A;  1KX5 A;  2PYO B;  3UT9 C;  1HQ3 C;  5JRG A;  4XUJ A;  5BNV B;  4G91 B;  5B1L A;  3MGQ C;  3KWQ A;  1P3G A;  3TU4 D;  5F99 D;  3VH5 A;  4H9O B;  4XUJ D;  3TU4 C;  5F99 C;  2Y2O A;  4XUJ C;  2FJ7 B;  2Y2I A;  4Z2M G;  4Z2M H;  4QLC D;  3W97 A;  4QLC C;  1JFI B;  5BT1 C;  3AZF A;  2JE5 A;  4HGA C;  5F99 B;  3W98 B;  3EPJ A;  5DNN B;  3AZJ D;  2Y2G A;  1F66 D;  1P3A B;  3AZJ C;  3WTP D;  3UTB A;  5G49 B;  3VH5 W;  5BS7 A;  3WTP C;  3O62 A;  3UTB D;  3C1B A;  3UTB C;  3NQU A;  5CPJ D;  3AZG D;  5BS7 C;  3NQJ B;  2BYK A;  3AZG C;  3MGP D;  5B0Z B;  4HGA B;  3B6G A;  4J8V D;  3X1V A;  3MGP C;  3C1B C;  4NE3 A;  1P3F A;  1ID3 B;  1AOI D;  3AFA A;  1M18 B;  1AOI C;  1F66 B;  3B6G D;  3AZK D;  1U35 A;  4M6B A;  1M1A D;  3B6G C;  2Y2H A;  3AZK C;  2YFV B;  3AZM D;  4KHA A;  1M1A C;  1P3I A;  3AZM C;  3MNN D;  1EQZ D;  3LZ0 D;  3MNN C;  5CPJ B;  3AZG B;  4JJN A;  1EQZ C;  5CP6 D;  4H9N B;  3LZ0 C;  2YFW B;  5B40 B;  5BO0 A;  3MGP B;  4J8V B;  4G92 C;  1AOI B;  3W96 B;  1PZR A;  4WU8 D;  3R45 A;  5AV8 A;  4J8W D;  3EPH A;  2ZM5 A;  4WU8 C;  4J8W C;  3C1C D;  4CAY A;  3C1C C;  4KUD A;  5GXQ D;  5B1M A;  5CPK D;  3LZ0 B;  5GXQ C;  5CPK C;  5CP6 B;  5B0Y D;  1Q9C A;  2ARO B;  5B0Y C;  2Y2K A;  1ULY A;  3AYW A;  3KXB B;  3AV1 D;  3AV1 C;  3B6F D;  4WU8 B;  4J8W B;  3B6F C;  3AZL A;  3C1C B;  3X1T A;  1B6W A;  1P3M A;  5GXQ B;  1P3O D;  5B31 B;  5CPK B;  2HIO D;  4J8X B;  1P3O C;  4H9P A;  3AZN A;  2HIO C;  5AVB B;  4J8U D;  1P3M D;  2XD1 A;  5KDM A;  1P3P A;  4ZUX A;  4J8U C;  2RVQ D;  1P3M C;  1P34 D;  4YS3 B;  2RVQ C;  3B0C T;  2DF4 C;  5B2I D;  2L5A A;  2CV5 D;  5DNM B;  1P34 C;  3VH6 T;  3REJ D;  5B2I C;  4R8P D;  2CV5 C;  5AVC B;  4R8P C;  4WNN B;  4YM6 A;  4H9S A;  3MVD D;  1H3O A;  5GSU A;  3KUY A;  5GT0 A;  3LZ1 A;  3MVD C;  3AZI B;  2HIO B;  3REL D;  3W99 B;  4YM6 D;  3A1I A;  3REL C;  1N1J A;  1P3B D;  4YM6 C;  1TZY A;  3B0D C;  5AY8 B;  3REJ B;  4Z5T B;  5AV5 A;  4WU9 D;  5B33 A;  5E5A A;  3REH B;  5GT3 A;  3WAA A;  2Y2L A;  5B32 B;  3B0B A;  2NZD A;  5AV6 A;  5AV9 A;  1TAF B;  5FUG B;  3REL B;  3X1S A;  3AZH B;  3B0D B;  1P3B B;  3AZE D;  3REK D;  3AN2 A;  2F8N B;  5B2J B;  3A6N B;  3AZE C;  3REK C;  2NQB A;  4WU9 B;  1HQ3 D;  1BH8 A;  5CPI D;  1S32 A;  3MGQ D;  5BNV A;  5CPI C;  1KX5 D;  4KGC B;  5JRG D;  1KX5 C;  3AV2 B;  5JRG C;  5B1L D;  3MGS A;  3KWQ D;  1P3G D;  4XZQ B;  4H9Q B;  2ZY4 A;  5B1L C;  3REK B;  1P3G C;  3KWQ C;  2Y2N A;  2CWE A;  1W2E A;  1KX4 A;  2BYM B;  3UT9 B;  1HQ3 B;  5B24 A;  5BT1 D;  3MGQ B;  4UUZ B;  3W97 D;  3W97 C;  3W98 A;  3TU4 B;  5DNN A;  4XUJ B;  3AZF D;  5B1L B; 
#chains in the Genus database with same CATH homology
 3AZF C;  4QLC B;  4X23 A;  3O62 D;  3NQJ A;  3O62 C;  5B0Z A;  3C1B D;  3W97 B;  3WA9 A;  1ID3 A;  3AZJ B;  4WJ3 C;  3X1V D;  3WTP B;  1P3F D;  3X1V C;  3AFA D;  1P3F C;  3UTA A;  3AFA C;  1U35 D;  3UTB B;  5JA4 A;  1U35 C;  3WKJ A;  2YFW A;  1P3I D;  5B40 A;  3C1B B;  3UTA C;  1P3I C;  3NQU B;  3VH5 T;  4JJN D;  3WKJ D;  4JJN C;  3WKJ C;  3EPK A;  3B6G B;  3AZK B;  3X1V B;  1M1A B;  3AZM B;  4LD9 A;  5AV8 D;  1R4V A;  3MNN B;  2FFF B;  1EQZ B;  5AV8 C;  1BH9 A;  4LD9 D;  2ARO A;  3LJA A;  4KUD D;  4LD9 C;  2VQR A;  5B1M D;  3KXB A;  4G92 B;  4KUD C;  3LEL A;  5B1M C;  4NFT A;  4AWL C;  5BO0 B;  3LJA C;  3AYW D;  1P3L A;  3AYW C;  1P3K A;  3R45 B;  2Y2J A;  3REI A;  3X1U A;  4ZBJ C;  3AZL D;  4J8X A;  2BG1 A;  1P3K D;  3X1T D;  3AZL C;  5B0Y B;  4CAY B;  1P3K C;  3X1T C;  1F1E A;  3REI C;  3AV1 B;  2G5H C;  3AZN D;  5B31 G;  5DNM A;  4Z66 A;  3AZN C;  3B6F B;  1P3P D;  4ZUX D;  5AVC A;  3AYW B;  4EO5 C;  1KX3 A;  1P3P C;  4ZUX C;  3F6T A;  1KX3 D;  3AZI A;  1P3O B;  4DRA A;  1M19 A;  4CSR B;  1KX3 C;  3W99 A;  4J8U B;  1P3M B;  5GSU D;  4H9R A;  4H9S C;  5GT0 D;  3LZ1 D;  3KUY D;  1ZLA A;  5GSU C;  3KUY C;  1P34 B;  5GT0 C;  3LZ1 C;  5B2I B;  2IO5 C;  2CV5 B;  5AY8 A;  5KDM B;  1TZY D;  4Z5T A;  4R8P B;  3REH A;  1TZY C;  3MGR A;  1T3U A;  5AV5 D;  3MVD B;  5B33 D;  5E5A D;  3MGR D;  5GT3 D;  5AV5 C;  2ZY2 A;  5B33 C;  5E5A C;  3MGR C;  3WAA D;  5GT3 C;  4YM6 B;  3AZH A;  1BFM A;  3WAA C;  2NZD D;  5AV6 D;  5AV9 D;  3V9R B;  5B2J A;  5B32 G;  5AV9 C;  5AV6 C;  2NZD C;  3X1S D;  3AL0 C;  3X1S C;  3AN2 D;  2PYO A;  3AN2 C;  2NQB D;  2F8N H;  2F8N G;  2NQB C;  5AV5 B;  4KGC A;  2ZY5 A;  5GT3 B;  4H9O A;  1S32 D;  3H0M C;  2PYO C;  3AV2 A;  2JSS A;  1S32 C;  4XZQ A;  5AV6 B;  1B67 A;  4G91 C;  3AZE B;  2FJ7 A;  5CHL B;  4E45 A;  3MGS D;  3AN2 B;  3UT9 A;  1WWS A;  3MGS C;  2FJ7 D;  4E44 A;  1JFI A;  5BNX B;  5CPI B;  1KX4 D;  2FJ7 C;  4UUZ A;  1HTA A;  2Y2P A;  1KX4 C;  5B24 D;  5F99 A;  1KX5 B;  1S32 B;  5B24 C;  5JRG B;  3A1K A;  2DQN C;  1KU5 A;  1P3A A;  1P3G B;  3KWQ B;  5G49 A;  3W98 D;  5DNN D;  2JCH A;  3W98 C;  5DNN C;  1P3A D;  3MGS B;  2XD5 A;  4QLC A;  1P3A C;  1WWI A;  3KFU G;  1KX4 B;  2G5I C;  5B24 B;  4X23 D;  3AZJ A;  4X23 C;  1M18 A;  5B0Z D;  1F66 A;  3WA9 D;  1Z2C B;  3WTP A;  3AZF B;  5B0Z C;  2Y2M A;  3WA9 C;  1ID3 D;  2YFV A;  4NE5 A;  5C3I C;  1M18 D;  1ID3 C;  1M18 C;  1F66 C;  4DRB A;  5CPJ A;  3AZG A;  4H9N A;  3O62 B;  3UTA D;  3MGP A;  4DQY B;  4J8V A;  4X23 B;  1AOI A;  5CPJ C;  5B40 D;  2BYK B;  3IP4 C;  3W96 A;  3WA9 B;  5B40 C;  3AZK A;  5C3I B;  1M1A A;  4J8V C;  1P3F B;  3AZM A;  3AFA B;  3W96 D;  3VH6 A;  3W96 C;  3MNN A;  1U35 B;  1EQZ A;  3LZ0 A;  4KHA B;  5CP6 A;  3UTA B;  1P3I B;  5JA4 B;  4JJN B;  3WKJ B;  2ARO D;  5CP6 C;  3LJA D;  4WU8 A;  3KXB D;  2ARO C;  4J8W A;  3LEL D;  3KXB C;  2UWX A;  3LEL C;  3C1C A;  1P3L D;  1A7W A;  5AV8 B;  5GXQ A;  5B31 A;  5CPK A;  1P3L C;  3B0C W;  4LD9 B;  5B0Y A;  3VH6 W;  5AVB A;  3REI D;  3X1U D;  4KUD B;  5B31 D;  5B1M B;  4J8X D;  3X1U C;  3AV1 A;  5B31 C;  1BH9 B;  4AWL B;  4YS3 A;  2HUE C;  4J8X C;  5AVB D;  3LJA B;  3B6F A;  5AVB C;  4YS3 D;  3LEL B;  4WNN A;  5DNM D;  4YS3 C;  4Z66 D;  4ZBJ B;  5DNM C;  5AVC D;  4Z66 C;  1P3L B;  1P3O A;  5AVC C;  4CSR A;  2HIO A;  3AZL B;  2J8P A;  1P3K B;  3X1T B;  4J8U A;  3EG5 B;  3H0R C;  3X1U B;  3H0L C;  3REI B;  3AZI D;  1M19 D;  2F8N K;  2HUE B;  4WZS B;  3W99 D;  1P34 A;  3AZI C;  4H9P B;  3P5J B;  1M19 C;  3AZN B;  3W99 C;  5B2I A;  2CV5 A;  2RIQ A;  4EO5 B;  3REJ A;  4R8P A;  1P3P B;  4ZUX B;  1ZLA D;  3KSY A;  1ZLA C;  4Z66 B;  5AY8 D;  5B32 A;  4Z5T D;  3MVD A;  5AY8 C;  3REH D;  1TAF A;  4Z5T C;  5FUG A;  3REJ C;  1KX3 B;  3REH C;  3REL A;  5B32 D;  4WV4 B;  3WTP E;  1P3B A;  5B32 C;  1H3O B;  5GSU B;  2Y2Q A;  5GT0 B;  3V9R A;  3LZ1 B;  3KUY B;  1M19 B;  3A6N A;  2F8N A;  2IO5 B;  3AZH D;  1N1J B;  3AZH C;  4H9R B;  1TZY B;  4WU9 A;  2F8N D;  1P3B C;  5B2J D;  3A6N D;  1ZLA B;  5B2J C;  3A6N C;  3EPL A;  2ZY3 A;  3FDD A;  5B33 B;  5E5A B;  2PYO D;  3MGR B;  4WU9 C;  3WAA B;  2W8S A;  4KGC D;  4H9Q A;  5AV9 B;  3REK A;  3AZE A;  2NZD B;  4KGC C;  3AV2 D;  2F2A C;  3X1S B;  2BYM A;  3AV2 C;  4XZQ D;  4NE6 A;  1HQ3 A;  4XZQ C;  5BNX A;  5CPI A;  2NQB B;  3MGQ A;  3UT9 D;  2LY8 A;  4UPK A;  1BH8 B;  3TU4 A;  1KX5 A;  2PYO B;  3UT9 C;  1HQ3 C;  5JRG A;  4XUJ A;  5BNV B;  4G91 B;  5B1L A;  3MGQ C;  3KWQ A;  1P3G A;  3TU4 D;  5F99 D;  3VH5 A;  4H9O B;  4XUJ D;  3TU4 C;  5F99 C;  2Y2O A;  4XUJ C;  2FJ7 B;  2Y2I A;  4Z2M G;  4Z2M H;  4QLC D;  3W97 A;  4QLC C;  1JFI B;  5BT1 C;  3AZF A;  2JE5 A;  4HGA C;  5F99 B;  3W98 B;  3EPJ A;  5DNN B;  3AZJ D;  2Y2G A;  1F66 D;  1P3A B;  3AZJ C;  3WTP D;  3UTB A;  5G49 B;  3VH5 W;  5BS7 A;  3WTP C;  3O62 A;  3UTB D;  3C1B A;  3UTB C;  3NQU A;  5CPJ D;  3AZG D;  5BS7 C;  3NQJ B;  2BYK A;  3AZG C;  3MGP D;  5B0Z B;  4HGA B;  3B6G A;  4J8V D;  3X1V A;  3MGP C;  3C1B C;  4NE3 A;  1P3F A;  1ID3 B;  1AOI D;  3AFA A;  1M18 B;  1AOI C;  1F66 B;  3B6G D;  3AZK D;  1U35 A;  4M6B A;  1M1A D;  3B6G C;  2Y2H A;  3AZK C;  2YFV B;  3AZM D;  4KHA A;  1M1A C;  1P3I A;  3AZM C;  3MNN D;  1EQZ D;  3LZ0 D;  3MNN C;  5CPJ B;  3AZG B;  4JJN A;  1EQZ C;  5CP6 D;  4H9N B;  3LZ0 C;  2YFW B;  5B40 B;  5BO0 A;  3MGP B;  4J8V B;  4G92 C;  1AOI B;  3W96 B;  1PZR A;  4WU8 D;  3R45 A;  5AV8 A;  4J8W D;  3EPH A;  2ZM5 A;  4WU8 C;  4J8W C;  3C1C D;  4CAY A;  3C1C C;  4KUD A;  5GXQ D;  5B1M A;  5CPK D;  3LZ0 B;  5GXQ C;  5CPK C;  5CP6 B;  5B0Y D;  1Q9C A;  2ARO B;  5B0Y C;  2Y2K A;  1ULY A;  3AYW A;  3KXB B;  3AV1 D;  3AV1 C;  3B6F D;  4WU8 B;  4J8W B;  3B6F C;  3AZL A;  3C1C B;  3X1T A;  1B6W A;  1P3M A;  5GXQ B;  1P3O D;  5B31 B;  5CPK B;  2HIO D;  4J8X B;  1P3O C;  4H9P A;  3AZN A;  2HIO C;  5AVB B;  4J8U D;  1P3M D;  2XD1 A;  5KDM A;  1P3P A;  4ZUX A;  4J8U C;  2RVQ D;  1P3M C;  1P34 D;  4YS3 B;  2RVQ C;  3B0C T;  2DF4 C;  5B2I D;  2L5A A;  2CV5 D;  5DNM B;  1P34 C;  3VH6 T;  3REJ D;  5B2I C;  4R8P D;  2CV5 C;  5AVC B;  4R8P C;  4WNN B;  4YM6 A;  4H9S A;  3MVD D;  1H3O A;  5GSU A;  3KUY A;  5GT0 A;  3LZ1 A;  3MVD C;  3AZI B;  2HIO B;  3REL D;  3W99 B;  4YM6 D;  3A1I A;  3REL C;  1N1J A;  1P3B D;  4YM6 C;  1TZY A;  3B0D C;  5AY8 B;  3REJ B;  4Z5T B;  5AV5 A;  4WU9 D;  5B33 A;  5E5A A;  3REH B;  5GT3 A;  3WAA A;  2Y2L A;  5B32 B;  3B0B A;  2NZD A;  5AV6 A;  5AV9 A;  1TAF B;  5FUG B;  3REL B;  3X1S A;  3AZH B;  3B0D B;  1P3B B;  3AZE D;  3REK D;  3AN2 A;  2F8N B;  5B2J B;  3A6N B;  3AZE C;  3REK C;  2NQB A;  4WU9 B;  1HQ3 D;  1BH8 A;  5CPI D;  1S32 A;  3MGQ D;  5BNV A;  5CPI C;  1KX5 D;  4KGC B;  5JRG D;  1KX5 C;  3AV2 B;  5JRG C;  5B1L D;  3MGS A;  3KWQ D;  1P3G D;  4XZQ B;  4H9Q B;  2ZY4 A;  5B1L C;  3REK B;  1P3G C;  3KWQ C;  2Y2N A;  2CWE A;  1W2E A;  1KX4 A;  2BYM B;  3UT9 B;  1HQ3 B;  5B24 A;  5BT1 D;  3MGQ B;  4UUZ B;  3W97 D;  3W97 C;  3W98 A;  3TU4 B;  5DNN A;  4XUJ B;  3AZF D;  5B1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...