3R45B

Structure of a cenp-a-histone h4 heterodimer in complex with chaperone hjurp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Histone H3-like centromeric protein A
publication title Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3r45B00
4J8VD 4Z5TC 4XZQA 3REHB 5B32G 3WA9B 3UTBD 3REJA 5AV6C 4KUDB 3AZEC 3W97C 3MGSC 1P3FD 5GSUB 4G91C 1TAFA 4WU9C 1P3IB 4H9QB 1M1AA 2BYKB 5AV9D 3AZIA 5FUGA 1H3OB 5B0ZC 3AV1A 5B24A 3AFAC 3REKB 1P3KA 4Z5TD 3W98D 5B1MA 5E5AC 5B32B 4J8UA 5B33B 5CPIA 3W97D 3MGSD 5B0YA 1TZYC 3VH6T 4WU9D 3KUYA 5B1LA 1P3MB 5B0ZD 4KGCC 3AFAD 3LJAD 3WAAB 1ZLAC 1S32C 5E5AD 1KX3A 3MGRD 3O62C 3VH6W 2AROC 5AVBC 3V9RB 1TZYD 3LZ0D 5AV6B 2F8NK 4H9SA 3AZEB 3MGSB 4G91B 3WKJA 1M19A 4WU9B 5CPKA 4KGCD 2FJ7B 5B0ZB 5BNXA 1S32D 3X1VD 3AYWC 3TU4B 3O62D 3REIA 1U35B 1KX5A 2AROD 1P3OA 5AVBD 3A6NC 1TZYB 4ZBJC 5KDMA 1N1JB 3MVDA 3C1CD 4YS3A 3W96C 3VH5W 4WV4B 3AZFC 3AZLC 1ZLAB 3KXBD 1S32B 5AY8C 1ID3D 3AZNB 2PYOD 4M6BA 2CWEA 5DNMA 3MNNA 4CAYB 5F99A 3O62B 4WU8A 2HIOC 2AROB 1EQZA 3A6ND 5BS7A 1M18C 5G49B 1KX4A 2BYMA 3KWQD 3REJC 4Z66A 3C1BC 4QLCA 3UT9A 3W96D 3AZLD 3AN2A 5GT3A 5AY8D 3AYWB 4CSRA 1ULYA 3UTAA 5BNVA 2NZDA 4XZQD 2CV5B 4J8WA 3WTPC 4Z2MH 1M18D 4XUJC 3X1TC 3A6NB 1P3BC 4WNNB 4ZBJB 3LZ1C 3REJD 4JJNA 3MGQC 1F66A 3LELA 5CP6B 5CPIC 5B2JA 1WWSA 5JRGA 1BH9B 3B6FA 3AZFB 3KUYC 3AZID 5GT0C 3AZLB 3X1SA 3B6GB 5B24D 2YFWA 5AY8B 1AOIA 3MGPB 3WTPE 3AZHA 5B1MD 5B31A 3NQJB 3AZGA 5JA4B 4R8PC 4KHAA 2HIOB 3AV2A 2F8NA 3WTPD 1KX3C 4XUJD 3X1TD 2NQBA 1P3FC 1M18B 5AV5A 3MGQD 5CPID 3AZMA 4H9OA 5B0YD 5B40A 4X23A 3C1BB 3KUYD 5GT0D 5B1LD 3WKJC 1P3PA 1M19C 5CPKC 3W98C 5GXQB 4YM6A 4G92C 4R8PD 3RELB 1HQ3B 4NE6A 4LD9A 1KX3D 4AWLB 1P3LA 3WTPB 5AV8C 3AZJC 4XUJB 3X1TB 5CPJB 1P3BB 1KX5C 3W99A 4H9RA 3LZ1B 3MGQB 2F8NH 4NE3A 4ZUXA 3LJAC 1P3GA 5AVCA 3WKJD 4HGAC 3R45B 5CPKD 4J8VB 1M19D 5GT0B 5DNNC 3MGRC 5B2IA 4J8XA 3UTBB 2YFVB 3REID 4R8PB 3MNNC 5AV8D 3LZ0C 3AZJD 1KX5D 5F99C 1P3OD 3X1UC 1P3FB 4WU8C 1EQZC 5AV9B 5BS7C 1B67A 1KX4C 3REHA 4UUZB 3X1VC 3WA9A 5DNND 4Z5TB 3W98B 1P34C 4QLCC 4EO5C 4KUDA 5GSUA 4G92B 4H9NB 5DNMD 1P3IA 4H9QA 3UTAC 3MNND 2BYKA 5F99D 1H3OA 3X1UD 3W97B 5AV8B 3NQUB 3AZJB 4WU8D 4NFTA 1EQZD 3REKA 3B0BA 1P3AC 3C1CC 1KX4D 1KU5A 1JFIB 3AFAB 3LJAB 4HGAB 5B32A 3VH5T 3KXBC 2L5AA 1P34D 4QLCD 5B2JC 1ID3C 5DNNB 2PYOC 1BH8B 5E5AB 5GT3D 5B33A 3B6FC 3MGRB 3X1SC 3UTAD 1P3MA 1HTAA 3LZ0B 4H9PB 5B31C 3B0DC 3KWQC 3X1UB 3WAAA 3AV2C 4J8WD 1P3AD 4DRAA 4KGCB 1F66D 5AV5C 2BYMB 3X1VB 5B2JD 5JRGD 1P34B 3B6FD 3V9RA 3X1SD 5AV6A 1P3PC 3AZEA 3MGSA 4XZQC 1AOID 5BO0B 5AVBB 4WU9A 3AZHD 5B31D 4YM6C 4WZSB 2FJ7A 5B0ZA 3AV2D 2F8ND 1P3LC 1P3AB 3C1CB 3TU4A 5AV5D 1M1AC 1U35A 3AZIC 3AV1C 5B40D 4X23D 5B24C 3KXBB 1BFMA 1ID3B 4ZUXC 1P3KC 1P3GC 2PYOB 1P3PD 3B6FB 5B1MC 1TZYA 1N1JA 4YM6D 3KWQB 4J8UC 1ZLAA 5B0YC 1P3LD 1S32A 3AZNA 3W96B 1M1AD 5B1LC 3AV1D 4CAYA 3KSYA 3AZKA 4ZUXD 1P3KD 1P3GD 2AROA 5CHLB 3VH6A 5G49A 4XZQB 5B2ID 4KUDC 4J8UD 3REJB 1P3IC 3AYWA 4H9SC 1P3LB 1TAFB 1R4VA 3REKC 1M1AB 3AZIB 5FUGB 3AV1B 3REHD 5B24B 2CV5A 1P3KB 3WA9D 2RVQC 5B1MB 4WNNA 4E44A 3REIC 4KUDD 5CP6A 1BH9A 1P3OC 1P3ID 3AZFA 4J8UB 3AZLA 3VH5A 5CPIB 5B0YB 3B6GA 5AY8A 3WAAC 3REKD 3MGPA 3KUYB 3MVDC 5B1LB 3NQJA 4E45A 4YS3C 5JA4A 2HIOA 2RVQD 5B32D 5C3IC 1M18A 5DNMC 5B33D 1KX3B 1Q9CA 3C1BA 1B6WA 1P3MD 2FJ7C 3WAAD 4Z66C 3MVDD 1WWIA 5GXQA 3WKJB 1M19B 2HUEC 5CPKB 4YS3D 2JSSA 3UT9C 3TU4C 3RELA 1HQ3A 3AN2C 5BNXB 5GT3C 1U35C 3WTPA 4XUJA 3X1TA 5CPJA 1P3BA 4Z2MG 3LZ1A 2NZDC 3MGQA 3REIB 5AV6D 3B0CT 3AZED 1KX5B 1P3OB 3R45A 4J8WC 4J8VA 5GT0A 2FJ7D 1F66C 4Z66D 4JJNC 3LELC 5KDMB 3MVDB 3UTBA 2YFVA 5JRGC 3UT9D 3TU4D 3AN2D 4YS3B 3AZNC 4R8PA 1U35D 3B0CW 5C3IB 1P3FA 1AOIC 3AZKC 2NZDD 5DNMB 3AZHC 3MNNB 5AV9A 2LY8A 5F99B 3AZGC 4UUZA 4WU8B 1EQZB 2NQBC 4Z5TA 3W98A 4NE5A 1KX4B 4JJND 3LELD 1A7WA 3AZMC 4Z66B 1ZLAD 2HUEB 4X23C 5B40C 3AZND 4QLCB 3UT9B 4H9NA 4EO5B 3AN2B 5GT3B 3W97A 5AV8A 3NQUA 3AZJA 4CSRB 3AZKD 3UTAB 5BNVB 5B31G 2CV5C 2NZDB 3AZGD 2F8NG 4LD9C 1JFIA 3AFAA 3LJAA 2NQBD 5CP6C 4J8WB 3W99C 5DNNA 1BH8A 3AZMD 1F66B 5E5AA 4JJNB 3LELB 3AYWD 3MGRA 3B6GC 5B2JB 5JRGB 5AVCC 3MGPC 3X1SB 4H9PA 3LZ0A 2YFWB 3X1UA 1AOIB 3AZKB 2IO5C 2CV5D 5B2IC 4DRBA 4J8XC 3AZHB 4KGCA 5B31B 3B0DB 4LD9D 3AZGB 3AV2B 4KHAB 2F8NB 5CP6D 3X1VA 3W99D 5BT1C 2NQBB 1P34A 5AV5B 3AZFD 3O62A 3AZMB 4H9OB 3B6GD 5B40B 4X23B 3REHC 5AVCD 5BO0A 5AVBA 3MGPD 3WA9C 5GXQC 1P3PB 3RELC 2HIOD 1HQ3C 4J8XD 4AWLC 4YM6B 5GSUC 3C1CA 1P3AA 5CPJC 4LD9B 5BT1D 3KXBA 1F1EA 3C1BD 3W99B 1ID3A 2PYOA 4H9RB 4J8VC 4ZUXB 1P3GB 5GXQD 5AVCB 5B32C 3A6NA 3UTBC 3RELD 1HQ3D 3KWQA 5B33C 2IO5B 5GSUD 5B2IB 4J8XB 5CPJD 1P3BD 3W96A 3LZ1D 1P3MC 5AV9C
chains in the Genus database with same CATH superfamily
4J8VD 4Z5TC 4XZQA 3REHB 5B32G 3WA9B 3UTBD 3REJA 5AV6C 4KUDB 3AZEC 3W97C 3MGSC 1P3FD 5GSUB 4G91C 1TAFA 3KFUG 4WU9C 1P3IB 4H9QB 1M1AA 2BYKB 5AV9D 3AZIA 5FUGA 1H3OB 5B0ZC 3AV1A 5B24A 3AFAC 3REKB 1P3KA 4Z5TD 3W98D 5B1MA 5E5AC 5B32B 4J8UA 5B33B 5CPIA 3W97D 3MGSD 5B0YA 1TZYC 3VH6T 4WU9D 3KUYA 5B1LA 1P3MB 5B0ZD 4KGCC 3AFAD 3LJAD 3WAAB 1ZLAC 1S32C 1W2EA 5E5AD 2DF4C 2ZM5A 1KX3A 3MGRD 3O62C 2ZY4A 3VH6W 2AROC 5AVBC 3V9RB 1TZYD 3LZ0D 5AV6B 2F8NK 4H9SA 3AZEB 3MGSB 4G91B 3WKJA 1M19A 4WU9B 5CPKA 4KGCD 2JE5A 2Y2MA 2FJ7B 5B0ZB 5BNXA 3FDDA 1S32D 3X1VD 3AYWC 3TU4B 3O62D 3REIA 1U35B 2BG1A 1KX5A 2AROD 1P3OA 3H0RC 5AVBD 3A6NC 1TZYB 4ZBJC 5KDMA 1N1JB 3MVDA 3C1CD 4YS3A 3W96C 3VH5W 4WV4B 3AZFC 3AZLC 1ZLAB 3KXBD 1S32B 5AY8C 1ID3D 3EG5B 3AZNB 2PYOD 4M6BA 2CWEA 5DNMA 3A1KA 3MNNA 2VQRA 4CAYB 5F99A 3O62B 4WU8A 2HIOC 2AROB 2W8SA 1EQZA 3A6ND 2Y2OA 5BS7A 1M18C 5G49B 1KX4A 2BYMA 3KWQD 3REJC 4Z66A 3C1BC 4QLCA 3UT9A 3W96D 3AZLD 3AN2A 3F6TA 5GT3A 5AY8D 3AYWB 4CSRA 1ULYA 3UTAA 5BNVA 2NZDA 4XZQD 2Y2GA 2CV5B 4J8WA 1T3UA 4Z2MH 3WTPC 4XUJC 3X1TC 3A6NB 1P3BC 1M18D 4WNNB 4ZBJB 3LZ1C 3REJD 4JJNA 3MGQC 1F66A 3LELA 5CP6B 5CPIC 5B2JA 1WWSA 5JRGA 1BH9B 3P5JB 3B6FA 3AZFB 3EPLA 3KUYC 3AZID 5GT0C 3AZLB 2JCHA 3X1SA 3B6GB 5B24D 2YFWA 5AY8B 1AOIA 3MGPB 3WTPE 3AZHA 5B1MD 5B31A 3NQJB 3AZGA 5JA4B 4R8PC 4KHAA 2HIOB 3AV2A 2F8NA 3WTPD 1KX3C 4XUJD 3X1TD 2NQBA 1P3FC 1M18B 5AV5A 3MGQD 2Y2LA 5CPID 3AZMA 2Y2HA 4H9OA 5B0YD 5B40A 2Y2JA 4X23A 3C1BB 3KUYD 5GT0D 5B1LD 3WKJC 1P3PA 1M19C 5CPKC 3W98C 5GXQB 4YM6A 2DQNC 4G92C 4R8PD 3RELB 1HQ3B 4NE6A 4LD9A 1KX3D 4AWLB 1P3LA 3WTPB 5AV8C 3AZJC 4XUJB 3X1TB 5CPJB 1P3BB 1KX5C 3W99A 4H9RA 3LZ1B 3MGQB 2F8NH 4NE3A 4ZUXA 3LJAC 1P3GA 5AVCA 3WKJD 4HGAC 3R45B 5CPKD 4J8VB 1M19D 5GT0B 5DNNC 3EPHA 3MGRC 5B2IA 4J8XA 3UTBB 2YFVB 3REID 4R8PB 3MNNC 5AV8D 3LZ0C 3AZJD 1KX5D 5F99C 1P3OD 3X1UC 1P3FB 4WU8C 1EQZC 4UPKA 5AV9B 5BS7C 1B67A 1KX4C 3REHA 4UUZB 3X1VC 3WA9A 5DNND 4Z5TB 3W98B 1P34C 4QLCC 2Y2KA 4EO5C 2FFFB 3EPKA 4KUDA 5GSUA 3EPJA 4G92B 2Y2QA 4H9NB 5DNMD 1P3IA 4H9QA 3UTAC 3MNND 2BYKA 3H0MC 1H3OA 5F99D 3X1UD 3W97B 5AV8B 3NQUB 3AZJB 4WU8D 4NFTA 1EQZD 3REKA 3B0BA 1P3AC 3C1CC 1KX4D 2RIQA 1KU5A 1JFIB 3AFAB 3LJAB 4HGAB 5B32A 3VH5T 3KXBC 2L5AA 1P34D 4QLCD 5B2JC 1ID3C 5DNNB 2PYOC 1BH8B 5E5AB 5GT3D 5B33A 3B6FC 3MGRB 3X1SC 3UTAD 1P3MA 1HTAA 3LZ0B 4H9PB 5B31C 3B0DC 3KWQC 3X1UB 3WAAA 3AV2C 4J8WD 1P3AD 4DRAA 4KGCB 3H0LC 1F66D 5AV5C 2BYMB 2XD1A 3X1VB 5B2JD 5JRGD 1P34B 3B6FD 3V9RA 3X1SD 5AV6A 1P3PC 3AZEA 3MGSA 4XZQC 1AOID 5BO0B 5AVBB 4WU9A 3AZHD 5B31D 4YM6C 4WZSB 2FJ7A 5B0ZA 3AV2D 2F8ND 1P3LC 1P3AB 3C1CB 3TU4A 5AV5D 3IP4C 1M1AC 1U35A 3AZIC 3AV1C 5B40D 4X23D 5B24C 3KXBB 1BFMA 1ID3B 4ZUXC 1P3KC 1P3GC 2PYOB 1P3PD 3B6FB 5B1MC 1TZYA 3A1IA 1N1JA 4YM6D 3KWQB 4J8UC 1ZLAA 5B0YC 1P3LD 1S32A 3AZNA 3W96B 1M1AD 5B1LC 3AV1D 4CAYA 3KSYA 3AZKA 4ZUXD 1P3KD 1P3GD 2AROA 5CHLB 3VH6A 5G49A 2F2AC 4XZQB 2ZY5A 5B2ID 4KUDC 4J8UD 3REJB 1P3IC 3AYWA 4H9SC 1P3LB 1TAFB 1R4VA 3REKC 1M1AB 2G5IC 3AZIB 5FUGB 3AV1B 3REHD 5B24B 2CV5A 1P3KB 3WA9D 2RVQC 5B1MB 4WJ3C 4WNNA 4E44A 3REIC 4KUDD 5CP6A 1BH9A 1P3OC 1P3ID 3AZFA 2Y2IA 4J8UB 3AZLA 3VH5A 5CPIB 5B0YB 3B6GA 5AY8A 3WAAC 3REKD 3MGPA 3KUYB 3MVDC 5B1LB 2J8PA 3NQJA 4E45A 4YS3C 5JA4A 2HIOA 2RVQD 5B32D 5C3IC 1M18A 5DNMC 5B33D 1KX3B 1Q9CA 3C1BA 1B6WA 1P3MD 1Z2CB 2FJ7C 3WAAD 2UWXA 4Z66C 3MVDD 1WWIA 5GXQA 3WKJB 1M19B 2HUEC 5CPKB 4YS3D 2JSSA 3UT9C 3TU4C 3RELA 1HQ3A 3AN2C 5BNXB 5GT3C 1U35C 3WTPA 4XUJA 3X1TA 5CPJA 1P3BA 4Z2MG 3LZ1A 2NZDC 3MGQA 3REIB 5AV6D 3B0CT 3AZED 1KX5B 1P3OB 3R45A 2Y2NA 4J8WC 4J8VA 5GT0A 2FJ7D 1F66C 4Z66D 2Y2PA 4JJNC 3LELC 5KDMB 3MVDB 3UTBA 2YFVA 5JRGC 3UT9D 3TU4D 3AN2D 4YS3B 3AZNC 4R8PA 1U35D 3B0CW 5C3IB 1P3FA 1AOIC 3AZKC 2NZDD 5DNMB 3AZHC 3MNNB 5AV9A 2LY8A 5F99B 3AZGC 4UUZA 4WU8B 1EQZB 2NQBC 4Z5TA 3W98A 4NE5A 1KX4B 4JJND 3LELD 1A7WA 3AZMC 4Z66B 1ZLAD 2HUEB 4X23C 5B40C 3AL0C 3AZND 4QLCB 3UT9B 4H9NA 4EO5B 3AN2B 5GT3B 3W97A 5AV8A 3NQUA 3AZJA 4CSRB 3AZKD 3UTAB 5BNVB 1PZRA 5B31G 2CV5C 2NZDB 3AZGD 2F8NG 4LD9C 1JFIA 3AFAA 3LJAA 2NQBD 5CP6C 4J8WB 3W99C 5DNNA 1BH8A 3AZMD 1F66B 5E5AA 4JJNB 3LELB 3AYWD 3MGRA 3B6GC 5B2JB 5JRGB 5AVCC 3MGPC 3X1SB 4H9PA 3LZ0A 2YFWB 3X1UA 1AOIB 3AZKB 2IO5C 2CV5D 2G5HC 5B2IC 4DRBA 4J8XC 3AZHB 4KGCA 5B31B 3B0DB 4LD9D 3AZGB 3AV2B 4KHAB 2F8NB 5CP6D 3X1VA 3W99D 5BT1C 2NQBB 1P34A 5AV5B 3AZFD 3O62A 3AZMB 4H9OB 3B6GD 5B40B 4X23B 3REHC 5AVCD 5BO0A 2ZY2A 5AVBA 3MGPD 4DQYB 3WA9C 5GXQC 1P3PB 3RELC 2HIOD 1HQ3C 4J8XD 4AWLC 4YM6B 5GSUC 3C1CA 1P3AA 5CPJC 4LD9B 5BT1D 3KXBA 1F1EA 3C1BD 3W99B 1ID3A 2PYOA 4H9RB 4J8VC 4ZUXB 1P3GB 5GXQD 5AVCB 5B32C 3A6NA 3UTBC 3RELD 1HQ3D 3KWQA 2XD5A 5B33C 2IO5B 5GSUD 5B2IB 4J8XB 5CPJD 1P3BD 3W96A 3LZ1D 1P3MC 5AV9C 2ZY3A
chains in the Genus database with same CATH topology
4J8VD 4Z5TC 4XZQA 3REHB 5B32G 3WA9B 3UTBD 3REJA 5AV6C 4KUDB 3AZEC 3W97C 3MGSC 1P3FD 5GSUB 4G91C 1TAFA 3KFUG 4WU9C 1P3IB 4H9QB 1M1AA 2BYKB 5AV9D 3AZIA 5FUGA 1H3OB 5B0ZC 3AV1A 5B24A 3AFAC 3REKB 1P3KA 4Z5TD 3W98D 5B1MA 5E5AC 5B32B 4J8UA 5B33B 5CPIA 3W97D 3MGSD 5B0YA 1TZYC 3VH6T 4WU9D 3KUYA 5B1LA 1P3MB 5B0ZD 4KGCC 3AFAD 3LJAD 3WAAB 1ZLAC 1S32C 1W2EA 5E5AD 2DF4C 2ZM5A 1KX3A 3MGRD 3O62C 2ZY4A 3VH6W 2AROC 5AVBC 3V9RB 1TZYD 3LZ0D 5AV6B 2F8NK 4H9SA 3AZEB 3MGSB 4G91B 3WKJA 1M19A 4WU9B 5CPKA 4KGCD 2JE5A 2Y2MA 2FJ7B 5B0ZB 5BNXA 3FDDA 1S32D 3X1VD 3AYWC 3TU4B 3O62D 3REIA 1U35B 2BG1A 1KX5A 2AROD 1P3OA 3H0RC 5AVBD 3A6NC 1TZYB 4ZBJC 5KDMA 1N1JB 3MVDA 3C1CD 4YS3A 3W96C 3VH5W 4WV4B 3AZFC 3AZLC 1ZLAB 3KXBD 1S32B 5AY8C 1ID3D 3EG5B 3AZNB 2PYOD 4M6BA 2CWEA 5DNMA 3A1KA 3MNNA 2VQRA 4CAYB 5F99A 3O62B 4WU8A 2HIOC 2AROB 2W8SA 1EQZA 3A6ND 2Y2OA 5BS7A 1M18C 5G49B 1KX4A 2BYMA 3KWQD 3REJC 4Z66A 3C1BC 4QLCA 3UT9A 3W96D 3AZLD 3AN2A 3F6TA 5GT3A 5AY8D 3AYWB 4CSRA 1ULYA 3UTAA 5BNVA 2NZDA 4XZQD 2Y2GA 2CV5B 4J8WA 1T3UA 4Z2MH 3WTPC 4XUJC 3X1TC 3A6NB 1P3BC 1M18D 4WNNB 4ZBJB 3LZ1C 3REJD 4JJNA 3MGQC 1F66A 3LELA 5CP6B 5CPIC 5B2JA 1WWSA 5JRGA 1BH9B 3P5JB 3B6FA 3AZFB 3EPLA 3KUYC 3AZID 5GT0C 3AZLB 2JCHA 3X1SA 3B6GB 5B24D 2YFWA 5AY8B 1AOIA 3MGPB 3WTPE 3AZHA 5B1MD 5B31A 3NQJB 3AZGA 5JA4B 4R8PC 4KHAA 2HIOB 3AV2A 2F8NA 3WTPD 1KX3C 4XUJD 3X1TD 2NQBA 1P3FC 1M18B 5AV5A 3MGQD 2Y2LA 5CPID 3AZMA 2Y2HA 4H9OA 5B0YD 5B40A 2Y2JA 4X23A 3C1BB 3KUYD 5GT0D 5B1LD 3WKJC 1P3PA 1M19C 5CPKC 3W98C 5GXQB 4YM6A 2DQNC 4G92C 4R8PD 3RELB 1HQ3B 4NE6A 4LD9A 1KX3D 4AWLB 1P3LA 3WTPB 5AV8C 3AZJC 4XUJB 3X1TB 5CPJB 1P3BB 1KX5C 3W99A 4H9RA 3LZ1B 3MGQB 2F8NH 4NE3A 4ZUXA 3LJAC 1P3GA 5AVCA 3WKJD 4HGAC 3R45B 5CPKD 4J8VB 1M19D 5GT0B 5DNNC 3EPHA 3MGRC 5B2IA 4J8XA 3UTBB 2YFVB 3REID 4R8PB 3MNNC 5AV8D 3LZ0C 3AZJD 1KX5D 5F99C 1P3OD 3X1UC 1P3FB 4WU8C 1EQZC 4UPKA 5AV9B 5BS7C 1B67A 1KX4C 3REHA 4UUZB 3X1VC 3WA9A 5DNND 4Z5TB 3W98B 1P34C 4QLCC 2Y2KA 4EO5C 2FFFB 3EPKA 4KUDA 5GSUA 3EPJA 4G92B 2Y2QA 4H9NB 5DNMD 1P3IA 4H9QA 3UTAC 3MNND 2BYKA 3H0MC 1H3OA 5F99D 3X1UD 3W97B 5AV8B 3NQUB 3AZJB 4WU8D 4NFTA 1EQZD 3REKA 3B0BA 1P3AC 3C1CC 1KX4D 2RIQA 1KU5A 1JFIB 3AFAB 3LJAB 4HGAB 5B32A 3VH5T 3KXBC 2L5AA 1P34D 4QLCD 5B2JC 1ID3C 5DNNB 2PYOC 1BH8B 5E5AB 5GT3D 5B33A 3B6FC 3MGRB 3X1SC 3UTAD 1P3MA 1HTAA 3LZ0B 4H9PB 5B31C 3B0DC 3KWQC 3X1UB 3WAAA 3AV2C 4J8WD 1P3AD 4DRAA 4KGCB 3H0LC 1F66D 5AV5C 2BYMB 2XD1A 3X1VB 5B2JD 5JRGD 1P34B 3B6FD 3V9RA 3X1SD 5AV6A 1P3PC 3AZEA 3MGSA 4XZQC 1AOID 5BO0B 5AVBB 4WU9A 3AZHD 5B31D 4YM6C 4WZSB 2FJ7A 5B0ZA 3AV2D 2F8ND 1P3LC 1P3AB 3C1CB 3TU4A 5AV5D 3IP4C 1M1AC 1U35A 3AZIC 3AV1C 5B40D 4X23D 5B24C 3KXBB 1BFMA 1ID3B 4ZUXC 1P3KC 1P3GC 2PYOB 1P3PD 3B6FB 5B1MC 1TZYA 3A1IA 1N1JA 4YM6D 3KWQB 4J8UC 1ZLAA 5B0YC 1P3LD 1S32A 3AZNA 3W96B 1M1AD 5B1LC 3AV1D 4CAYA 3KSYA 3AZKA 4ZUXD 1P3KD 1P3GD 2AROA 5CHLB 3VH6A 5G49A 2F2AC 4XZQB 2ZY5A 5B2ID 4KUDC 4J8UD 3REJB 1P3IC 3AYWA 4H9SC 1P3LB 1TAFB 1R4VA 3REKC 1M1AB 2G5IC 3AZIB 5FUGB 3AV1B 3REHD 5B24B 2CV5A 1P3KB 3WA9D 2RVQC 5B1MB 4WJ3C 4WNNA 4E44A 3REIC 4KUDD 5CP6A 1BH9A 1P3OC 1P3ID 3AZFA 2Y2IA 4J8UB 3AZLA 3VH5A 5CPIB 5B0YB 3B6GA 5AY8A 3WAAC 3REKD 3MGPA 3KUYB 3MVDC 5B1LB 2J8PA 3NQJA 4E45A 4YS3C 5JA4A 2HIOA 2RVQD 5B32D 5C3IC 1M18A 5DNMC 5B33D 1KX3B 1Q9CA 3C1BA 1B6WA 1P3MD 1Z2CB 2FJ7C 3WAAD 2UWXA 4Z66C 3MVDD 1WWIA 5GXQA 3WKJB 1M19B 2HUEC 5CPKB 4YS3D 2JSSA 3UT9C 3TU4C 3RELA 1HQ3A 3AN2C 5BNXB 5GT3C 1U35C 3WTPA 4XUJA 3X1TA 5CPJA 1P3BA 4Z2MG 3LZ1A 2NZDC 3MGQA 3REIB 5AV6D 3B0CT 3AZED 1KX5B 1P3OB 3R45A 2Y2NA 4J8WC 4J8VA 5GT0A 2FJ7D 1F66C 4Z66D 2Y2PA 4JJNC 3LELC 5KDMB 3MVDB 3UTBA 2YFVA 5JRGC 3UT9D 3TU4D 3AN2D 4YS3B 3AZNC 4R8PA 1U35D 3B0CW 5C3IB 1P3FA 1AOIC 3AZKC 2NZDD 5DNMB 3AZHC 3MNNB 5AV9A 2LY8A 5F99B 3AZGC 4UUZA 4WU8B 1EQZB 2NQBC 4Z5TA 3W98A 4NE5A 1KX4B 4JJND 3LELD 1A7WA 3AZMC 4Z66B 1ZLAD 2HUEB 4X23C 5B40C 3AL0C 3AZND 4QLCB 3UT9B 4H9NA 4EO5B 3AN2B 5GT3B 3W97A 5AV8A 3NQUA 3AZJA 4CSRB 3AZKD 3UTAB 5BNVB 1PZRA 5B31G 2CV5C 2NZDB 3AZGD 2F8NG 4LD9C 1JFIA 3AFAA 3LJAA 2NQBD 5CP6C 4J8WB 3W99C 5DNNA 1BH8A 3AZMD 1F66B 5E5AA 4JJNB 3LELB 3AYWD 3MGRA 3B6GC 5B2JB 5JRGB 5AVCC 3MGPC 3X1SB 4H9PA 3LZ0A 2YFWB 3X1UA 1AOIB 3AZKB 2IO5C 2CV5D 2G5HC 5B2IC 4DRBA 4J8XC 3AZHB 4KGCA 5B31B 3B0DB 4LD9D 3AZGB 3AV2B 4KHAB 2F8NB 5CP6D 3X1VA 3W99D 5BT1C 2NQBB 1P34A 5AV5B 3AZFD 3O62A 3AZMB 4H9OB 3B6GD 5B40B 4X23B 3REHC 5AVCD 5BO0A 2ZY2A 5AVBA 3MGPD 4DQYB 3WA9C 5GXQC 1P3PB 3RELC 2HIOD 1HQ3C 4J8XD 4AWLC 4YM6B 5GSUC 3C1CA 1P3AA 5CPJC 4LD9B 5BT1D 3KXBA 1F1EA 3C1BD 3W99B 1ID3A 2PYOA 4H9RB 4J8VC 4ZUXB 1P3GB 5GXQD 5AVCB 5B32C 3A6NA 3UTBC 3RELD 1HQ3D 3KWQA 2XD5A 5B33C 2IO5B 5GSUD 5B2IB 4J8XB 5CPJD 1P3BD 3W96A 3LZ1D 1P3MC 5AV9C 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V D;  4Z5T C;  4XZQ A;  3REH B;  5B32 G;  3WA9 B;  3UTB D;  3REJ A;  5AV6 C;  4KUD B;  3AZE C;  3W97 C;  3MGS C;  1P3F D;  5GSU B;  4G91 C;  1TAF A;  4WU9 C;  1P3I B;  4H9Q B;  1M1A A;  2BYK B;  5AV9 D;  3AZI A;  5FUG A;  1H3O B;  5B0Z C;  3AV1 A;  5B24 A;  3AFA C;  3REK B;  1P3K A;  4Z5T D;  3W98 D;  5B1M A;  5E5A C;  5B32 B;  4J8U A;  5B33 B;  5CPI A;  3W97 D;  3MGS D;  5B0Y A;  1TZY C;  3VH6 T;  4WU9 D;  3KUY A;  5B1L A;  1P3M B;  5B0Z D;  4KGC C;  3AFA D;  3LJA D;  3WAA B;  1ZLA C;  1S32 C;  5E5A D;  1KX3 A;  3MGR D;  3O62 C;  3VH6 W;  2ARO C;  5AVB C;  3V9R B;  1TZY D;  3LZ0 D;  5AV6 B;  2F8N K;  4H9S A;  3AZE B;  3MGS B;  4G91 B;  3WKJ A;  1M19 A;  4WU9 B;  5CPK A;  4KGC D;  2FJ7 B;  5B0Z B;  5BNX A;  1S32 D;  3X1V D;  3AYW C;  3TU4 B;  3O62 D;  3REI A;  1U35 B;  1KX5 A;  2ARO D;  1P3O A;  5AVB D;  3A6N C;  1TZY B;  4ZBJ C;  5KDM A;  1N1J B;  3MVD A;  3C1C D;  4YS3 A;  3W96 C;  3VH5 W;  4WV4 B;  3AZF C;  3AZL C;  1ZLA B;  3KXB D;  1S32 B;  5AY8 C;  1ID3 D;  3AZN B;  2PYO D;  4M6B A;  2CWE A;  5DNM A;  3MNN A;  4CAY B;  5F99 A;  3O62 B;  4WU8 A;  2HIO C;  2ARO B;  1EQZ A;  3A6N D;  5BS7 A;  1M18 C;  5G49 B;  1KX4 A;  2BYM A;  3KWQ D;  3REJ C;  4Z66 A;  3C1B C;  4QLC A;  3UT9 A;  3W96 D;  3AZL D;  3AN2 A;  5GT3 A;  5AY8 D;  3AYW B;  4CSR A;  1ULY A;  3UTA A;  5BNV A;  2NZD A;  4XZQ D;  2CV5 B;  4J8W A;  3WTP C;  4Z2M H;  1M18 D;  4XUJ C;  3X1T C;  3A6N B;  1P3B C;  4WNN B;  4ZBJ B;  3LZ1 C;  3REJ D;  4JJN A;  3MGQ C;  1F66 A;  3LEL A;  5CP6 B;  5CPI C;  5B2J A;  1WWS A;  5JRG A;  1BH9 B;  3B6F A;  3AZF B;  3KUY C;  3AZI D;  5GT0 C;  3AZL B;  3X1S A;  3B6G B;  5B24 D;  2YFW A;  5AY8 B;  1AOI A;  3MGP B;  3WTP E;  3AZH A;  5B1M D;  5B31 A;  3NQJ B;  3AZG A;  5JA4 B;  4R8P C;  4KHA A;  2HIO B;  3AV2 A;  2F8N A;  3WTP D;  1KX3 C;  4XUJ D;  3X1T D;  2NQB A;  1P3F C;  1M18 B;  5AV5 A;  3MGQ D;  5CPI D;  3AZM A;  4H9O A;  5B0Y D;  5B40 A;  4X23 A;  3C1B B;  3KUY D;  5GT0 D;  5B1L D;  3WKJ C;  1P3P A;  1M19 C;  5CPK C;  3W98 C;  5GXQ B;  4YM6 A;  4G92 C;  4R8P D;  3REL B;  1HQ3 B;  4NE6 A;  4LD9 A;  1KX3 D;  4AWL B;  1P3L A;  3WTP B;  5AV8 C;  3AZJ C;  4XUJ B;  3X1T B;  5CPJ B;  1P3B B;  1KX5 C;  3W99 A;  4H9R A;  3LZ1 B;  3MGQ B;  2F8N H;  4NE3 A;  4ZUX A;  3LJA C;  1P3G A;  5AVC A;  3WKJ D;  4HGA C;  3R45 B;  5CPK D;  4J8V B;  1M19 D;  5GT0 B;  5DNN C;  3MGR C;  5B2I A;  4J8X A;  3UTB B;  2YFV B;  3REI D;  4R8P B;  3MNN C;  5AV8 D;  3LZ0 C;  3AZJ D;  1KX5 D;  5F99 C;  1P3O D;  3X1U C;  1P3F B;  4WU8 C;  1EQZ C;  5AV9 B;  5BS7 C;  1B67 A;  1KX4 C;  3REH A;  4UUZ B;  3X1V C;  3WA9 A;  5DNN D;  4Z5T B;  3W98 B;  1P34 C;  4QLC C;  4EO5 C;  4KUD A;  5GSU A;  4G92 B;  4H9N B;  5DNM D;  1P3I A;  4H9Q A;  3UTA C;  3MNN D;  2BYK A;  5F99 D;  1H3O A;  3X1U D;  3W97 B;  5AV8 B;  3NQU B;  3AZJ B;  4WU8 D;  4NFT A;  1EQZ D;  3REK A;  3B0B A;  1P3A C;  3C1C C;  1KX4 D;  1KU5 A;  1JFI B;  3AFA B;  3LJA B;  4HGA B;  5B32 A;  3VH5 T;  3KXB C;  2L5A A;  1P34 D;  4QLC D;  5B2J C;  1ID3 C;  5DNN B;  2PYO C;  1BH8 B;  5E5A B;  5GT3 D;  5B33 A;  3B6F C;  3MGR B;  3X1S C;  3UTA D;  1P3M A;  1HTA A;  3LZ0 B;  4H9P B;  5B31 C;  3B0D C;  3KWQ C;  3X1U B;  3WAA A;  3AV2 C;  4J8W D;  1P3A D;  4DRA A;  4KGC B;  1F66 D;  5AV5 C;  2BYM B;  3X1V B;  5B2J D;  5JRG D;  1P34 B;  3B6F D;  3V9R A;  3X1S D;  5AV6 A;  1P3P C;  3AZE A;  3MGS A;  4XZQ C;  1AOI D;  5BO0 B;  5AVB B;  4WU9 A;  3AZH D;  5B31 D;  4YM6 C;  4WZS B;  2FJ7 A;  5B0Z A;  3AV2 D;  2F8N D;  1P3L C;  1P3A B;  3C1C B;  3TU4 A;  5AV5 D;  1M1A C;  1U35 A;  3AZI C;  3AV1 C;  5B40 D;  4X23 D;  5B24 C;  3KXB B;  1BFM A;  1ID3 B;  4ZUX C;  1P3K C;  1P3G C;  2PYO B;  1P3P D;  3B6F B;  5B1M C;  1TZY A;  1N1J A;  4YM6 D;  3KWQ B;  4J8U C;  1ZLA A;  5B0Y C;  1P3L D;  1S32 A;  3AZN A;  3W96 B;  1M1A D;  5B1L C;  3AV1 D;  4CAY A;  3KSY A;  3AZK A;  4ZUX D;  1P3K D;  1P3G D;  2ARO A;  5CHL B;  3VH6 A;  5G49 A;  4XZQ B;  5B2I D;  4KUD C;  4J8U D;  3REJ B;  1P3I C;  3AYW A;  4H9S C;  1P3L B;  1TAF B;  1R4V A;  3REK C;  1M1A B;  3AZI B;  5FUG B;  3AV1 B;  3REH D;  5B24 B;  2CV5 A;  1P3K B;  3WA9 D;  2RVQ C;  5B1M B;  4WNN A;  4E44 A;  3REI C;  4KUD D;  5CP6 A;  1BH9 A;  1P3O C;  1P3I D;  3AZF A;  4J8U B;  3AZL A;  3VH5 A;  5CPI B;  5B0Y B;  3B6G A;  5AY8 A;  3WAA C;  3REK D;  3MGP A;  3KUY B;  3MVD C;  5B1L B;  3NQJ A;  4E45 A;  4YS3 C;  5JA4 A;  2HIO A;  2RVQ D;  5B32 D;  5C3I C;  1M18 A;  5DNM C;  5B33 D;  1KX3 B;  1Q9C A;  3C1B A;  1B6W A;  1P3M D;  2FJ7 C;  3WAA D;  4Z66 C;  3MVD D;  1WWI A;  5GXQ A;  3WKJ B;  1M19 B;  2HUE C;  5CPK B;  4YS3 D;  2JSS A;  3UT9 C;  3TU4 C;  3REL A;  1HQ3 A;  3AN2 C;  5BNX B;  5GT3 C;  1U35 C;  3WTP A;  4XUJ A;  3X1T A;  5CPJ A;  1P3B A;  4Z2M G;  3LZ1 A;  2NZD C;  3MGQ A;  3REI B;  5AV6 D;  3B0C T;  3AZE D;  1KX5 B;  1P3O B;  3R45 A;  4J8W C;  4J8V A;  5GT0 A;  2FJ7 D;  1F66 C;  4Z66 D;  4JJN C;  3LEL C;  5KDM B;  3MVD B;  3UTB A;  2YFV A;  5JRG C;  3UT9 D;  3TU4 D;  3AN2 D;  4YS3 B;  3AZN C;  4R8P A;  1U35 D;  3B0C W;  5C3I B;  1P3F A;  1AOI C;  3AZK C;  2NZD D;  5DNM B;  3AZH C;  3MNN B;  5AV9 A;  2LY8 A;  5F99 B;  3AZG C;  4UUZ A;  4WU8 B;  1EQZ B;  2NQB C;  4Z5T A;  3W98 A;  4NE5 A;  1KX4 B;  4JJN D;  3LEL D;  1A7W A;  3AZM C;  4Z66 B;  1ZLA D;  2HUE B;  4X23 C;  5B40 C;  3AZN D;  4QLC B;  3UT9 B;  4H9N A;  4EO5 B;  3AN2 B;  5GT3 B;  3W97 A;  5AV8 A;  3NQU A;  3AZJ A;  4CSR B;  3AZK D;  3UTA B;  5BNV B;  5B31 G;  2CV5 C;  2NZD B;  3AZG D;  2F8N G;  4LD9 C;  1JFI A;  3AFA A;  3LJA A;  2NQB D;  5CP6 C;  4J8W B;  3W99 C;  5DNN A;  1BH8 A;  3AZM D;  1F66 B;  5E5A A;  4JJN B;  3LEL B;  3AYW D;  3MGR A;  3B6G C;  5B2J B;  5JRG B;  5AVC C;  3MGP C;  3X1S B;  4H9P A;  3LZ0 A;  2YFW B;  3X1U A;  1AOI B;  3AZK B;  2IO5 C;  2CV5 D;  5B2I C;  4DRB A;  4J8X C;  3AZH B;  4KGC A;  5B31 B;  3B0D B;  4LD9 D;  3AZG B;  3AV2 B;  4KHA B;  2F8N B;  5CP6 D;  3X1V A;  3W99 D;  5BT1 C;  2NQB B;  1P34 A;  5AV5 B;  3AZF D;  3O62 A;  3AZM B;  4H9O B;  3B6G D;  5B40 B;  4X23 B;  3REH C;  5AVC D;  5BO0 A;  5AVB A;  3MGP D;  3WA9 C;  5GXQ C;  1P3P B;  3REL C;  2HIO D;  1HQ3 C;  4J8X D;  4AWL C;  4YM6 B;  5GSU C;  3C1C A;  1P3A A;  5CPJ C;  4LD9 B;  5BT1 D;  3KXB A;  1F1E A;  3C1B D;  3W99 B;  1ID3 A;  2PYO A;  4H9R B;  4J8V C;  4ZUX B;  1P3G B;  5GXQ D;  5AVC B;  5B32 C;  3A6N A;  3UTB C;  3REL D;  1HQ3 D;  3KWQ A;  5B33 C;  2IO5 B;  5GSU D;  5B2I B;  4J8X B;  5CPJ D;  1P3B D;  3W96 A;  3LZ1 D;  1P3M C;  5AV9 C; 
#chains in the Genus database with same CATH topology
 4J8V D;  4Z5T C;  4XZQ A;  3REH B;  5B32 G;  3WA9 B;  3UTB D;  3REJ A;  5AV6 C;  4KUD B;  3AZE C;  3W97 C;  3MGS C;  1P3F D;  5GSU B;  4G91 C;  1TAF A;  3KFU G;  4WU9 C;  1P3I B;  4H9Q B;  1M1A A;  2BYK B;  5AV9 D;  3AZI A;  5FUG A;  1H3O B;  5B0Z C;  3AV1 A;  5B24 A;  3AFA C;  3REK B;  1P3K A;  4Z5T D;  3W98 D;  5B1M A;  5E5A C;  5B32 B;  4J8U A;  5B33 B;  5CPI A;  3W97 D;  3MGS D;  5B0Y A;  1TZY C;  3VH6 T;  4WU9 D;  3KUY A;  5B1L A;  1P3M B;  5B0Z D;  4KGC C;  3AFA D;  3LJA D;  3WAA B;  1ZLA C;  1S32 C;  1W2E A;  5E5A D;  2DF4 C;  2ZM5 A;  1KX3 A;  3MGR D;  3O62 C;  2ZY4 A;  3VH6 W;  2ARO C;  5AVB C;  3V9R B;  1TZY D;  3LZ0 D;  5AV6 B;  2F8N K;  4H9S A;  3AZE B;  3MGS B;  4G91 B;  3WKJ A;  1M19 A;  4WU9 B;  5CPK A;  4KGC D;  2JE5 A;  2Y2M A;  2FJ7 B;  5B0Z B;  5BNX A;  3FDD A;  1S32 D;  3X1V D;  3AYW C;  3TU4 B;  3O62 D;  3REI A;  1U35 B;  2BG1 A;  1KX5 A;  2ARO D;  1P3O A;  3H0R C;  5AVB D;  3A6N C;  1TZY B;  4ZBJ C;  5KDM A;  1N1J B;  3MVD A;  3C1C D;  4YS3 A;  3W96 C;  3VH5 W;  4WV4 B;  3AZF C;  3AZL C;  1ZLA B;  3KXB D;  1S32 B;  5AY8 C;  1ID3 D;  3EG5 B;  3AZN B;  2PYO D;  4M6B A;  2CWE A;  5DNM A;  3A1K A;  3MNN A;  2VQR A;  4CAY B;  5F99 A;  3O62 B;  4WU8 A;  2HIO C;  2ARO B;  2W8S A;  1EQZ A;  3A6N D;  2Y2O A;  5BS7 A;  1M18 C;  5G49 B;  1KX4 A;  2BYM A;  3KWQ D;  3REJ C;  4Z66 A;  3C1B C;  4QLC A;  3UT9 A;  3W96 D;  3AZL D;  3AN2 A;  3F6T A;  5GT3 A;  5AY8 D;  3AYW B;  4CSR A;  1ULY A;  3UTA A;  5BNV A;  2NZD A;  4XZQ D;  2Y2G A;  2CV5 B;  4J8W A;  1T3U A;  4Z2M H;  3WTP C;  4XUJ C;  3X1T C;  3A6N B;  1P3B C;  1M18 D;  4WNN B;  4ZBJ B;  3LZ1 C;  3REJ D;  4JJN A;  3MGQ C;  1F66 A;  3LEL A;  5CP6 B;  5CPI C;  5B2J A;  1WWS A;  5JRG A;  1BH9 B;  3P5J B;  3B6F A;  3AZF B;  3EPL A;  3KUY C;  3AZI D;  5GT0 C;  3AZL B;  2JCH A;  3X1S A;  3B6G B;  5B24 D;  2YFW A;  5AY8 B;  1AOI A;  3MGP B;  3WTP E;  3AZH A;  5B1M D;  5B31 A;  3NQJ B;  3AZG A;  5JA4 B;  4R8P C;  4KHA A;  2HIO B;  3AV2 A;  2F8N A;  3WTP D;  1KX3 C;  4XUJ D;  3X1T D;  2NQB A;  1P3F C;  1M18 B;  5AV5 A;  3MGQ D;  2Y2L A;  5CPI D;  3AZM A;  2Y2H A;  4H9O A;  5B0Y D;  5B40 A;  2Y2J A;  4X23 A;  3C1B B;  3KUY D;  5GT0 D;  5B1L D;  3WKJ C;  1P3P A;  1M19 C;  5CPK C;  3W98 C;  5GXQ B;  4YM6 A;  2DQN C;  4G92 C;  4R8P D;  3REL B;  1HQ3 B;  4NE6 A;  4LD9 A;  1KX3 D;  4AWL B;  1P3L A;  3WTP B;  5AV8 C;  3AZJ C;  4XUJ B;  3X1T B;  5CPJ B;  1P3B B;  1KX5 C;  3W99 A;  4H9R A;  3LZ1 B;  3MGQ B;  2F8N H;  4NE3 A;  4ZUX A;  3LJA C;  1P3G A;  5AVC A;  3WKJ D;  4HGA C;  3R45 B;  5CPK D;  4J8V B;  1M19 D;  5GT0 B;  5DNN C;  3EPH A;  3MGR C;  5B2I A;  4J8X A;  3UTB B;  2YFV B;  3REI D;  4R8P B;  3MNN C;  5AV8 D;  3LZ0 C;  3AZJ D;  1KX5 D;  5F99 C;  1P3O D;  3X1U C;  1P3F B;  4WU8 C;  1EQZ C;  4UPK A;  5AV9 B;  5BS7 C;  1B67 A;  1KX4 C;  3REH A;  4UUZ B;  3X1V C;  3WA9 A;  5DNN D;  4Z5T B;  3W98 B;  1P34 C;  4QLC C;  2Y2K A;  4EO5 C;  2FFF B;  3EPK A;  4KUD A;  5GSU A;  3EPJ A;  4G92 B;  2Y2Q A;  4H9N B;  5DNM D;  1P3I A;  4H9Q A;  3UTA C;  3MNN D;  2BYK A;  3H0M C;  1H3O A;  5F99 D;  3X1U D;  3W97 B;  5AV8 B;  3NQU B;  3AZJ B;  4WU8 D;  4NFT A;  1EQZ D;  3REK A;  3B0B A;  1P3A C;  3C1C C;  1KX4 D;  2RIQ A;  1KU5 A;  1JFI B;  3AFA B;  3LJA B;  4HGA B;  5B32 A;  3VH5 T;  3KXB C;  2L5A A;  1P34 D;  4QLC D;  5B2J C;  1ID3 C;  5DNN B;  2PYO C;  1BH8 B;  5E5A B;  5GT3 D;  5B33 A;  3B6F C;  3MGR B;  3X1S C;  3UTA D;  1P3M A;  1HTA A;  3LZ0 B;  4H9P B;  5B31 C;  3B0D C;  3KWQ C;  3X1U B;  3WAA A;  3AV2 C;  4J8W D;  1P3A D;  4DRA A;  4KGC B;  3H0L C;  1F66 D;  5AV5 C;  2BYM B;  2XD1 A;  3X1V B;  5B2J D;  5JRG D;  1P34 B;  3B6F D;  3V9R A;  3X1S D;  5AV6 A;  1P3P C;  3AZE A;  3MGS A;  4XZQ C;  1AOI D;  5BO0 B;  5AVB B;  4WU9 A;  3AZH D;  5B31 D;  4YM6 C;  4WZS B;  2FJ7 A;  5B0Z A;  3AV2 D;  2F8N D;  1P3L C;  1P3A B;  3C1C B;  3TU4 A;  5AV5 D;  3IP4 C;  1M1A C;  1U35 A;  3AZI C;  3AV1 C;  5B40 D;  4X23 D;  5B24 C;  3KXB B;  1BFM A;  1ID3 B;  4ZUX C;  1P3K C;  1P3G C;  2PYO B;  1P3P D;  3B6F B;  5B1M C;  1TZY A;  3A1I A;  1N1J A;  4YM6 D;  3KWQ B;  4J8U C;  1ZLA A;  5B0Y C;  1P3L D;  1S32 A;  3AZN A;  3W96 B;  1M1A D;  5B1L C;  3AV1 D;  4CAY A;  3KSY A;  3AZK A;  4ZUX D;  1P3K D;  1P3G D;  2ARO A;  5CHL B;  3VH6 A;  5G49 A;  2F2A C;  4XZQ B;  2ZY5 A;  5B2I D;  4KUD C;  4J8U D;  3REJ B;  1P3I C;  3AYW A;  4H9S C;  1P3L B;  1TAF B;  1R4V A;  3REK C;  1M1A B;  2G5I C;  3AZI B;  5FUG B;  3AV1 B;  3REH D;  5B24 B;  2CV5 A;  1P3K B;  3WA9 D;  2RVQ C;  5B1M B;  4WJ3 C;  4WNN A;  4E44 A;  3REI C;  4KUD D;  5CP6 A;  1BH9 A;  1P3O C;  1P3I D;  3AZF A;  2Y2I A;  4J8U B;  3AZL A;  3VH5 A;  5CPI B;  5B0Y B;  3B6G A;  5AY8 A;  3WAA C;  3REK D;  3MGP A;  3KUY B;  3MVD C;  5B1L B;  2J8P A;  3NQJ A;  4E45 A;  4YS3 C;  5JA4 A;  2HIO A;  2RVQ D;  5B32 D;  5C3I C;  1M18 A;  5DNM C;  5B33 D;  1KX3 B;  1Q9C A;  3C1B A;  1B6W A;  1P3M D;  1Z2C B;  2FJ7 C;  3WAA D;  2UWX A;  4Z66 C;  3MVD D;  1WWI A;  5GXQ A;  3WKJ B;  1M19 B;  2HUE C;  5CPK B;  4YS3 D;  2JSS A;  3UT9 C;  3TU4 C;  3REL A;  1HQ3 A;  3AN2 C;  5BNX B;  5GT3 C;  1U35 C;  3WTP A;  4XUJ A;  3X1T A;  5CPJ A;  1P3B A;  4Z2M G;  3LZ1 A;  2NZD C;  3MGQ A;  3REI B;  5AV6 D;  3B0C T;  3AZE D;  1KX5 B;  1P3O B;  3R45 A;  2Y2N A;  4J8W C;  4J8V A;  5GT0 A;  2FJ7 D;  1F66 C;  4Z66 D;  2Y2P A;  4JJN C;  3LEL C;  5KDM B;  3MVD B;  3UTB A;  2YFV A;  5JRG C;  3UT9 D;  3TU4 D;  3AN2 D;  4YS3 B;  3AZN C;  4R8P A;  1U35 D;  3B0C W;  5C3I B;  1P3F A;  1AOI C;  3AZK C;  2NZD D;  5DNM B;  3AZH C;  3MNN B;  5AV9 A;  2LY8 A;  5F99 B;  3AZG C;  4UUZ A;  4WU8 B;  1EQZ B;  2NQB C;  4Z5T A;  3W98 A;  4NE5 A;  1KX4 B;  4JJN D;  3LEL D;  1A7W A;  3AZM C;  4Z66 B;  1ZLA D;  2HUE B;  4X23 C;  5B40 C;  3AL0 C;  3AZN D;  4QLC B;  3UT9 B;  4H9N A;  4EO5 B;  3AN2 B;  5GT3 B;  3W97 A;  5AV8 A;  3NQU A;  3AZJ A;  4CSR B;  3AZK D;  3UTA B;  5BNV B;  1PZR A;  5B31 G;  2CV5 C;  2NZD B;  3AZG D;  2F8N G;  4LD9 C;  1JFI A;  3AFA A;  3LJA A;  2NQB D;  5CP6 C;  4J8W B;  3W99 C;  5DNN A;  1BH8 A;  3AZM D;  1F66 B;  5E5A A;  4JJN B;  3LEL B;  3AYW D;  3MGR A;  3B6G C;  5B2J B;  5JRG B;  5AVC C;  3MGP C;  3X1S B;  4H9P A;  3LZ0 A;  2YFW B;  3X1U A;  1AOI B;  3AZK B;  2IO5 C;  2CV5 D;  2G5H C;  5B2I C;  4DRB A;  4J8X C;  3AZH B;  4KGC A;  5B31 B;  3B0D B;  4LD9 D;  3AZG B;  3AV2 B;  4KHA B;  2F8N B;  5CP6 D;  3X1V A;  3W99 D;  5BT1 C;  2NQB B;  1P34 A;  5AV5 B;  3AZF D;  3O62 A;  3AZM B;  4H9O B;  3B6G D;  5B40 B;  4X23 B;  3REH C;  5AVC D;  5BO0 A;  2ZY2 A;  5AVB A;  3MGP D;  4DQY B;  3WA9 C;  5GXQ C;  1P3P B;  3REL C;  2HIO D;  1HQ3 C;  4J8X D;  4AWL C;  4YM6 B;  5GSU C;  3C1C A;  1P3A A;  5CPJ C;  4LD9 B;  5BT1 D;  3KXB A;  1F1E A;  3C1B D;  3W99 B;  1ID3 A;  2PYO A;  4H9R B;  4J8V C;  4ZUX B;  1P3G B;  5GXQ D;  5AVC B;  5B32 C;  3A6N A;  3UTB C;  3REL D;  1HQ3 D;  3KWQ A;  2XD5 A;  5B33 C;  2IO5 B;  5GSU D;  5B2I B;  4J8X B;  5CPJ D;  1P3B D;  3W96 A;  3LZ1 D;  1P3M C;  5AV9 C;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 4J8V D;  4Z5T C;  4XZQ A;  3REH B;  5B32 G;  3WA9 B;  3UTB D;  3REJ A;  5AV6 C;  4KUD B;  3AZE C;  3W97 C;  3MGS C;  1P3F D;  5GSU B;  4G91 C;  1TAF A;  3KFU G;  4WU9 C;  1P3I B;  4H9Q B;  1M1A A;  2BYK B;  5AV9 D;  3AZI A;  5FUG A;  1H3O B;  5B0Z C;  3AV1 A;  5B24 A;  3AFA C;  3REK B;  1P3K A;  4Z5T D;  3W98 D;  5B1M A;  5E5A C;  5B32 B;  4J8U A;  5B33 B;  5CPI A;  3W97 D;  3MGS D;  5B0Y A;  1TZY C;  3VH6 T;  4WU9 D;  3KUY A;  5B1L A;  1P3M B;  5B0Z D;  4KGC C;  3AFA D;  3LJA D;  3WAA B;  1ZLA C;  1S32 C;  1W2E A;  5E5A D;  2DF4 C;  2ZM5 A;  1KX3 A;  3MGR D;  3O62 C;  2ZY4 A;  3VH6 W;  2ARO C;  5AVB C;  3V9R B;  1TZY D;  3LZ0 D;  5AV6 B;  2F8N K;  4H9S A;  3AZE B;  3MGS B;  4G91 B;  3WKJ A;  1M19 A;  4WU9 B;  5CPK A;  4KGC D;  2JE5 A;  2Y2M A;  2FJ7 B;  5B0Z B;  5BNX A;  3FDD A;  1S32 D;  3X1V D;  3AYW C;  3TU4 B;  3O62 D;  3REI A;  1U35 B;  2BG1 A;  1KX5 A;  2ARO D;  1P3O A;  3H0R C;  5AVB D;  3A6N C;  1TZY B;  4ZBJ C;  5KDM A;  1N1J B;  3MVD A;  3C1C D;  4YS3 A;  3W96 C;  3VH5 W;  4WV4 B;  3AZF C;  3AZL C;  1ZLA B;  3KXB D;  1S32 B;  5AY8 C;  1ID3 D;  3EG5 B;  3AZN B;  2PYO D;  4M6B A;  2CWE A;  5DNM A;  3A1K A;  3MNN A;  2VQR A;  4CAY B;  5F99 A;  3O62 B;  4WU8 A;  2HIO C;  2ARO B;  2W8S A;  1EQZ A;  3A6N D;  2Y2O A;  5BS7 A;  1M18 C;  5G49 B;  1KX4 A;  2BYM A;  3KWQ D;  3REJ C;  4Z66 A;  3C1B C;  4QLC A;  3UT9 A;  3W96 D;  3AZL D;  3AN2 A;  3F6T A;  5GT3 A;  5AY8 D;  3AYW B;  4CSR A;  1ULY A;  3UTA A;  5BNV A;  2NZD A;  4XZQ D;  2Y2G A;  2CV5 B;  4J8W A;  1T3U A;  4Z2M H;  3WTP C;  4XUJ C;  3X1T C;  3A6N B;  1P3B C;  1M18 D;  4WNN B;  4ZBJ B;  3LZ1 C;  3REJ D;  4JJN A;  3MGQ C;  1F66 A;  3LEL A;  5CP6 B;  5CPI C;  5B2J A;  1WWS A;  5JRG A;  1BH9 B;  3P5J B;  3B6F A;  3AZF B;  3EPL A;  3KUY C;  3AZI D;  5GT0 C;  3AZL B;  2JCH A;  3X1S A;  3B6G B;  5B24 D;  2YFW A;  5AY8 B;  1AOI A;  3MGP B;  3WTP E;  3AZH A;  5B1M D;  5B31 A;  3NQJ B;  3AZG A;  5JA4 B;  4R8P C;  4KHA A;  2HIO B;  3AV2 A;  2F8N A;  3WTP D;  1KX3 C;  4XUJ D;  3X1T D;  2NQB A;  1P3F C;  1M18 B;  5AV5 A;  3MGQ D;  2Y2L A;  5CPI D;  3AZM A;  2Y2H A;  4H9O A;  5B0Y D;  5B40 A;  2Y2J A;  4X23 A;  3C1B B;  3KUY D;  5GT0 D;  5B1L D;  3WKJ C;  1P3P A;  1M19 C;  5CPK C;  3W98 C;  5GXQ B;  4YM6 A;  2DQN C;  4G92 C;  4R8P D;  3REL B;  1HQ3 B;  4NE6 A;  4LD9 A;  1KX3 D;  4AWL B;  1P3L A;  3WTP B;  5AV8 C;  3AZJ C;  4XUJ B;  3X1T B;  5CPJ B;  1P3B B;  1KX5 C;  3W99 A;  4H9R A;  3LZ1 B;  3MGQ B;  2F8N H;  4NE3 A;  4ZUX A;  3LJA C;  1P3G A;  5AVC A;  3WKJ D;  4HGA C;  3R45 B;  5CPK D;  4J8V B;  1M19 D;  5GT0 B;  5DNN C;  3EPH A;  3MGR C;  5B2I A;  4J8X A;  3UTB B;  2YFV B;  3REI D;  4R8P B;  3MNN C;  5AV8 D;  3LZ0 C;  3AZJ D;  1KX5 D;  5F99 C;  1P3O D;  3X1U C;  1P3F B;  4WU8 C;  1EQZ C;  4UPK A;  5AV9 B;  5BS7 C;  1B67 A;  1KX4 C;  3REH A;  4UUZ B;  3X1V C;  3WA9 A;  5DNN D;  4Z5T B;  3W98 B;  1P34 C;  4QLC C;  2Y2K A;  4EO5 C;  2FFF B;  3EPK A;  4KUD A;  5GSU A;  3EPJ A;  4G92 B;  2Y2Q A;  4H9N B;  5DNM D;  1P3I A;  4H9Q A;  3UTA C;  3MNN D;  2BYK A;  3H0M C;  1H3O A;  5F99 D;  3X1U D;  3W97 B;  5AV8 B;  3NQU B;  3AZJ B;  4WU8 D;  4NFT A;  1EQZ D;  3REK A;  3B0B A;  1P3A C;  3C1C C;  1KX4 D;  2RIQ A;  1KU5 A;  1JFI B;  3AFA B;  3LJA B;  4HGA B;  5B32 A;  3VH5 T;  3KXB C;  2L5A A;  1P34 D;  4QLC D;  5B2J C;  1ID3 C;  5DNN B;  2PYO C;  1BH8 B;  5E5A B;  5GT3 D;  5B33 A;  3B6F C;  3MGR B;  3X1S C;  3UTA D;  1P3M A;  1HTA A;  3LZ0 B;  4H9P B;  5B31 C;  3B0D C;  3KWQ C;  3X1U B;  3WAA A;  3AV2 C;  4J8W D;  1P3A D;  4DRA A;  4KGC B;  3H0L C;  1F66 D;  5AV5 C;  2BYM B;  2XD1 A;  3X1V B;  5B2J D;  5JRG D;  1P34 B;  3B6F D;  3V9R A;  3X1S D;  5AV6 A;  1P3P C;  3AZE A;  3MGS A;  4XZQ C;  1AOI D;  5BO0 B;  5AVB B;  4WU9 A;  3AZH D;  5B31 D;  4YM6 C;  4WZS B;  2FJ7 A;  5B0Z A;  3AV2 D;  2F8N D;  1P3L C;  1P3A B;  3C1C B;  3TU4 A;  5AV5 D;  3IP4 C;  1M1A C;  1U35 A;  3AZI C;  3AV1 C;  5B40 D;  4X23 D;  5B24 C;  3KXB B;  1BFM A;  1ID3 B;  4ZUX C;  1P3K C;  1P3G C;  2PYO B;  1P3P D;  3B6F B;  5B1M C;  1TZY A;  3A1I A;  1N1J A;  4YM6 D;  3KWQ B;  4J8U C;  1ZLA A;  5B0Y C;  1P3L D;  1S32 A;  3AZN A;  3W96 B;  1M1A D;  5B1L C;  3AV1 D;  4CAY A;  3KSY A;  3AZK A;  4ZUX D;  1P3K D;  1P3G D;  2ARO A;  5CHL B;  3VH6 A;  5G49 A;  2F2A C;  4XZQ B;  2ZY5 A;  5B2I D;  4KUD C;  4J8U D;  3REJ B;  1P3I C;  3AYW A;  4H9S C;  1P3L B;  1TAF B;  1R4V A;  3REK C;  1M1A B;  2G5I C;  3AZI B;  5FUG B;  3AV1 B;  3REH D;  5B24 B;  2CV5 A;  1P3K B;  3WA9 D;  2RVQ C;  5B1M B;  4WJ3 C;  4WNN A;  4E44 A;  3REI C;  4KUD D;  5CP6 A;  1BH9 A;  1P3O C;  1P3I D;  3AZF A;  2Y2I A;  4J8U B;  3AZL A;  3VH5 A;  5CPI B;  5B0Y B;  3B6G A;  5AY8 A;  3WAA C;  3REK D;  3MGP A;  3KUY B;  3MVD C;  5B1L B;  2J8P A;  3NQJ A;  4E45 A;  4YS3 C;  5JA4 A;  2HIO A;  2RVQ D;  5B32 D;  5C3I C;  1M18 A;  5DNM C;  5B33 D;  1KX3 B;  1Q9C A;  3C1B A;  1B6W A;  1P3M D;  1Z2C B;  2FJ7 C;  3WAA D;  2UWX A;  4Z66 C;  3MVD D;  1WWI A;  5GXQ A;  3WKJ B;  1M19 B;  2HUE C;  5CPK B;  4YS3 D;  2JSS A;  3UT9 C;  3TU4 C;  3REL A;  1HQ3 A;  3AN2 C;  5BNX B;  5GT3 C;  1U35 C;  3WTP A;  4XUJ A;  3X1T A;  5CPJ A;  1P3B A;  4Z2M G;  3LZ1 A;  2NZD C;  3MGQ A;  3REI B;  5AV6 D;  3B0C T;  3AZE D;  1KX5 B;  1P3O B;  3R45 A;  2Y2N A;  4J8W C;  4J8V A;  5GT0 A;  2FJ7 D;  1F66 C;  4Z66 D;  2Y2P A;  4JJN C;  3LEL C;  5KDM B;  3MVD B;  3UTB A;  2YFV A;  5JRG C;  3UT9 D;  3TU4 D;  3AN2 D;  4YS3 B;  3AZN C;  4R8P A;  1U35 D;  3B0C W;  5C3I B;  1P3F A;  1AOI C;  3AZK C;  2NZD D;  5DNM B;  3AZH C;  3MNN B;  5AV9 A;  2LY8 A;  5F99 B;  3AZG C;  4UUZ A;  4WU8 B;  1EQZ B;  2NQB C;  4Z5T A;  3W98 A;  4NE5 A;  1KX4 B;  4JJN D;  3LEL D;  1A7W A;  3AZM C;  4Z66 B;  1ZLA D;  2HUE B;  4X23 C;  5B40 C;  3AL0 C;  3AZN D;  4QLC B;  3UT9 B;  4H9N A;  4EO5 B;  3AN2 B;  5GT3 B;  3W97 A;  5AV8 A;  3NQU A;  3AZJ A;  4CSR B;  3AZK D;  3UTA B;  5BNV B;  1PZR A;  5B31 G;  2CV5 C;  2NZD B;  3AZG D;  2F8N G;  4LD9 C;  1JFI A;  3AFA A;  3LJA A;  2NQB D;  5CP6 C;  4J8W B;  3W99 C;  5DNN A;  1BH8 A;  3AZM D;  1F66 B;  5E5A A;  4JJN B;  3LEL B;  3AYW D;  3MGR A;  3B6G C;  5B2J B;  5JRG B;  5AVC C;  3MGP C;  3X1S B;  4H9P A;  3LZ0 A;  2YFW B;  3X1U A;  1AOI B;  3AZK B;  2IO5 C;  2CV5 D;  2G5H C;  5B2I C;  4DRB A;  4J8X C;  3AZH B;  4KGC A;  5B31 B;  3B0D B;  4LD9 D;  3AZG B;  3AV2 B;  4KHA B;  2F8N B;  5CP6 D;  3X1V A;  3W99 D;  5BT1 C;  2NQB B;  1P34 A;  5AV5 B;  3AZF D;  3O62 A;  3AZM B;  4H9O B;  3B6G D;  5B40 B;  4X23 B;  3REH C;  5AVC D;  5BO0 A;  2ZY2 A;  5AVB A;  3MGP D;  4DQY B;  3WA9 C;  5GXQ C;  1P3P B;  3REL C;  2HIO D;  1HQ3 C;  4J8X D;  4AWL C;  4YM6 B;  5GSU C;  3C1C A;  1P3A A;  5CPJ C;  4LD9 B;  5BT1 D;  3KXB A;  1F1E A;  3C1B D;  3W99 B;  1ID3 A;  2PYO A;  4H9R B;  4J8V C;  4ZUX B;  1P3G B;  5GXQ D;  5AVC B;  5B32 C;  3A6N A;  3UTB C;  3REL D;  1HQ3 D;  3KWQ A;  2XD5 A;  5B33 C;  2IO5 B;  5GSU D;  5B2I B;  4J8X B;  5CPJ D;  1P3B D;  3W96 A;  3LZ1 D;  1P3M C;  5AV9 C;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...