3WTPC

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpC00
5CP6A 3NQJB 3B0DB 5B2JB 3MGQC 5AVCA 1H3OB 1P3AA 5AY8D 3C1BA 1P3GA 1M1AC 1M19C 5AV5A 2YFVB 3VH6W 1P3KC 3REID 4M6BA 4H9PA 5E5AD 1HQ3B 2F8NB 3LZ0C 5CPJD 3UTAD 2NZDC 3X1SD 3AFAC 3X1UD 5B24C 5CPIA 3MVDB 4ZBJB 4WU9B 4YM6B 2NQBA 4NE5A 3AN2D 3W98A 3AZLB 5DNMD 4YS3B 4JJNB 3W97A 2FJ7D 1ZLAA 3REHC 3AZEC 3MGRB 3AZFA 3VH5T 3AZHD 3MVDC 3AZIA 4XZQA 4CSRB 5B2JA 4YS3C 1S32D 1ID3D 5GXQD 5AV6B 5DNND 1B67A 5AY8A 3KXBB 1U35D 1TZYD 3W96B 1HQ3A 1WWIA 1P3PC 5B0ZC 2L5AA 5G49B 1P3LD 3X1VD 1P3FD 1M18D 3B6FD 3WTPB 5AV6C 3LELC 1F66B 4J8UB 2YFWB 5CPJA 1P3IB 5JRGB 3WKJB 1KX5B 4HGAB 5BNXA 3AZKB 4QLCC 3VH5W 3MGSB 5C3IB 4JJNA 4KGCD 1F66C 4J8UC 3AV1C 1P3IC 3AZGD 5GSUB 3AV2D 1P34C 1KX5C 3AZHA 5B0YC 1BH9B 2BYMB 2CV5B 3MGSC 5C3IC 3TU4D 1P3MD 1AOID 4G91C 5DNNA 4H9NB 4Z5TD 1U35A 3AYWB 3LJAC 4XUJD 3V9RA 1P3LA 3WAAA 5GT3B 1P3BB 2YFWA 5F99D 5BT1D 4J8XB 5JRGA 3AZNC 3WKJA 3AZKA 3MGPD 3RELD 3LZ1B 2AROA 1EQZB 5AVCD 4Z66B 1P3AD 1P3OB 3C1BD 5GSUA 4J8VC 3UT9B 1P3GD 4KGCA 4NFTA 2BYKA 5B32D 2BYMA 3LZ1C 2CV5A 5B1LB 1P3OC 3AZJC 3TU4A 1BH8A 4AWLB 5B2IB 2HIOB 4KHAB 4LD9B 5CPID 1TAFB 3REJB 3C1CD 3B6GD 3AYWA 5CPKC 2NQBD 4H9SA 3MGQD 4Z5TA 3REKB 1KX4C 5GT3A 1P3BA 4KUDC 3W97D 1M1AD 4XUJA 2PYOC 1ZLAD 5B40B 1N1JA 1R4VA 3AZFD 4AWLC 5F99A 3KWQC 1M19B 3AZID 3REJC 5B31D 4DRAA 4ZUXC 3RELA 5AV9C 1P3KB 1EQZA 5B2JD 3REKC 3WA9B 3LZ0B 5GT0C 4WZSB 4J8WA 5B40C 2NZDB 4H9RB 5AV5C 3AFAB 3B0CT 3W99B 2F8ND 1HQ3D 3UTBC 5AVBA 5B24B 5B32A 3X1TC 3AZMB 5B1LA 1JFIB 3WA9C 4R8PA 5B2IA 2HIOA 4KHAA 3KUYC 4LD9A 2F8NK 3REHB 3AZEB 5B1MB 3W99C 4WU9D 4YM6D 3AZLD 3NQUB 3C1CA 3B0BA 3AZMC 1KX3A 3B6GA 4H9QB 4JJND 3W98C 3MGQA 3MNNB 5B33C 3MGRD 1M1AA 1M19A 2IO5B 5B1MC 4NE6A 1P3KA 4XZQC 5B31A 1P3PB 5B0ZB 3REIB 3B0CW 5E5AB 3NQJA 3MNNC 1H3OA 3KXBD 1F1EA 3LELB 2IO5C 5AY8C 3AFAA 3W96D 3X1SB 2YFVA 5B24A 4G92C 3X1UB 2F8NA 4QLCB 2HUEC 3WTPD 5AV8B 3REIC 3WAAD 5E5AC 1F66D 1P3ID 5DNMB 5JRGD 5CPJC 3UTAC 3REHA 3AZKD 3AZEA 3AV1B 1KX5D 3WKJD 3X1SC 1P34B 3MVDA 3X1UC 3NQUA 5BNVB 2AROD 4WU9A 4YM6A 5AV8C 4H9QA 3A6NB 5B0YB 3AZLA 4YS3A 3AN2C 5GSUD 5DNMC 3O62B 1ID3B 3MGRA 2FJ7C 4G91B 1B6WA 2CV5D 3AZHC 3A6NC 1TZYB 4CSRA 3LJAB 3X1VB 5AV6A 3O62C 1S32C 1ID3C 5CHLB 5GXQC 3KXBA 5DNNC 3AZNB 3AYWD 3W96A 1U35C 1TZYC 5G49A 5GT3D 1P3BD 3WTPA 1P3FC 1P3LC 3X1VC 4J8XD 1M18C 3B6FC 1F66A 5JA4B 4UUZB 4J8UA 3AV1A 1P3IA 4J8VB 4X23B 1P34A 3AZGB 1KX5A 4Z2MH 1EQZD 2JSSA 5B0YA 4Z66D 3MGSA 3UT9D 4J8WD 1A7WA 3AZJB 4X23C 1P3MB 3AZGC 3AV2C 5AVBD 4WU8B 1BH9A 2RVQD 5B1LD 5CPKB 4R8PD 3LJAA 1KX4B 3R45B 5B2ID 2HIOD 4KUDB 4LD9D 2PYOB 1KU5A 1P3MC 1AOIC 4WU8C 3KWQB 4H9NA 1KX3D 3MGPB 4ZUXB 5AV9B 5B40D 5CP6B 5BS7C 4NE3A 5GT0B 3WTPE 4J8VA 4J8XA 1M19D 1P3KD 5AV5B 3LZ1A 3UTBB 3MGPC 3WA9D 3LZ0D 4H9PB 3X1TB 2F8NH 4Z66A 5CP6C 1P3OA 2NZDD 5AVCC 3UT9A 1P3AC 3AFAD 3W99D 3C1BC 1P3GC 3KUYB 5B24D 3AZMD 5B32C 2NQBB 3W98B 3R45A 2PYOA 3REHD 5B33B 3AZED 3MVDD 1TAFA 3AZFB 3REJA 5CPIC 4ZUXA 5AV9A 3C1CC 4XZQB 3B6GC 4YS3D 3MNND 3REKA 2NQBC 5GT0A 5B40A 3W97C 1ZLAC 3AZFC 5AY8B 1BFMA 3UTBA 1P3PD 5B0ZD 4G92B 3AZIC 5B31C 3X1TA 2HUEB 3WA9A 3LZ0A 3B0DC 5B2JC 5AV6D 3LELD 5KDMB 3KUYA 2NZDA 4H9RA 5CPJB 3UTAB 5BO0B 3W99A 4QLCD 5AV8D 5BNXB 1HQ3C 3AZMA 3VH6A 1JFIA 5FUGB 4E45A 4J8UD 3AV1D 5B33A 3AN2B 1P34D 5B1MA 2FJ7B 4WNNB 3A6ND 4ZBJC 5B0YD 4E44A 4WU9C 4YM6C 3MGSD 3AZHB 3AZLC 3O62D 3MNNA 4JJNC 1S32B 3MGRC 5GXQB 5DNNB 3LJAD 1P3PA 1U35B 5B0ZA 3REIA 5E5AA 5KDMA 3V9RB 1P3FB 1M18B 1P3LB 3B6FB 3WAAB 3LELA 3UTAA 1ULYA 3AZND 3KXBC 5BO0A 3KSYA 3X1SA 3W96C 3X1UA 4QLCA 5AV8A 2AROB 5FUGA 3WTPC 3AN2A 3WAAC 4J8VD 5DNMA 4X23D 4EO5B 4KGCB 2FJ7A 5JRGC 4WNNA 3WKJC 4HGAC 3AZKC 2BYKB 3LZ1D 3AV2B 5BNVA 1Q9CA 3A6NA 2AROC 4CAYB 1P3OD 3AZJD 3VH5A 3O62A 1S32A 1ID3A 5GSUC 5GXQA 4EO5C 3TU4B 4WU8D 4KGCC 1BH8B 4Z2MG 1AOIB 5CPKD 4DRBA 1TZYA 1KX4D 5B32G 2CV5C 2CWEA 4KUDD 4Z5TB 1P3FA 1M18A 3B6FA 3X1VA 2PYOD 4XUJB 1N1JB 3TU4C 3KWQD 3REJD 3AZNA 5F99B 4ZUXD 5AV9D 3AYWC 4H9OB 3REKD 5CP6D 3RELB 4H9SC 5GT0D 4Z5TC 5GT3C 1P3BC 5JA4A 4UUZA 4XUJC 4J8WB 4J8XC 5AVCB 5AV5D 4X23A 1P3AB 1WWSA 3C1BB 3UTBD 3AZGA 5F99C 5BT1C 3AV2A 1P3GB 3X1TD 5AVBB 5B32B 4CAYA 5B31G 2LY8A 3RELC 1EQZC 4Z66C 4WV4B 4R8PB 3UT9C 4J8WC 3KUYD 3AZJA 3VH6T 1P3MA 1AOIA 4WU8A 5AVBC 5CPKA 5CPIB 3W98D 2F8NG 3C1CB 1KX3B 3B6GB 2RVQC 5B1LC 4R8PC 5B33D 1KX4A 5BS7A 3MGQB 4KUDA 5B1MD 5B2IC 2HIOC 1M1AB 3W97B 4LD9C 1HTAA 1ZLAB 3KWQA 4XZQD 4H9OA 3MGPA 3AZIB 5B31B 1KX3C
chains in the Genus database with same CATH superfamily
5CP6A 3NQJB 3B0DB 5B2JB 3MGQC 5AVCA 1H3OB 1P3AA 5AY8D 3C1BA 1P3GA 1M1AC 1M19C 5AV5A 2YFVB 2VQRA 3VH6W 1P3KC 2BG1A 4M6BA 3REID 4H9PA 5E5AD 1HQ3B 2F8NB 3LZ0C 5CPJD 3UTAD 2NZDC 3X1SD 3AFAC 3X1UD 5B24C 5CPIA 3MVDB 4ZBJB 4WU9B 4YM6B 2NQBA 4NE5A 3AN2D 3W98A 3AZLB 5DNMD 4YS3B 4JJNB 3W97A 2FJ7D 1ZLAA 3REHC 3AZEC 3MGRB 3AZFA 3VH5T 3AZHD 3MVDC 3AZIA 4XZQA 3IP4C 4CSRB 5B2JA 4YS3C 1S32D 1ID3D 5GXQD 5AV6B 5DNND 1B67A 5AY8A 3KXBB 1U35D 2Y2NA 1TZYD 3W96B 1HQ3A 1WWIA 1P3PC 3P5JB 5B0ZC 2L5AA 5G49B 1P3LD 3X1VD 1P3FD 1M18D 3B6FD 3WTPB 5AV6C 3LELC 1F66B 4J8UB 2YFWB 5CPJA 1P3IB 5JRGB 3WKJB 1KX5B 4HGAB 5BNXA 3AZKB 4QLCC 3VH5W 3MGSB 2Y2KA 5C3IB 4JJNA 4KGCD 1F66C 4J8UC 3AV1C 1P3IC 3AZGD 5GSUB 3AV2D 1P34C 1KX5C 2Y2OA 2F2AC 3AZHA 5B0YC 1BH9B 2BYMB 2CV5B 3MGSC 5C3IC 3TU4D 1P3MD 2Y2QA 1AOID 4G91C 5DNNA 4H9NB 4Z5TD 1U35A 3AYWB 3LJAC 4XUJD 3V9RA 1P3LA 3WAAA 5GT3B 1P3BB 2YFWA 2UWXA 5F99D 5BT1D 4J8XB 5JRGA 3AZNC 3WKJA 3AZKA 3EG5B 3EPLA 3MGPD 3RELD 3LZ1B 2AROA 1EQZB 5AVCD 2Y2HA 4Z66B 1P3AD 1P3OB 3C1BD 5GSUA 4J8VC 3UT9B 1P3GD 4KGCA 4NFTA 2BYKA 5B32D 2BYMA 3LZ1C 2CV5A 5B1LB 1P3OC 3AZJC 3TU4A 1BH8A 4AWLB 5B2IB 2HIOB 4KHAB 4LD9B 2ZM5A 5CPID 1TAFB 2Y2MA 3REJB 3C1CD 3B6GD 3AYWA 5CPKC 2NQBD 4H9SA 3MGQD 4Z5TA 3REKB 1KX4C 5GT3A 1P3BA 4KUDC 3W97D 1M1AD 4XUJA 2PYOC 1ZLAD 5B40B 1N1JA 1R4VA 3AZFD 4AWLC 5F99A 3KWQC 1M19B 3AZID 3REJC 5B31D 4DRAA 4ZUXC 3RELA 5AV9C 1P3KB 1EQZA 5B2JD 2RIQA 3REKC 2JE5A 3WA9B 3LZ0B 5GT0C 4WZSB 4J8WA 5B40C 2Y2IA 2NZDB 4H9RB 5AV5C 3AFAB 3B0CT 3W99B 2F8ND 1HQ3D 3UTBC 5AVBA 5B24B 5B32A 3X1TC 3AZMB 5B1LA 1JFIB 3WA9C 4R8PA 2ZY2A 3EPJA 5B2IA 2HIOA 4KHAA 3KUYC 4LD9A 2F8NK 3REHB 3AZEB 5B1MB 3W99C 4WU9D 4YM6D 2ZY5A 3AZLD 3NQUB 3C1CA 3B0BA 3AZMC 1KX3A 3B6GA 4H9QB 4JJND 1Z2CB 3W98C 3MGQA 3MNNB 5B33C 3MGRD 1M1AA 1M19A 2IO5B 5B1MC 4NE6A 1P3KA 4XZQC 5B31A 1P3PB 5B0ZB 3REIB 3A1KA 3B0CW 3NQJA 5E5AB 4DQYB 3MNNC 1H3OA 2JCHA 3KXBD 1F1EA 3LELB 2IO5C 5AY8C 3AFAA 3W96D 3X1SB 2YFVA 5B24A 4G92C 3X1UB 2F8NA 4QLCB 2HUEC 3WTPD 5AV8B 3REIC 3WAAD 5E5AC 1F66D 1P3ID 5DNMB 5JRGD 5CPJC 3UTAC 3REHA 3AZKD 3AZEA 3AV1B 1KX5D 3WKJD 3X1SC 1P34B 3MVDA 3X1UC 3NQUA 5BNVB 2AROD 4WU9A 4YM6A 5AV8C 4H9QA 3A6NB 5B0YB 3AZLA 4YS3A 3AN2C 5GSUD 5DNMC 3O62B 2XD5A 1ID3B 3MGRA 2FJ7C 4G91B 2Y2PA 1B6WA 2CV5D 3AZHC 3A6NC 1TZYB 4CSRA 3LJAB 3X1VB 5AV6A 3O62C 1S32C 1ID3C 5CHLB 5GXQC 2ZY4A 2Y2JA 3KXBA 5DNNC 3AZNB 3AYWD 3W96A 1U35C 1TZYC 5G49A 5GT3D 1P3BD 3WTPA 1P3FC 1P3LC 3X1VC 4J8XD 1M18C 3B6FC 1F66A 5JA4B 4UUZB 4J8UA 2DF4C 3AV1A 1P3IA 2Y2LA 4J8VB 4X23B 1P34A 3AZGB 1KX5A 4Z2MH 1EQZD 2JSSA 2W8SA 5B0YA 4Z66D 3MGSA 3UT9D 4J8WD 1A7WA 3AZJB 4X23C 1P3MB 3AZGC 3AV2C 5AVBD 4WU8B 1BH9A 2RVQD 5B1LD 5CPKB 4R8PD 3LJAA 1KX4B 3R45B 5B2ID 2HIOD 4KUDB 4LD9D 2PYOB 1KU5A 1P3MC 1AOIC 4WU8C 3KWQB 4H9NA 1KX3D 3MGPB 4ZUXB 5AV9B 5B40D 5CP6B 5BS7C 4NE3A 5GT0B 3WTPE 4J8VA 4J8XA 1M19D 1P3KD 5AV5B 3LZ1A 3UTBB 3MGPC 3WA9D 3LZ0D 4H9PB 3X1TB 3FDDA 2F8NH 4Z66A 5CP6C 3EPKA 1P3OA 3KFUG 2NZDD 5AVCC 3UT9A 1P3AC 3AFAD 3W99D 3C1BC 1P3GC 3KUYB 2G5IC 5B24D 3AZMD 5B32C 1W2EA 2NQBB 3W98B 3R45A 2FFFB 2PYOA 3REHD 5B33B 3AZED 3MVDD 1TAFA 3AZFB 3REJA 5CPIC 4ZUXA 5AV9A 3C1CC 2G5HC 4XZQB 3B6GC 4YS3D 2DQNC 3MNND 3REKA 2NQBC 5GT0A 5B40A 3W97C 1ZLAC 3AZFC 5AY8B 1BFMA 3UTBA 3EPHA 1P3PD 5B0ZD 4G92B 3AZIC 5B31C 3X1TA 2HUEB 3WA9A 3LZ0A 3B0DC 5B2JC 5AV6D 3LELD 5KDMB 1PZRA 3KUYA 2NZDA 4H9RA 5CPJB 3UTAB 5BO0B 3W99A 4QLCD 5AV8D 5BNXB 1HQ3C 3AZMA 3VH6A 1JFIA 5FUGB 4E45A 4J8UD 3AV1D 5B33A 4UPKA 3AN2B 1P34D 4WJ3C 5B1MA 2FJ7B 4WNNB 3A6ND 4ZBJC 5B0YD 4E44A 4WU9C 4YM6C 3MGSD 3AZHB 3AZLC 3O62D 3MNNA 4JJNC 1S32B 3MGRC 5GXQB 3AL0C 5DNNB 2ZY3A 3LJAD 1P3PA 1U35B 5B0ZA 3REIA 5E5AA 5KDMA 3V9RB 1P3FB 1M18B 1P3LB 3B6FB 3WAAB 3LELA 3UTAA 1ULYA 3AZND 3KXBC 5BO0A 3KSYA 3X1SA 3W96C 3X1UA 4QLCA 5AV8A 2AROB 5FUGA 3WTPC 3AN2A 3WAAC 4J8VD 5DNMA 4X23D 3H0MC 4EO5B 4KGCB 2FJ7A 5JRGC 4WNNA 3WKJC 4HGAC 3AZKC 2BYKB 3LZ1D 3AV2B 5BNVA 1Q9CA 3A6NA 2AROC 4CAYB 1P3OD 3AZJD 3VH5A 3O62A 1S32A 1ID3A 5GSUC 5GXQA 4EO5C 3TU4B 4WU8D 4KGCC 1BH8B 4Z2MG 1AOIB 5CPKD 4DRBA 3H0RC 1TZYA 1KX4D 5B32G 3H0LC 2CV5C 2CWEA 4KUDD 4Z5TB 1P3FA 1M18A 3B6FA 3X1VA 2PYOD 4XUJB 2XD1A 1N1JB 3TU4C 3KWQD 3REJD 3AZNA 5F99B 2J8PA 4ZUXD 5AV9D 3AYWC 4H9OB 3REKD 5CP6D 3RELB 4H9SC 5GT0D 4Z5TC 5GT3C 1P3BC 5JA4A 4UUZA 4XUJC 4J8WB 2Y2GA 3A1IA 5AVCB 4J8XC 5AV5D 4X23A 1P3AB 1WWSA 3C1BB 3UTBD 3F6TA 5F99C 5BT1C 3AZGA 3AV2A 1P3GB 3X1TD 5AVBB 5B32B 4CAYA 5B31G 2LY8A 3RELC 1EQZC 4Z66C 4WV4B 4R8PB 3UT9C 4J8WC 3KUYD 3AZJA 3VH6T 1P3MA 1AOIA 4WU8A 1T3UA 5AVBC 5CPKA 5CPIB 3W98D 2F8NG 3C1CB 1KX3B 3B6GB 2RVQC 5B1LC 4R8PC 5B33D 1KX4A 5BS7A 3MGQB 4KUDA 5B1MD 5B2IC 2HIOC 1M1AB 3W97B 4LD9C 1HTAA 1ZLAB 3KWQA 4XZQD 4H9OA 3MGPA 3AZIB 5B31B 1KX3C
chains in the Genus database with same CATH topology
5CP6A 3NQJB 3B0DB 5B2JB 3MGQC 5AVCA 1H3OB 1P3AA 5AY8D 3C1BA 1P3GA 1M1AC 1M19C 5AV5A 2YFVB 2VQRA 3VH6W 1P3KC 2BG1A 4M6BA 3REID 4H9PA 5E5AD 1HQ3B 2F8NB 3LZ0C 5CPJD 3UTAD 2NZDC 3X1SD 3AFAC 3X1UD 5B24C 5CPIA 3MVDB 4ZBJB 4WU9B 4YM6B 2NQBA 4NE5A 3AN2D 3W98A 3AZLB 5DNMD 4YS3B 4JJNB 3W97A 2FJ7D 1ZLAA 3REHC 3AZEC 3MGRB 3AZFA 3VH5T 3AZHD 3MVDC 3AZIA 4XZQA 3IP4C 4CSRB 5B2JA 4YS3C 1S32D 1ID3D 5GXQD 5AV6B 5DNND 1B67A 5AY8A 3KXBB 1U35D 2Y2NA 1TZYD 3W96B 1HQ3A 1WWIA 1P3PC 3P5JB 5B0ZC 2L5AA 5G49B 1P3LD 3X1VD 1P3FD 1M18D 3B6FD 3WTPB 5AV6C 3LELC 1F66B 4J8UB 2YFWB 5CPJA 1P3IB 5JRGB 3WKJB 1KX5B 4HGAB 5BNXA 3AZKB 4QLCC 3VH5W 3MGSB 2Y2KA 5C3IB 4JJNA 4KGCD 1F66C 4J8UC 3AV1C 1P3IC 3AZGD 5GSUB 3AV2D 1P34C 1KX5C 2Y2OA 2F2AC 3AZHA 5B0YC 1BH9B 2BYMB 2CV5B 3MGSC 5C3IC 3TU4D 1P3MD 2Y2QA 1AOID 4G91C 5DNNA 4H9NB 4Z5TD 1U35A 3AYWB 3LJAC 4XUJD 3V9RA 1P3LA 3WAAA 5GT3B 1P3BB 2YFWA 2UWXA 5F99D 5BT1D 4J8XB 5JRGA 3AZNC 3WKJA 3AZKA 3EG5B 3EPLA 3MGPD 3RELD 3LZ1B 2AROA 1EQZB 5AVCD 2Y2HA 4Z66B 1P3AD 1P3OB 3C1BD 5GSUA 4J8VC 3UT9B 1P3GD 4KGCA 4NFTA 2BYKA 5B32D 2BYMA 3LZ1C 2CV5A 5B1LB 1P3OC 3AZJC 3TU4A 1BH8A 4AWLB 5B2IB 2HIOB 4KHAB 4LD9B 2ZM5A 5CPID 1TAFB 2Y2MA 3REJB 3C1CD 3B6GD 3AYWA 5CPKC 2NQBD 4H9SA 3MGQD 4Z5TA 3REKB 1KX4C 5GT3A 1P3BA 4KUDC 3W97D 1M1AD 4XUJA 2PYOC 1ZLAD 5B40B 1N1JA 1R4VA 3AZFD 4AWLC 5F99A 3KWQC 1M19B 3AZID 3REJC 5B31D 4DRAA 4ZUXC 3RELA 5AV9C 1P3KB 1EQZA 5B2JD 2RIQA 3REKC 2JE5A 3WA9B 3LZ0B 5GT0C 4WZSB 4J8WA 5B40C 2Y2IA 2NZDB 4H9RB 5AV5C 3AFAB 3B0CT 3W99B 2F8ND 1HQ3D 3UTBC 5AVBA 5B24B 5B32A 3X1TC 3AZMB 5B1LA 1JFIB 3WA9C 4R8PA 2ZY2A 3EPJA 5B2IA 2HIOA 4KHAA 3KUYC 4LD9A 2F8NK 3REHB 3AZEB 5B1MB 3W99C 4WU9D 4YM6D 2ZY5A 3AZLD 3NQUB 3C1CA 3B0BA 3AZMC 1KX3A 3B6GA 4H9QB 4JJND 1Z2CB 3W98C 3MGQA 3MNNB 5B33C 3MGRD 1M1AA 1M19A 2IO5B 5B1MC 4NE6A 1P3KA 4XZQC 5B31A 1P3PB 5B0ZB 3REIB 3A1KA 3B0CW 3NQJA 5E5AB 4DQYB 3MNNC 1H3OA 2JCHA 3KXBD 1F1EA 3LELB 2IO5C 5AY8C 3AFAA 3W96D 3X1SB 2YFVA 5B24A 4G92C 3X1UB 2F8NA 4QLCB 2HUEC 3WTPD 5AV8B 3REIC 3WAAD 5E5AC 1F66D 1P3ID 5DNMB 5JRGD 5CPJC 3UTAC 3REHA 3AZKD 3AZEA 3AV1B 1KX5D 3WKJD 3X1SC 1P34B 3MVDA 3X1UC 3NQUA 5BNVB 2AROD 4WU9A 4YM6A 5AV8C 4H9QA 3A6NB 5B0YB 3AZLA 4YS3A 3AN2C 5GSUD 5DNMC 3O62B 2XD5A 1ID3B 3MGRA 2FJ7C 4G91B 2Y2PA 1B6WA 2CV5D 3AZHC 3A6NC 1TZYB 4CSRA 3LJAB 3X1VB 5AV6A 3O62C 1S32C 1ID3C 5CHLB 5GXQC 2ZY4A 2Y2JA 3KXBA 5DNNC 3AZNB 3AYWD 3W96A 1U35C 1TZYC 5G49A 5GT3D 1P3BD 3WTPA 1P3FC 1P3LC 3X1VC 4J8XD 1M18C 3B6FC 1F66A 5JA4B 4UUZB 4J8UA 2DF4C 3AV1A 1P3IA 2Y2LA 4J8VB 4X23B 1P34A 3AZGB 1KX5A 4Z2MH 1EQZD 2JSSA 2W8SA 5B0YA 4Z66D 3MGSA 3UT9D 4J8WD 1A7WA 3AZJB 4X23C 1P3MB 3AZGC 3AV2C 5AVBD 4WU8B 1BH9A 2RVQD 5B1LD 5CPKB 4R8PD 3LJAA 1KX4B 3R45B 5B2ID 2HIOD 4KUDB 4LD9D 2PYOB 1KU5A 1P3MC 1AOIC 4WU8C 3KWQB 4H9NA 1KX3D 3MGPB 4ZUXB 5AV9B 5B40D 5CP6B 5BS7C 4NE3A 5GT0B 3WTPE 4J8VA 4J8XA 1M19D 1P3KD 5AV5B 3LZ1A 3UTBB 3MGPC 3WA9D 3LZ0D 4H9PB 3X1TB 3FDDA 2F8NH 4Z66A 5CP6C 3EPKA 1P3OA 3KFUG 2NZDD 5AVCC 3UT9A 1P3AC 3AFAD 3W99D 3C1BC 1P3GC 3KUYB 2G5IC 5B24D 3AZMD 5B32C 1W2EA 2NQBB 3W98B 3R45A 2FFFB 2PYOA 3REHD 5B33B 3AZED 3MVDD 1TAFA 3AZFB 3REJA 5CPIC 4ZUXA 5AV9A 3C1CC 2G5HC 4XZQB 3B6GC 4YS3D 2DQNC 3MNND 3REKA 2NQBC 5GT0A 5B40A 3W97C 1ZLAC 3AZFC 5AY8B 1BFMA 3UTBA 3EPHA 1P3PD 5B0ZD 4G92B 3AZIC 5B31C 3X1TA 2HUEB 3WA9A 3LZ0A 3B0DC 5B2JC 5AV6D 3LELD 5KDMB 1PZRA 3KUYA 2NZDA 4H9RA 5CPJB 3UTAB 5BO0B 3W99A 4QLCD 5AV8D 5BNXB 1HQ3C 3AZMA 3VH6A 1JFIA 5FUGB 4E45A 4J8UD 3AV1D 5B33A 4UPKA 3AN2B 1P34D 4WJ3C 5B1MA 2FJ7B 4WNNB 3A6ND 4ZBJC 5B0YD 4E44A 4WU9C 4YM6C 3MGSD 3AZHB 3AZLC 3O62D 3MNNA 4JJNC 1S32B 3MGRC 5GXQB 3AL0C 5DNNB 2ZY3A 3LJAD 1P3PA 1U35B 5B0ZA 3REIA 5E5AA 5KDMA 3V9RB 1P3FB 1M18B 1P3LB 3B6FB 3WAAB 3LELA 3UTAA 1ULYA 3AZND 3KXBC 5BO0A 3KSYA 3X1SA 3W96C 3X1UA 4QLCA 5AV8A 2AROB 5FUGA 3WTPC 3AN2A 3WAAC 4J8VD 5DNMA 4X23D 3H0MC 4EO5B 4KGCB 2FJ7A 5JRGC 4WNNA 3WKJC 4HGAC 3AZKC 2BYKB 3LZ1D 3AV2B 5BNVA 1Q9CA 3A6NA 2AROC 4CAYB 1P3OD 3AZJD 3VH5A 3O62A 1S32A 1ID3A 5GSUC 5GXQA 4EO5C 3TU4B 4WU8D 4KGCC 1BH8B 4Z2MG 1AOIB 5CPKD 4DRBA 3H0RC 1TZYA 1KX4D 5B32G 3H0LC 2CV5C 2CWEA 4KUDD 4Z5TB 1P3FA 1M18A 3B6FA 3X1VA 2PYOD 4XUJB 2XD1A 1N1JB 3TU4C 3KWQD 3REJD 3AZNA 5F99B 2J8PA 4ZUXD 5AV9D 3AYWC 4H9OB 3REKD 5CP6D 3RELB 4H9SC 5GT0D 4Z5TC 5GT3C 1P3BC 5JA4A 4UUZA 4XUJC 4J8WB 2Y2GA 3A1IA 5AVCB 4J8XC 5AV5D 4X23A 1P3AB 1WWSA 3C1BB 3UTBD 3F6TA 5F99C 5BT1C 3AZGA 3AV2A 1P3GB 3X1TD 5AVBB 5B32B 4CAYA 5B31G 2LY8A 3RELC 1EQZC 4Z66C 4WV4B 4R8PB 3UT9C 4J8WC 3KUYD 3AZJA 3VH6T 1P3MA 1AOIA 4WU8A 1T3UA 5AVBC 5CPKA 5CPIB 3W98D 2F8NG 3C1CB 1KX3B 3B6GB 2RVQC 5B1LC 4R8PC 5B33D 1KX4A 5BS7A 3MGQB 4KUDA 5B1MD 5B2IC 2HIOC 1M1AB 3W97B 4LD9C 1HTAA 1ZLAB 3KWQA 4XZQD 4H9OA 3MGPA 3AZIB 5B31B 1KX3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 A;  3NQJ B;  3B0D B;  5B2J B;  3MGQ C;  5AVC A;  1H3O B;  1P3A A;  5AY8 D;  3C1B A;  1P3G A;  1M1A C;  1M19 C;  5AV5 A;  2YFV B;  3VH6 W;  1P3K C;  3REI D;  4M6B A;  4H9P A;  5E5A D;  1HQ3 B;  2F8N B;  3LZ0 C;  5CPJ D;  3UTA D;  2NZD C;  3X1S D;  3AFA C;  3X1U D;  5B24 C;  5CPI A;  3MVD B;  4ZBJ B;  4WU9 B;  4YM6 B;  2NQB A;  4NE5 A;  3AN2 D;  3W98 A;  3AZL B;  5DNM D;  4YS3 B;  4JJN B;  3W97 A;  2FJ7 D;  1ZLA A;  3REH C;  3AZE C;  3MGR B;  3AZF A;  3VH5 T;  3AZH D;  3MVD C;  3AZI A;  4XZQ A;  4CSR B;  5B2J A;  4YS3 C;  1S32 D;  1ID3 D;  5GXQ D;  5AV6 B;  5DNN D;  1B67 A;  5AY8 A;  3KXB B;  1U35 D;  1TZY D;  3W96 B;  1HQ3 A;  1WWI A;  1P3P C;  5B0Z C;  2L5A A;  5G49 B;  1P3L D;  3X1V D;  1P3F D;  1M18 D;  3B6F D;  3WTP B;  5AV6 C;  3LEL C;  1F66 B;  4J8U B;  2YFW B;  5CPJ A;  1P3I B;  5JRG B;  3WKJ B;  1KX5 B;  4HGA B;  5BNX A;  3AZK B;  4QLC C;  3VH5 W;  3MGS B;  5C3I B;  4JJN A;  4KGC D;  1F66 C;  4J8U C;  3AV1 C;  1P3I C;  3AZG D;  5GSU B;  3AV2 D;  1P34 C;  1KX5 C;  3AZH A;  5B0Y C;  1BH9 B;  2BYM B;  2CV5 B;  3MGS C;  5C3I C;  3TU4 D;  1P3M D;  1AOI D;  4G91 C;  5DNN A;  4H9N B;  4Z5T D;  1U35 A;  3AYW B;  3LJA C;  4XUJ D;  3V9R A;  1P3L A;  3WAA A;  5GT3 B;  1P3B B;  2YFW A;  5F99 D;  5BT1 D;  4J8X B;  5JRG A;  3AZN C;  3WKJ A;  3AZK A;  3MGP D;  3REL D;  3LZ1 B;  2ARO A;  1EQZ B;  5AVC D;  4Z66 B;  1P3A D;  1P3O B;  3C1B D;  5GSU A;  4J8V C;  3UT9 B;  1P3G D;  4KGC A;  4NFT A;  2BYK A;  5B32 D;  2BYM A;  3LZ1 C;  2CV5 A;  5B1L B;  1P3O C;  3AZJ C;  3TU4 A;  1BH8 A;  4AWL B;  5B2I B;  2HIO B;  4KHA B;  4LD9 B;  5CPI D;  1TAF B;  3REJ B;  3C1C D;  3B6G D;  3AYW A;  5CPK C;  2NQB D;  4H9S A;  3MGQ D;  4Z5T A;  3REK B;  1KX4 C;  5GT3 A;  1P3B A;  4KUD C;  3W97 D;  1M1A D;  4XUJ A;  2PYO C;  1ZLA D;  5B40 B;  1N1J A;  1R4V A;  3AZF D;  4AWL C;  5F99 A;  3KWQ C;  1M19 B;  3AZI D;  3REJ C;  5B31 D;  4DRA A;  4ZUX C;  3REL A;  5AV9 C;  1P3K B;  1EQZ A;  5B2J D;  3REK C;  3WA9 B;  3LZ0 B;  5GT0 C;  4WZS B;  4J8W A;  5B40 C;  2NZD B;  4H9R B;  5AV5 C;  3AFA B;  3B0C T;  3W99 B;  2F8N D;  1HQ3 D;  3UTB C;  5AVB A;  5B24 B;  5B32 A;  3X1T C;  3AZM B;  5B1L A;  1JFI B;  3WA9 C;  4R8P A;  5B2I A;  2HIO A;  4KHA A;  3KUY C;  4LD9 A;  2F8N K;  3REH B;  3AZE B;  5B1M B;  3W99 C;  4WU9 D;  4YM6 D;  3AZL D;  3NQU B;  3C1C A;  3B0B A;  3AZM C;  1KX3 A;  3B6G A;  4H9Q B;  4JJN D;  3W98 C;  3MGQ A;  3MNN B;  5B33 C;  3MGR D;  1M1A A;  1M19 A;  2IO5 B;  5B1M C;  4NE6 A;  1P3K A;  4XZQ C;  5B31 A;  1P3P B;  5B0Z B;  3REI B;  3B0C W;  5E5A B;  3NQJ A;  3MNN C;  1H3O A;  3KXB D;  1F1E A;  3LEL B;  2IO5 C;  5AY8 C;  3AFA A;  3W96 D;  3X1S B;  2YFV A;  5B24 A;  4G92 C;  3X1U B;  2F8N A;  4QLC B;  2HUE C;  3WTP D;  5AV8 B;  3REI C;  3WAA D;  5E5A C;  1F66 D;  1P3I D;  5DNM B;  5JRG D;  5CPJ C;  3UTA C;  3REH A;  3AZK D;  3AZE A;  3AV1 B;  1KX5 D;  3WKJ D;  3X1S C;  1P34 B;  3MVD A;  3X1U C;  3NQU A;  5BNV B;  2ARO D;  4WU9 A;  4YM6 A;  5AV8 C;  4H9Q A;  3A6N B;  5B0Y B;  3AZL A;  4YS3 A;  3AN2 C;  5GSU D;  5DNM C;  3O62 B;  1ID3 B;  3MGR A;  2FJ7 C;  4G91 B;  1B6W A;  2CV5 D;  3AZH C;  3A6N C;  1TZY B;  4CSR A;  3LJA B;  3X1V B;  5AV6 A;  3O62 C;  1S32 C;  1ID3 C;  5CHL B;  5GXQ C;  3KXB A;  5DNN C;  3AZN B;  3AYW D;  3W96 A;  1U35 C;  1TZY C;  5G49 A;  5GT3 D;  1P3B D;  3WTP A;  1P3F C;  1P3L C;  3X1V C;  4J8X D;  1M18 C;  3B6F C;  1F66 A;  5JA4 B;  4UUZ B;  4J8U A;  3AV1 A;  1P3I A;  4J8V B;  4X23 B;  1P34 A;  3AZG B;  1KX5 A;  4Z2M H;  1EQZ D;  2JSS A;  5B0Y A;  4Z66 D;  3MGS A;  3UT9 D;  4J8W D;  1A7W A;  3AZJ B;  4X23 C;  1P3M B;  3AZG C;  3AV2 C;  5AVB D;  4WU8 B;  1BH9 A;  2RVQ D;  5B1L D;  5CPK B;  4R8P D;  3LJA A;  1KX4 B;  3R45 B;  5B2I D;  2HIO D;  4KUD B;  4LD9 D;  2PYO B;  1KU5 A;  1P3M C;  1AOI C;  4WU8 C;  3KWQ B;  4H9N A;  1KX3 D;  3MGP B;  4ZUX B;  5AV9 B;  5B40 D;  5CP6 B;  5BS7 C;  4NE3 A;  5GT0 B;  3WTP E;  4J8V A;  4J8X A;  1M19 D;  1P3K D;  5AV5 B;  3LZ1 A;  3UTB B;  3MGP C;  3WA9 D;  3LZ0 D;  4H9P B;  3X1T B;  2F8N H;  4Z66 A;  5CP6 C;  1P3O A;  2NZD D;  5AVC C;  3UT9 A;  1P3A C;  3AFA D;  3W99 D;  3C1B C;  1P3G C;  3KUY B;  5B24 D;  3AZM D;  5B32 C;  2NQB B;  3W98 B;  3R45 A;  2PYO A;  3REH D;  5B33 B;  3AZE D;  3MVD D;  1TAF A;  3AZF B;  3REJ A;  5CPI C;  4ZUX A;  5AV9 A;  3C1C C;  4XZQ B;  3B6G C;  4YS3 D;  3MNN D;  3REK A;  2NQB C;  5GT0 A;  5B40 A;  3W97 C;  1ZLA C;  3AZF C;  5AY8 B;  1BFM A;  3UTB A;  1P3P D;  5B0Z D;  4G92 B;  3AZI C;  5B31 C;  3X1T A;  2HUE B;  3WA9 A;  3LZ0 A;  3B0D C;  5B2J C;  5AV6 D;  3LEL D;  5KDM B;  3KUY A;  2NZD A;  4H9R A;  5CPJ B;  3UTA B;  5BO0 B;  3W99 A;  4QLC D;  5AV8 D;  5BNX B;  1HQ3 C;  3AZM A;  3VH6 A;  1JFI A;  5FUG B;  4E45 A;  4J8U D;  3AV1 D;  5B33 A;  3AN2 B;  1P34 D;  5B1M A;  2FJ7 B;  4WNN B;  3A6N D;  4ZBJ C;  5B0Y D;  4E44 A;  4WU9 C;  4YM6 C;  3MGS D;  3AZH B;  3AZL C;  3O62 D;  3MNN A;  4JJN C;  1S32 B;  3MGR C;  5GXQ B;  5DNN B;  3LJA D;  1P3P A;  1U35 B;  5B0Z A;  3REI A;  5E5A A;  5KDM A;  3V9R B;  1P3F B;  1M18 B;  1P3L B;  3B6F B;  3WAA B;  3LEL A;  3UTA A;  1ULY A;  3AZN D;  3KXB C;  5BO0 A;  3KSY A;  3X1S A;  3W96 C;  3X1U A;  4QLC A;  5AV8 A;  2ARO B;  5FUG A;  3WTP C;  3AN2 A;  3WAA C;  4J8V D;  5DNM A;  4X23 D;  4EO5 B;  4KGC B;  2FJ7 A;  5JRG C;  4WNN A;  3WKJ C;  4HGA C;  3AZK C;  2BYK B;  3LZ1 D;  3AV2 B;  5BNV A;  1Q9C A;  3A6N A;  2ARO C;  4CAY B;  1P3O D;  3AZJ D;  3VH5 A;  3O62 A;  1S32 A;  1ID3 A;  5GSU C;  5GXQ A;  4EO5 C;  3TU4 B;  4WU8 D;  4KGC C;  1BH8 B;  4Z2M G;  1AOI B;  5CPK D;  4DRB A;  1TZY A;  1KX4 D;  5B32 G;  2CV5 C;  2CWE A;  4KUD D;  4Z5T B;  1P3F A;  1M18 A;  3B6F A;  3X1V A;  2PYO D;  4XUJ B;  1N1J B;  3TU4 C;  3KWQ D;  3REJ D;  3AZN A;  5F99 B;  4ZUX D;  5AV9 D;  3AYW C;  4H9O B;  3REK D;  5CP6 D;  3REL B;  4H9S C;  5GT0 D;  4Z5T C;  5GT3 C;  1P3B C;  5JA4 A;  4UUZ A;  4XUJ C;  4J8W B;  4J8X C;  5AVC B;  5AV5 D;  4X23 A;  1P3A B;  1WWS A;  3C1B B;  3UTB D;  3AZG A;  5F99 C;  5BT1 C;  3AV2 A;  1P3G B;  3X1T D;  5AVB B;  5B32 B;  4CAY A;  5B31 G;  2LY8 A;  3REL C;  1EQZ C;  4Z66 C;  4WV4 B;  4R8P B;  3UT9 C;  4J8W C;  3KUY D;  3AZJ A;  3VH6 T;  1P3M A;  1AOI A;  4WU8 A;  5AVB C;  5CPK A;  5CPI B;  3W98 D;  2F8N G;  3C1C B;  1KX3 B;  3B6G B;  2RVQ C;  5B1L C;  4R8P C;  5B33 D;  1KX4 A;  5BS7 A;  3MGQ B;  4KUD A;  5B1M D;  5B2I C;  2HIO C;  1M1A B;  3W97 B;  4LD9 C;  1HTA A;  1ZLA B;  3KWQ A;  4XZQ D;  4H9O A;  3MGP A;  3AZI B;  5B31 B;  1KX3 C; 
#chains in the Genus database with same CATH topology
 5CP6 A;  3NQJ B;  3B0D B;  5B2J B;  3MGQ C;  5AVC A;  1H3O B;  1P3A A;  5AY8 D;  3C1B A;  1P3G A;  1M1A C;  1M19 C;  5AV5 A;  2YFV B;  2VQR A;  3VH6 W;  1P3K C;  2BG1 A;  4M6B A;  3REI D;  4H9P A;  5E5A D;  1HQ3 B;  2F8N B;  3LZ0 C;  5CPJ D;  3UTA D;  2NZD C;  3X1S D;  3AFA C;  3X1U D;  5B24 C;  5CPI A;  3MVD B;  4ZBJ B;  4WU9 B;  4YM6 B;  2NQB A;  4NE5 A;  3AN2 D;  3W98 A;  3AZL B;  5DNM D;  4YS3 B;  4JJN B;  3W97 A;  2FJ7 D;  1ZLA A;  3REH C;  3AZE C;  3MGR B;  3AZF A;  3VH5 T;  3AZH D;  3MVD C;  3AZI A;  4XZQ A;  3IP4 C;  4CSR B;  5B2J A;  4YS3 C;  1S32 D;  1ID3 D;  5GXQ D;  5AV6 B;  5DNN D;  1B67 A;  5AY8 A;  3KXB B;  1U35 D;  2Y2N A;  1TZY D;  3W96 B;  1HQ3 A;  1WWI A;  1P3P C;  3P5J B;  5B0Z C;  2L5A A;  5G49 B;  1P3L D;  3X1V D;  1P3F D;  1M18 D;  3B6F D;  3WTP B;  5AV6 C;  3LEL C;  1F66 B;  4J8U B;  2YFW B;  5CPJ A;  1P3I B;  5JRG B;  3WKJ B;  1KX5 B;  4HGA B;  5BNX A;  3AZK B;  4QLC C;  3VH5 W;  3MGS B;  2Y2K A;  5C3I B;  4JJN A;  4KGC D;  1F66 C;  4J8U C;  3AV1 C;  1P3I C;  3AZG D;  5GSU B;  3AV2 D;  1P34 C;  1KX5 C;  2Y2O A;  2F2A C;  3AZH A;  5B0Y C;  1BH9 B;  2BYM B;  2CV5 B;  3MGS C;  5C3I C;  3TU4 D;  1P3M D;  2Y2Q A;  1AOI D;  4G91 C;  5DNN A;  4H9N B;  4Z5T D;  1U35 A;  3AYW B;  3LJA C;  4XUJ D;  3V9R A;  1P3L A;  3WAA A;  5GT3 B;  1P3B B;  2YFW A;  2UWX A;  5F99 D;  5BT1 D;  4J8X B;  5JRG A;  3AZN C;  3WKJ A;  3AZK A;  3EG5 B;  3EPL A;  3MGP D;  3REL D;  3LZ1 B;  2ARO A;  1EQZ B;  5AVC D;  2Y2H A;  4Z66 B;  1P3A D;  1P3O B;  3C1B D;  5GSU A;  4J8V C;  3UT9 B;  1P3G D;  4KGC A;  4NFT A;  2BYK A;  5B32 D;  2BYM A;  3LZ1 C;  2CV5 A;  5B1L B;  1P3O C;  3AZJ C;  3TU4 A;  1BH8 A;  4AWL B;  5B2I B;  2HIO B;  4KHA B;  4LD9 B;  2ZM5 A;  5CPI D;  1TAF B;  2Y2M A;  3REJ B;  3C1C D;  3B6G D;  3AYW A;  5CPK C;  2NQB D;  4H9S A;  3MGQ D;  4Z5T A;  3REK B;  1KX4 C;  5GT3 A;  1P3B A;  4KUD C;  3W97 D;  1M1A D;  4XUJ A;  2PYO C;  1ZLA D;  5B40 B;  1N1J A;  1R4V A;  3AZF D;  4AWL C;  5F99 A;  3KWQ C;  1M19 B;  3AZI D;  3REJ C;  5B31 D;  4DRA A;  4ZUX C;  3REL A;  5AV9 C;  1P3K B;  1EQZ A;  5B2J D;  2RIQ A;  3REK C;  2JE5 A;  3WA9 B;  3LZ0 B;  5GT0 C;  4WZS B;  4J8W A;  5B40 C;  2Y2I A;  2NZD B;  4H9R B;  5AV5 C;  3AFA B;  3B0C T;  3W99 B;  2F8N D;  1HQ3 D;  3UTB C;  5AVB A;  5B24 B;  5B32 A;  3X1T C;  3AZM B;  5B1L A;  1JFI B;  3WA9 C;  4R8P A;  2ZY2 A;  3EPJ A;  5B2I A;  2HIO A;  4KHA A;  3KUY C;  4LD9 A;  2F8N K;  3REH B;  3AZE B;  5B1M B;  3W99 C;  4WU9 D;  4YM6 D;  2ZY5 A;  3AZL D;  3NQU B;  3C1C A;  3B0B A;  3AZM C;  1KX3 A;  3B6G A;  4H9Q B;  4JJN D;  1Z2C B;  3W98 C;  3MGQ A;  3MNN B;  5B33 C;  3MGR D;  1M1A A;  1M19 A;  2IO5 B;  5B1M C;  4NE6 A;  1P3K A;  4XZQ C;  5B31 A;  1P3P B;  5B0Z B;  3REI B;  3A1K A;  3B0C W;  3NQJ A;  5E5A B;  4DQY B;  3MNN C;  1H3O A;  2JCH A;  3KXB D;  1F1E A;  3LEL B;  2IO5 C;  5AY8 C;  3AFA A;  3W96 D;  3X1S B;  2YFV A;  5B24 A;  4G92 C;  3X1U B;  2F8N A;  4QLC B;  2HUE C;  3WTP D;  5AV8 B;  3REI C;  3WAA D;  5E5A C;  1F66 D;  1P3I D;  5DNM B;  5JRG D;  5CPJ C;  3UTA C;  3REH A;  3AZK D;  3AZE A;  3AV1 B;  1KX5 D;  3WKJ D;  3X1S C;  1P34 B;  3MVD A;  3X1U C;  3NQU A;  5BNV B;  2ARO D;  4WU9 A;  4YM6 A;  5AV8 C;  4H9Q A;  3A6N B;  5B0Y B;  3AZL A;  4YS3 A;  3AN2 C;  5GSU D;  5DNM C;  3O62 B;  2XD5 A;  1ID3 B;  3MGR A;  2FJ7 C;  4G91 B;  2Y2P A;  1B6W A;  2CV5 D;  3AZH C;  3A6N C;  1TZY B;  4CSR A;  3LJA B;  3X1V B;  5AV6 A;  3O62 C;  1S32 C;  1ID3 C;  5CHL B;  5GXQ C;  2ZY4 A;  2Y2J A;  3KXB A;  5DNN C;  3AZN B;  3AYW D;  3W96 A;  1U35 C;  1TZY C;  5G49 A;  5GT3 D;  1P3B D;  3WTP A;  1P3F C;  1P3L C;  3X1V C;  4J8X D;  1M18 C;  3B6F C;  1F66 A;  5JA4 B;  4UUZ B;  4J8U A;  2DF4 C;  3AV1 A;  1P3I A;  2Y2L A;  4J8V B;  4X23 B;  1P34 A;  3AZG B;  1KX5 A;  4Z2M H;  1EQZ D;  2JSS A;  2W8S A;  5B0Y A;  4Z66 D;  3MGS A;  3UT9 D;  4J8W D;  1A7W A;  3AZJ B;  4X23 C;  1P3M B;  3AZG C;  3AV2 C;  5AVB D;  4WU8 B;  1BH9 A;  2RVQ D;  5B1L D;  5CPK B;  4R8P D;  3LJA A;  1KX4 B;  3R45 B;  5B2I D;  2HIO D;  4KUD B;  4LD9 D;  2PYO B;  1KU5 A;  1P3M C;  1AOI C;  4WU8 C;  3KWQ B;  4H9N A;  1KX3 D;  3MGP B;  4ZUX B;  5AV9 B;  5B40 D;  5CP6 B;  5BS7 C;  4NE3 A;  5GT0 B;  3WTP E;  4J8V A;  4J8X A;  1M19 D;  1P3K D;  5AV5 B;  3LZ1 A;  3UTB B;  3MGP C;  3WA9 D;  3LZ0 D;  4H9P B;  3X1T B;  3FDD A;  2F8N H;  4Z66 A;  5CP6 C;  3EPK A;  1P3O A;  3KFU G;  2NZD D;  5AVC C;  3UT9 A;  1P3A C;  3AFA D;  3W99 D;  3C1B C;  1P3G C;  3KUY B;  2G5I C;  5B24 D;  3AZM D;  5B32 C;  1W2E A;  2NQB B;  3W98 B;  3R45 A;  2FFF B;  2PYO A;  3REH D;  5B33 B;  3AZE D;  3MVD D;  1TAF A;  3AZF B;  3REJ A;  5CPI C;  4ZUX A;  5AV9 A;  3C1C C;  2G5H C;  4XZQ B;  3B6G C;  4YS3 D;  2DQN C;  3MNN D;  3REK A;  2NQB C;  5GT0 A;  5B40 A;  3W97 C;  1ZLA C;  3AZF C;  5AY8 B;  1BFM A;  3UTB A;  3EPH A;  1P3P D;  5B0Z D;  4G92 B;  3AZI C;  5B31 C;  3X1T A;  2HUE B;  3WA9 A;  3LZ0 A;  3B0D C;  5B2J C;  5AV6 D;  3LEL D;  5KDM B;  1PZR A;  3KUY A;  2NZD A;  4H9R A;  5CPJ B;  3UTA B;  5BO0 B;  3W99 A;  4QLC D;  5AV8 D;  5BNX B;  1HQ3 C;  3AZM A;  3VH6 A;  1JFI A;  5FUG B;  4E45 A;  4J8U D;  3AV1 D;  5B33 A;  4UPK A;  3AN2 B;  1P34 D;  4WJ3 C;  5B1M A;  2FJ7 B;  4WNN B;  3A6N D;  4ZBJ C;  5B0Y D;  4E44 A;  4WU9 C;  4YM6 C;  3MGS D;  3AZH B;  3AZL C;  3O62 D;  3MNN A;  4JJN C;  1S32 B;  3MGR C;  5GXQ B;  3AL0 C;  5DNN B;  2ZY3 A;  3LJA D;  1P3P A;  1U35 B;  5B0Z A;  3REI A;  5E5A A;  5KDM A;  3V9R B;  1P3F B;  1M18 B;  1P3L B;  3B6F B;  3WAA B;  3LEL A;  3UTA A;  1ULY A;  3AZN D;  3KXB C;  5BO0 A;  3KSY A;  3X1S A;  3W96 C;  3X1U A;  4QLC A;  5AV8 A;  2ARO B;  5FUG A;  3WTP C;  3AN2 A;  3WAA C;  4J8V D;  5DNM A;  4X23 D;  3H0M C;  4EO5 B;  4KGC B;  2FJ7 A;  5JRG C;  4WNN A;  3WKJ C;  4HGA C;  3AZK C;  2BYK B;  3LZ1 D;  3AV2 B;  5BNV A;  1Q9C A;  3A6N A;  2ARO C;  4CAY B;  1P3O D;  3AZJ D;  3VH5 A;  3O62 A;  1S32 A;  1ID3 A;  5GSU C;  5GXQ A;  4EO5 C;  3TU4 B;  4WU8 D;  4KGC C;  1BH8 B;  4Z2M G;  1AOI B;  5CPK D;  4DRB A;  3H0R C;  1TZY A;  1KX4 D;  5B32 G;  3H0L C;  2CV5 C;  2CWE A;  4KUD D;  4Z5T B;  1P3F A;  1M18 A;  3B6F A;  3X1V A;  2PYO D;  4XUJ B;  2XD1 A;  1N1J B;  3TU4 C;  3KWQ D;  3REJ D;  3AZN A;  5F99 B;  2J8P A;  4ZUX D;  5AV9 D;  3AYW C;  4H9O B;  3REK D;  5CP6 D;  3REL B;  4H9S C;  5GT0 D;  4Z5T C;  5GT3 C;  1P3B C;  5JA4 A;  4UUZ A;  4XUJ C;  4J8W B;  2Y2G A;  3A1I A;  5AVC B;  4J8X C;  5AV5 D;  4X23 A;  1P3A B;  1WWS A;  3C1B B;  3UTB D;  3F6T A;  5F99 C;  5BT1 C;  3AZG A;  3AV2 A;  1P3G B;  3X1T D;  5AVB B;  5B32 B;  4CAY A;  5B31 G;  2LY8 A;  3REL C;  1EQZ C;  4Z66 C;  4WV4 B;  4R8P B;  3UT9 C;  4J8W C;  3KUY D;  3AZJ A;  3VH6 T;  1P3M A;  1AOI A;  4WU8 A;  1T3U A;  5AVB C;  5CPK A;  5CPI B;  3W98 D;  2F8N G;  3C1C B;  1KX3 B;  3B6G B;  2RVQ C;  5B1L C;  4R8P C;  5B33 D;  1KX4 A;  5BS7 A;  3MGQ B;  4KUD A;  5B1M D;  5B2I C;  2HIO C;  1M1A B;  3W97 B;  4LD9 C;  1HTA A;  1ZLA B;  3KWQ A;  4XZQ D;  4H9O A;  3MGP A;  3AZI B;  5B31 B;  1KX3 C; 
#chains in the Genus database with same CATH homology
 5CP6 A;  3NQJ B;  3B0D B;  5B2J B;  3MGQ C;  5AVC A;  1H3O B;  1P3A A;  5AY8 D;  3C1B A;  1P3G A;  1M1A C;  1M19 C;  5AV5 A;  2YFV B;  2VQR A;  3VH6 W;  1P3K C;  2BG1 A;  4M6B A;  3REI D;  4H9P A;  5E5A D;  1HQ3 B;  2F8N B;  3LZ0 C;  5CPJ D;  3UTA D;  2NZD C;  3X1S D;  3AFA C;  3X1U D;  5B24 C;  5CPI A;  3MVD B;  4ZBJ B;  4WU9 B;  4YM6 B;  2NQB A;  4NE5 A;  3AN2 D;  3W98 A;  3AZL B;  5DNM D;  4YS3 B;  4JJN B;  3W97 A;  2FJ7 D;  1ZLA A;  3REH C;  3AZE C;  3MGR B;  3AZF A;  3VH5 T;  3AZH D;  3MVD C;  3AZI A;  4XZQ A;  3IP4 C;  4CSR B;  5B2J A;  4YS3 C;  1S32 D;  1ID3 D;  5GXQ D;  5AV6 B;  5DNN D;  1B67 A;  5AY8 A;  3KXB B;  1U35 D;  2Y2N A;  1TZY D;  3W96 B;  1HQ3 A;  1WWI A;  1P3P C;  3P5J B;  5B0Z C;  2L5A A;  5G49 B;  1P3L D;  3X1V D;  1P3F D;  1M18 D;  3B6F D;  3WTP B;  5AV6 C;  3LEL C;  1F66 B;  4J8U B;  2YFW B;  5CPJ A;  1P3I B;  5JRG B;  3WKJ B;  1KX5 B;  4HGA B;  5BNX A;  3AZK B;  4QLC C;  3VH5 W;  3MGS B;  2Y2K A;  5C3I B;  4JJN A;  4KGC D;  1F66 C;  4J8U C;  3AV1 C;  1P3I C;  3AZG D;  5GSU B;  3AV2 D;  1P34 C;  1KX5 C;  2Y2O A;  2F2A C;  3AZH A;  5B0Y C;  1BH9 B;  2BYM B;  2CV5 B;  3MGS C;  5C3I C;  3TU4 D;  1P3M D;  2Y2Q A;  1AOI D;  4G91 C;  5DNN A;  4H9N B;  4Z5T D;  1U35 A;  3AYW B;  3LJA C;  4XUJ D;  3V9R A;  1P3L A;  3WAA A;  5GT3 B;  1P3B B;  2YFW A;  2UWX A;  5F99 D;  5BT1 D;  4J8X B;  5JRG A;  3AZN C;  3WKJ A;  3AZK A;  3EG5 B;  3EPL A;  3MGP D;  3REL D;  3LZ1 B;  2ARO A;  1EQZ B;  5AVC D;  2Y2H A;  4Z66 B;  1P3A D;  1P3O B;  3C1B D;  5GSU A;  4J8V C;  3UT9 B;  1P3G D;  4KGC A;  4NFT A;  2BYK A;  5B32 D;  2BYM A;  3LZ1 C;  2CV5 A;  5B1L B;  1P3O C;  3AZJ C;  3TU4 A;  1BH8 A;  4AWL B;  5B2I B;  2HIO B;  4KHA B;  4LD9 B;  2ZM5 A;  5CPI D;  1TAF B;  2Y2M A;  3REJ B;  3C1C D;  3B6G D;  3AYW A;  5CPK C;  2NQB D;  4H9S A;  3MGQ D;  4Z5T A;  3REK B;  1KX4 C;  5GT3 A;  1P3B A;  4KUD C;  3W97 D;  1M1A D;  4XUJ A;  2PYO C;  1ZLA D;  5B40 B;  1N1J A;  1R4V A;  3AZF D;  4AWL C;  5F99 A;  3KWQ C;  1M19 B;  3AZI D;  3REJ C;  5B31 D;  4DRA A;  4ZUX C;  3REL A;  5AV9 C;  1P3K B;  1EQZ A;  5B2J D;  2RIQ A;  3REK C;  2JE5 A;  3WA9 B;  3LZ0 B;  5GT0 C;  4WZS B;  4J8W A;  5B40 C;  2Y2I A;  2NZD B;  4H9R B;  5AV5 C;  3AFA B;  3B0C T;  3W99 B;  2F8N D;  1HQ3 D;  3UTB C;  5AVB A;  5B24 B;  5B32 A;  3X1T C;  3AZM B;  5B1L A;  1JFI B;  3WA9 C;  4R8P A;  2ZY2 A;  3EPJ A;  5B2I A;  2HIO A;  4KHA A;  3KUY C;  4LD9 A;  2F8N K;  3REH B;  3AZE B;  5B1M B;  3W99 C;  4WU9 D;  4YM6 D;  2ZY5 A;  3AZL D;  3NQU B;  3C1C A;  3B0B A;  3AZM C;  1KX3 A;  3B6G A;  4H9Q B;  4JJN D;  1Z2C B;  3W98 C;  3MGQ A;  3MNN B;  5B33 C;  3MGR D;  1M1A A;  1M19 A;  2IO5 B;  5B1M C;  4NE6 A;  1P3K A;  4XZQ C;  5B31 A;  1P3P B;  5B0Z B;  3REI B;  3A1K A;  3B0C W;  3NQJ A;  5E5A B;  4DQY B;  3MNN C;  1H3O A;  2JCH A;  3KXB D;  1F1E A;  3LEL B;  2IO5 C;  5AY8 C;  3AFA A;  3W96 D;  3X1S B;  2YFV A;  5B24 A;  4G92 C;  3X1U B;  2F8N A;  4QLC B;  2HUE C;  3WTP D;  5AV8 B;  3REI C;  3WAA D;  5E5A C;  1F66 D;  1P3I D;  5DNM B;  5JRG D;  5CPJ C;  3UTA C;  3REH A;  3AZK D;  3AZE A;  3AV1 B;  1KX5 D;  3WKJ D;  3X1S C;  1P34 B;  3MVD A;  3X1U C;  3NQU A;  5BNV B;  2ARO D;  4WU9 A;  4YM6 A;  5AV8 C;  4H9Q A;  3A6N B;  5B0Y B;  3AZL A;  4YS3 A;  3AN2 C;  5GSU D;  5DNM C;  3O62 B;  2XD5 A;  1ID3 B;  3MGR A;  2FJ7 C;  4G91 B;  2Y2P A;  1B6W A;  2CV5 D;  3AZH C;  3A6N C;  1TZY B;  4CSR A;  3LJA B;  3X1V B;  5AV6 A;  3O62 C;  1S32 C;  1ID3 C;  5CHL B;  5GXQ C;  2ZY4 A;  2Y2J A;  3KXB A;  5DNN C;  3AZN B;  3AYW D;  3W96 A;  1U35 C;  1TZY C;  5G49 A;  5GT3 D;  1P3B D;  3WTP A;  1P3F C;  1P3L C;  3X1V C;  4J8X D;  1M18 C;  3B6F C;  1F66 A;  5JA4 B;  4UUZ B;  4J8U A;  2DF4 C;  3AV1 A;  1P3I A;  2Y2L A;  4J8V B;  4X23 B;  1P34 A;  3AZG B;  1KX5 A;  4Z2M H;  1EQZ D;  2JSS A;  2W8S A;  5B0Y A;  4Z66 D;  3MGS A;  3UT9 D;  4J8W D;  1A7W A;  3AZJ B;  4X23 C;  1P3M B;  3AZG C;  3AV2 C;  5AVB D;  4WU8 B;  1BH9 A;  2RVQ D;  5B1L D;  5CPK B;  4R8P D;  3LJA A;  1KX4 B;  3R45 B;  5B2I D;  2HIO D;  4KUD B;  4LD9 D;  2PYO B;  1KU5 A;  1P3M C;  1AOI C;  4WU8 C;  3KWQ B;  4H9N A;  1KX3 D;  3MGP B;  4ZUX B;  5AV9 B;  5B40 D;  5CP6 B;  5BS7 C;  4NE3 A;  5GT0 B;  3WTP E;  4J8V A;  4J8X A;  1M19 D;  1P3K D;  5AV5 B;  3LZ1 A;  3UTB B;  3MGP C;  3WA9 D;  3LZ0 D;  4H9P B;  3X1T B;  3FDD A;  2F8N H;  4Z66 A;  5CP6 C;  3EPK A;  1P3O A;  3KFU G;  2NZD D;  5AVC C;  3UT9 A;  1P3A C;  3AFA D;  3W99 D;  3C1B C;  1P3G C;  3KUY B;  2G5I C;  5B24 D;  3AZM D;  5B32 C;  1W2E A;  2NQB B;  3W98 B;  3R45 A;  2FFF B;  2PYO A;  3REH D;  5B33 B;  3AZE D;  3MVD D;  1TAF A;  3AZF B;  3REJ A;  5CPI C;  4ZUX A;  5AV9 A;  3C1C C;  2G5H C;  4XZQ B;  3B6G C;  4YS3 D;  2DQN C;  3MNN D;  3REK A;  2NQB C;  5GT0 A;  5B40 A;  3W97 C;  1ZLA C;  3AZF C;  5AY8 B;  1BFM A;  3UTB A;  3EPH A;  1P3P D;  5B0Z D;  4G92 B;  3AZI C;  5B31 C;  3X1T A;  2HUE B;  3WA9 A;  3LZ0 A;  3B0D C;  5B2J C;  5AV6 D;  3LEL D;  5KDM B;  1PZR A;  3KUY A;  2NZD A;  4H9R A;  5CPJ B;  3UTA B;  5BO0 B;  3W99 A;  4QLC D;  5AV8 D;  5BNX B;  1HQ3 C;  3AZM A;  3VH6 A;  1JFI A;  5FUG B;  4E45 A;  4J8U D;  3AV1 D;  5B33 A;  4UPK A;  3AN2 B;  1P34 D;  4WJ3 C;  5B1M A;  2FJ7 B;  4WNN B;  3A6N D;  4ZBJ C;  5B0Y D;  4E44 A;  4WU9 C;  4YM6 C;  3MGS D;  3AZH B;  3AZL C;  3O62 D;  3MNN A;  4JJN C;  1S32 B;  3MGR C;  5GXQ B;  3AL0 C;  5DNN B;  2ZY3 A;  3LJA D;  1P3P A;  1U35 B;  5B0Z A;  3REI A;  5E5A A;  5KDM A;  3V9R B;  1P3F B;  1M18 B;  1P3L B;  3B6F B;  3WAA B;  3LEL A;  3UTA A;  1ULY A;  3AZN D;  3KXB C;  5BO0 A;  3KSY A;  3X1S A;  3W96 C;  3X1U A;  4QLC A;  5AV8 A;  2ARO B;  5FUG A;  3WTP C;  3AN2 A;  3WAA C;  4J8V D;  5DNM A;  4X23 D;  3H0M C;  4EO5 B;  4KGC B;  2FJ7 A;  5JRG C;  4WNN A;  3WKJ C;  4HGA C;  3AZK C;  2BYK B;  3LZ1 D;  3AV2 B;  5BNV A;  1Q9C A;  3A6N A;  2ARO C;  4CAY B;  1P3O D;  3AZJ D;  3VH5 A;  3O62 A;  1S32 A;  1ID3 A;  5GSU C;  5GXQ A;  4EO5 C;  3TU4 B;  4WU8 D;  4KGC C;  1BH8 B;  4Z2M G;  1AOI B;  5CPK D;  4DRB A;  3H0R C;  1TZY A;  1KX4 D;  5B32 G;  3H0L C;  2CV5 C;  2CWE A;  4KUD D;  4Z5T B;  1P3F A;  1M18 A;  3B6F A;  3X1V A;  2PYO D;  4XUJ B;  2XD1 A;  1N1J B;  3TU4 C;  3KWQ D;  3REJ D;  3AZN A;  5F99 B;  2J8P A;  4ZUX D;  5AV9 D;  3AYW C;  4H9O B;  3REK D;  5CP6 D;  3REL B;  4H9S C;  5GT0 D;  4Z5T C;  5GT3 C;  1P3B C;  5JA4 A;  4UUZ A;  4XUJ C;  4J8W B;  2Y2G A;  3A1I A;  5AVC B;  4J8X C;  5AV5 D;  4X23 A;  1P3A B;  1WWS A;  3C1B B;  3UTB D;  3F6T A;  5F99 C;  5BT1 C;  3AZG A;  3AV2 A;  1P3G B;  3X1T D;  5AVB B;  5B32 B;  4CAY A;  5B31 G;  2LY8 A;  3REL C;  1EQZ C;  4Z66 C;  4WV4 B;  4R8P B;  3UT9 C;  4J8W C;  3KUY D;  3AZJ A;  3VH6 T;  1P3M A;  1AOI A;  4WU8 A;  1T3U A;  5AVB C;  5CPK A;  5CPI B;  3W98 D;  2F8N G;  3C1C B;  1KX3 B;  3B6G B;  2RVQ C;  5B1L C;  4R8P C;  5B33 D;  1KX4 A;  5BS7 A;  3MGQ B;  4KUD A;  5B1M D;  5B2I C;  2HIO C;  1M1A B;  3W97 B;  4LD9 C;  1HTA A;  1ZLA B;  3KWQ A;  4XZQ D;  4H9O A;  3MGP A;  3AZI B;  5B31 B;  1KX3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...