3WTPC

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpC00
3MGQD 3VH6W 4H9OB 1BH9B 1TZYD 4ZUXB 1P3OD 4R8PB 3MNNA 2YFVA 5GSUC 5B2ID 5B0ZD 3MGQC 1F66C 3KUYA 3AN2A 4KUDB 1TZYC 2LY8A 5CPJB 5AV6B 5B0ZC 4H9SA 3WTPD 5JRGD 3X1UC 5B31D 3RELA 3LZ0D 4LD9C 5B24C 1U35C 3AZFA 5JRGC 3AYWC 1EQZB 3LZ0C 1M1AB 3AZKA 4NE3A 4KGCD 3B0CW 5DNMC 3B6FD 5BNXA 4J8VB 4Z5TA 3X1SB 1M19D 3UTAC 4KGCC 2PYOC 3AZHC 5DNNA 1P34B 3X1TD 2CV5D 1KX4D 5AV9C 3AZIC 3KWQC 1P3FB 2F8NH 5B1MC 3VH5T 2CV5C 4X23D 1P3PD 3LJAA 2NQBB 3UT9D 3A6NB 3B6GB 3KXBB 3C1CB 2JSSA 3WAAC 4ZUXD 3UT9C 4R8PD 1P3GA 1HTAA 3AV1C 4Z2MG 4H9QB 3REJD 3W96D 5AY8D 1ZLAC 5B2JA 4KUDD 4CSRB 4J8WB 5CPJD 5AV6D 3AZEB 5C3IC 1P3AB 5CPID 3REJC 2IO5C 3W96C 5AY8C 5B32G 2HIOA 5BS7A 5B32C 5KDMB 3AZJB 3WKJC 3AZNB 5AVCA 2BYMB 5CPIC 4J8XB 3W98B 1P3AA 1EQZD 3MGRB 1M1AD 1AOIC 1S32B 3WA9C 3MGPC 2RVQC 5CP6B 3NQUA 4XUJA 3W97C 3LZ1D 3AFAB 3LELA 5G49A 5CPKB 5E5AC 1P34D 3LZ1C 1ID3B 3REKB 5CP6A 3REHD 1P3IC 3MVDB 2AROD 3TU4B 4G91C 4XZQA 1M18A 1P3FD 3REHC 4YS3B 2AROC 2NQBD 2YFWA 5AV8A 1A7WA 4YM6A 3B0CT 4NE6A 5F99C 4Z66C 3A6ND 4JJNB 3KXBD 3C1CD 3B6GD 4QLCC 5B33A 4M6BA 5GT0A 1HQ3A 5B0YC 5AVBB 1JFIA 1KX5B 3UTBC 4J8WD 4HGAB 5B40C 3AZED 3W99B 4J8UB 3R45A 3AZJD 3AZND 2NZDC 4E44A 3W98D 3O62D 3MGRD 1KX3B 1S32D 4WU8A 2F8NG 3AZMA 1P3BC 3O62C 3AV2B 3AFAD 1P3LD 5CPKD 4AWLC 5GXQB 5GSUA 3C1BC 3MGQA 3AZGB 1F66A 1ID3D 3REKD 1P3LC 3REIC 3MVDD 3AZLC 5FUGB 3TU4D 2FJ7C 5GT3D 3X1UA 4CAYA 4YS3D 4ZBJC 3MNNB 2YFVB 5B24A 1P3MC 4LD9A 3VH6A 1U35A 5GT3C 4JJND 1N1JA 5BT1D 3KUYB 3AYWA 3AN2B 1P3KB 4NE5A 4UUZA 5DNMA 3RELB 3UTAA 1KX5D 3MGSD 2HUEB 3AZHA 1P3OC 2PYOA 3AZFB 3W99D 5B2IC 1P3KA 4WNNA 4J8UD 3AZKB 1WWIA 3MGSC 3X1VD 4DRBA 5AV9A 3AZIA 5BNXB 3WTPC 4Z5TB 3KWQA 5CHLB 5B31G 5B1MA 5B31C 3X1VC 2CV5A 1KX3D 5DNNB 3V9RA 4WU9D 3AV2D 3WAAA 3AV1A 3AZGD 3B6FC 4WU9C 1B6WA 4DRAA 1M19C 4WV4B 3LJAB 1ZLAA 5JA4A 4H9PA 3NQJA 1TAFA 5B1LD 3X1TC 3B0DB 1KX4C 5B32A 3MNND 3WKJA 1P3GB 5CPIA 5B1LC 3KUYD 3AN2D 5B2JB 4X23C 1AOIA 1P3PC 3WA9A 3MGPA 3RELD 3W97A 2HIOB 5E5AA 4ZUXC 4R8PC 5AVCB 3WTPE 3RELC 3LZ1A 3AZKD 1P3IA 4KUDC 5CPJC 4EO5B 5AV6C 3NQUB 4XUJB 3LELB 3REHA 5G49B 3VH6T 2AROA 1F1EA 5DNND 5F99A 4Z66A 4J8VD 4QLCA 3X1SD 1EQZC 1M1AC 4XZQB 5B0YA 1M18B 4J8VC 3X1SC 5AV5B 3LJAD 3UTBA 2YFWB 5AV8B 5B40A 4YM6B 1P34C 5B33B 5GT0B 1HQ3B 5AV5A 1P3GD 2NZDA 1JFIB 4G92B 1P3FC 5B2JD 1P3GC 2NQBC 1R4VA 3A6NC 3B6GC 1P3BA 2F8NA 3KXBC 5BO0A 3C1CC 2HIOD 3R45B 4WZSB 3C1BA 1P3AD 1P3LA 3REIA 4WU8B 3AZLA 4J8WC 3AZEC 2FJ7A 2BYKA 3AZMB 1P3AC 4NFTA 4XUJD 4J8XD 2CWEA 3LELD 5GSUB 3AZJC 1P3MA 3AZNC 1B67A 3MGQB 5GT3A 1F66B 4J8XC 3W98C 5CP6D 3MGRC 1S32C 4XZQD 1M18D 3X1UB 5CP6C 4CAYB 1BH8A 3AFAC 4LD9B 5B24B 5CPKC 3B0BA 1TZYA 5AV8D 1P3OA 4YM6D 1U35B 5B2IA 5JRGB 1N1JB 5B0ZA 3AYWB 5B33D 1ID3C 3REKC 3MGSA 5GT0D 1HQ3D 3MVDC 4UUZB 5DNMB 3TU4C 3WTPA 3UTAB 5JRGA 5B31A 3X1VA 1ULYA 4YS3C 3LZ0A 3AZHB 2PYOB 4H9NA 4WNNB 4JJNC 4KHAA 5BT1C 5AVBD 5AV9B 3AZIB 4KGCA 3KWQB 3B6FA 4WU9A 5B1MB 5AVBC 2CV5B 1M19A 4H9RA 4WU8D 1KX5C 3V9RB 4HGAC 1H3OA 3AZMD 3W99C 3WAAB 4J8UC 3X1TA 1KX4A 5GSUD 3AV1B 1F66D 5B1LA 1ZLAB 1KX3C 4X23A 5JA4B 1P3PA 4H9PB 5C3IB 3UT9A 3NQJB 5GXQD 1TAFB 3X1UD 3REJB 2IO5B 3W96B 5AY8B 4H9OA 1BH9A 3AV2C 4E45A 5B32B 5B24D 3WKJB 4LD9D 4ZUXA 4R8PA 1U35D 5GXQC 5CPIB 3AYWD 3AZGC 3REJA 1AOIB 3W96A 2F8NK 5AY8A 3MGPB 3WA9B 4KUDA 5DNMD 5CPJA 5AV6A 3W97B 3UTAD 5E5AB 3AZHD 2PYOD 3MNNC 1WWSA 1P3KD 3LZ1B 3KUYC 1P3IB 3AN2C 1EQZA 1M1AA 5AV9D 4G91B 3AZID 1P3KC 4H9SC 3KWQD 3AZFD 4J8VA 3REHB 5B1MD 3X1SA 2AROB 1Q9CA 2HUEC 3AZFC 5F99B 4Z66B 1P34A 4Z5TD 4QLCB 3WAAD 3AZKC 5B0YB 3AV1D 4Z5TC 1P3FA 1BFMA 1ZLAD 3UTBB 5B40B 5DNNC 2NQBA 3A6NA 3B6GA 3KXBA 3C1CA 5B32D 3WKJD 2NZDB 2L5AA 4H9QA 1AOID 3LJAC 3MGPD 3WA9D 2RVQD 4CSRA 4J8WA 3AZEA 1P3BB 2F8NB 3O62B 5BO0B 3W97D 1KU5A 3KSYA 3B0DC 5E5AD 4AWLB 5KDMA 3AZJA 3C1BB 3AZNA 2BYMA 4J8XA 1P3LB 1P3ID 3W98A 3O62A 3MGRA 3REIB 5B2JC 3AZLB 1S32A 2FJ7B 2BYKB 5AVCD 2HIOC 5BS7C 3AFAA 4ZBJB 5CPKA 1P3MB 5F99D 5GT3B 5AVCC 4Z66D 4QLCD 1ID3A 3REKA 3MVDA 5B0YD 3TU4A 4EO5C 4XUJC 1BH8B 3LELC 3UTBD 1TZYB 4YS3A 1P3OB 5B40D 5B2IB 5B0ZB 4JJNA 3MGSB 5AV5D 2NZDD 4XZQC 3WTPB 1M18C 5AVBA 5B31B 3X1VB 5AV5C 3LZ0B 1KX5A 3VH5A 5AV8C 4H9NB 4YM6C 1P3BD 3W99A 2F8ND 4KHAB 3VH5W 4J8UA 5B33C 4Z2MH 4KGCB 5BNVB 1HQ3C 5GT0C 3C1BD 3B6FB 4WU9B 1M19B 4G92C 3REID 4H9RB 3AZLD 1KX3A 1H3OB 2FJ7D 5BNVA 3X1TB 3AV2A 1KX4B 1P3MD 5GXQA 5B1LB 3AZGA 4X23B 1P3PB 4WU8C 5FUGA 3UT9B 3AZMC
chains in the Genus database with same CATH superfamily
3MGQD 3VH6W 4H9OB 1BH9B 1TZYD 4ZUXB 1P3OD 4R8PB 3MNNA 2YFVA 5GSUC 5B2ID 5B0ZD 3MGQC 2XD1A 1F66C 3KUYA 3AN2A 1T3UA 4KUDB 1TZYC 2J8PA 2LY8A 5CPJB 5AV6B 5B0ZC 4H9SA 3WTPD 5JRGD 3X1UC 3H0MC 5B31D 3RELA 3LZ0D 4LD9C 5B24C 1U35C 3AZFA 5JRGC 3AYWC 1EQZB 3LZ0C 1M1AB 3AZKA 4NE3A 4KGCD 3B0CW 5DNMC 3B6FD 5BNXA 2ZM5A 4J8VB 4Z5TA 3X1SB 1M19D 3UTAC 4KGCC 2PYOC 3AZHC 5DNNA 1P34B 3H0LC 3X1TD 2CV5D 1KX4D 5AV9C 3AZIC 3KWQC 1P3FB 2F8NH 5B1MC 3VH5T 2CV5C 4X23D 1P3PD 2Y2JA 3LJAA 2NQBB 3UT9D 3A6NB 2Y2IA 3B6GB 3KXBB 3C1CB 2JSSA 3WAAC 4ZUXD 3UT9C 4R8PD 1P3GA 1HTAA 3AV1C 4Z2MG 4H9QB 3REJD 3W96D 5AY8D 1ZLAC 5B2JA 4KUDD 4CSRB 4J8WB 5CPJD 5AV6D 3AZEB 5C3IC 1P3AB 5CPID 3REJC 2F2AC 2IO5C 3W96C 5AY8C 5B32G 2HIOA 5BS7A 5B32C 5KDMB 3AZJB 3WKJC 3AZNB 5AVCA 2BYMB 5CPIC 4J8XB 3W98B 1P3AA 1EQZD 3MGRB 4DQYB 1M1AD 1AOIC 1S32B 3WA9C 3MGPC 2RVQC 5CP6B 3NQUA 4XUJA 3W97C 3LZ1D 3AFAB 3LELA 5G49A 5CPKB 5E5AC 1P34D 3EG5B 4UPKA 3LZ1C 1ID3B 3REKB 5CP6A 3REHD 1P3IC 3AL0C 3MVDB 2AROD 3TU4B 4G91C 4XZQA 1M18A 1P3FD 3REHC 4YS3B 2AROC 2NQBD 2YFWA 5AV8A 1A7WA 4NE6A 3B0CT 4YM6A 5F99C 4Z66C 3A6ND 4JJNB 3KXBD 3C1CD 3B6GD 4QLCC 2ZY2A 5B33A 4M6BA 5GT0A 1HQ3A 5B0YC 5AVBB 1JFIA 1KX5B 3UTBC 4J8WD 4HGAB 5B40C 3AZED 3W99B 4J8UB 3R45A 3AZJD 3AZND 2NZDC 4E44A 3W98D 3O62D 3MGRD 1KX3B 1S32D 4WU8A 2F8NG 3AZMA 1P3BC 3A1KA 3O62C 3AV2B 3AFAD 1P3LD 5CPKD 4AWLC 2BG1A 5GXQB 5GSUA 3C1BC 3MGQA 3AZGB 1F66A 1ID3D 3REKD 1P3LC 3REIC 3MVDD 3AZLC 5FUGB 3TU4D 2FJ7C 5GT3D 3X1UA 4CAYA 4YS3D 4ZBJC 3MNNB 2YFVB 5B24A 1P3MC 4LD9A 2Y2PA 3VH6A 1U35A 5GT3C 4JJND 1N1JA 5BT1D 3KUYB 3AYWA 3AN2B 4WJ3C 1P3KB 4NE5A 4UUZA 5DNMA 3RELB 3UTAA 1KX5D 3MGSD 2HUEB 3AZHA 1P3OC 2PYOA 3AZFB 3W99D 5B2IC 1P3KA 4WNNA 4J8UD 3AZKB 1WWIA 3MGSC 3X1VD 4DRBA 5AV9A 3AZIA 5BNXB 3WTPC 4Z5TB 3KWQA 5CHLB 5B31G 5B1MA 5B31C 3X1VC 2CV5A 1KX3D 5DNNB 3V9RA 4WU9D 3AV2D 3WAAA 3AV1A 3AZGD 3B6FC 4WU9C 1B6WA 4DRAA 3EPKA 1M19C 4WV4B 3LJAB 1ZLAA 5JA4A 4H9PA 3NQJA 1TAFA 5B1LD 3X1TC 2Y2QA 3B0DB 1KX4C 5B32A 3MNND 3WKJA 1P3GB 5CPIA 5B1LC 3KUYD 3AN2D 5B2JB 4X23C 1AOIA 1P3PC 3WA9A 3MGPA 3RELD 3W97A 2HIOB 5E5AA 4ZUXC 4R8PC 5AVCB 3WTPE 3RELC 3LZ1A 3AZKD 1P3IA 4KUDC 2Y2GA 4EO5B 5AV6C 5CPJC 3NQUB 4XUJB 3LELB 3REHA 3EPHA 5G49B 3VH6T 2AROA 1F1EA 5DNND 5F99A 4Z66A 4J8VD 4QLCA 3X1SD 1EQZC 1M1AC 4XZQB 3F6TA 2XD5A 2Y2HA 5B0YA 1M18B 4J8VC 3X1SC 5AV5B 3LJAD 2UWXA 3UTBA 2YFWB 2G5IC 5AV8B 5B40A 4YM6B 1P34C 5B33B 5GT0B 1HQ3B 5AV5A 1P3GD 2NZDA 1JFIB 1Z2CB 2JCHA 4G92B 1P3FC 5B2JD 1P3GC 2NQBC 3H0RC 3EPJA 1R4VA 3A6NC 3FDDA 1P3BA 3B6GC 2F8NA 3KXBC 5BO0A 3C1CC 2HIOD 3A1IA 3R45B 4WZSB 3C1BA 1P3AD 1P3LA 3REIA 4WU8B 3AZLA 4J8WC 3AZEC 2FJ7A 2BYKA 3AZMB 1P3AC 4NFTA 4XUJD 4J8XD 2CWEA 3LELD 5GSUB 3AZJC 1P3MA 2W8SA 1B67A 3MGQB 3AZNC 5GT3A 1F66B 4J8XC 3W98C 5CP6D 3MGRC 1S32C 2FFFB 4XZQD 1M18D 3X1UB 3EPLA 5CP6C 4CAYB 1BH8A 3AFAC 4LD9B 5B24B 5CPKC 3B0BA 1TZYA 5AV8D 1P3OA 4YM6D 1U35B 5B2IA 5JRGB 1N1JB 5B0ZA 3AYWB 5B33D 1ID3C 3REKC 3MGSA 5GT0D 1HQ3D 3MVDC 4UUZB 5DNMB 3TU4C 3WTPA 3UTAB 5JRGA 5B31A 3X1VA 2Y2KA 1ULYA 4YS3C 3LZ0A 3AZHB 2PYOB 4H9NA 4WNNB 4JJNC 4KHAA 5BT1C 5AVBD 1W2EA 5AV9B 3AZIB 4KGCA 3KWQB 3B6FA 4WU9A 5B1MB 5AVBC 2CV5B 1M19A 4H9RA 4WU8D 1KX5C 3V9RB 4HGAC 1H3OA 3AZMD 3W99C 1PZRA 3WAAB 4J8UC 3X1TA 1KX4A 5GSUD 3AV1B 2DF4C 1F66D 5B1LA 1ZLAB 1KX3C 4X23A 5JA4B 1P3PA 4H9PB 5C3IB 3UT9A 2Y2LA 3NQJB 5GXQD 1TAFB 3X1UD 3REJB 2IO5B 3W96B 5AY8B 4H9OA 1BH9A 3AV2C 4E45A 5B32B 5B24D 3WKJB 4LD9D 4ZUXA 4R8PA 1U35D 5GXQC 5CPIB 3AYWD 3AZGC 3REJA 1AOIB 3W96A 2F8NK 5AY8A 3MGPB 3WA9B 4KUDA 2RIQA 5DNMD 3P5JB 5CPJA 5AV6A 3W97B 3UTAD 5E5AB 3AZHD 2PYOD 3MNNC 1WWSA 1P3KD 3LZ1B 2ZY3A 3KUYC 1P3IB 3AN2C 1EQZA 1M1AA 5AV9D 4G91B 3AZID 1P3KC 4H9SC 3KWQD 3AZFD 4J8VA 3REHB 5B1MD 3X1SA 2AROB 2ZY4A 1Q9CA 2HUEC 3AZFC 5F99B 4Z66B 1P34A 4Z5TD 4QLCB 3WAAD 3AZKC 5B0YB 3IP4C 3AV1D 4Z5TC 1P3FA 1BFMA 1ZLAD 3UTBB 5B40B 5DNNC 2NQBA 3A6NA 3B6GA 3KXBA 3C1CA 5B32D 3WKJD 2NZDB 2L5AA 2ZY5A 4H9QA 1AOID 3LJAC 3MGPD 3WA9D 2RVQD 4CSRA 4J8WA 3AZEA 1P3BB 2F8NB 3O62B 5BO0B 3W97D 2VQRA 1KU5A 3KSYA 3B0DC 5E5AD 4AWLB 5KDMA 3AZJA 3C1BB 3AZNA 2BYMA 4J8XA 1P3LB 1P3ID 3W98A 3O62A 3MGRA 3REIB 5B2JC 3AZLB 1S32A 2FJ7B 2BYKB 5AVCD 2Y2MA 2HIOC 5BS7C 3AFAA 4ZBJB 5CPKA 1P3MB 5F99D 5GT3B 5AVCC 4Z66D 4QLCD 1ID3A 3REKA 3KFUG 3MVDA 5B0YD 3TU4A 4EO5C 4XUJC 2JE5A 1BH8B 3LELC 3UTBD 1TZYB 4YS3A 1P3OB 5B40D 5B2IB 5B0ZB 4JJNA 2DQNC 3MGSB 5AV5D 2NZDD 4XZQC 3WTPB 1M18C 5AVBA 5B31B 3X1VB 5AV5C 3LZ0B 1KX5A 3VH5A 5AV8C 4H9NB 4YM6C 1P3BD 3W99A 2F8ND 4KHAB 3VH5W 4J8UA 5B33C 4Z2MH 4KGCB 5BNVB 1HQ3C 5GT0C 3C1BD 2Y2NA 3B6FB 4WU9B 1M19B 4G92C 3REID 4H9RB 3AZLD 1KX3A 1H3OB 2FJ7D 5BNVA 3X1TB 2G5HC 3AV2A 1KX4B 1P3MD 2Y2OA 5GXQA 5B1LB 3AZGA 4X23B 1P3PB 4WU8C 5FUGA 3UT9B 3AZMC
chains in the Genus database with same CATH topology
3MGQD 3VH6W 4H9OB 1BH9B 1TZYD 4ZUXB 1P3OD 4R8PB 3MNNA 2YFVA 5GSUC 5B2ID 5B0ZD 3MGQC 2XD1A 1F66C 3KUYA 3AN2A 1T3UA 4KUDB 1TZYC 2J8PA 2LY8A 5CPJB 5AV6B 5B0ZC 4H9SA 3WTPD 5JRGD 3X1UC 3H0MC 5B31D 3RELA 3LZ0D 4LD9C 5B24C 1U35C 3AZFA 5JRGC 3AYWC 1EQZB 3LZ0C 1M1AB 3AZKA 4NE3A 4KGCD 3B0CW 5DNMC 3B6FD 5BNXA 2ZM5A 4J8VB 4Z5TA 3X1SB 1M19D 3UTAC 4KGCC 2PYOC 3AZHC 5DNNA 1P34B 3H0LC 3X1TD 2CV5D 1KX4D 5AV9C 3AZIC 3KWQC 1P3FB 2F8NH 5B1MC 3VH5T 2CV5C 4X23D 1P3PD 2Y2JA 3LJAA 2NQBB 3UT9D 3A6NB 2Y2IA 3B6GB 3KXBB 3C1CB 2JSSA 3WAAC 4ZUXD 3UT9C 4R8PD 1P3GA 1HTAA 3AV1C 4Z2MG 4H9QB 3REJD 3W96D 5AY8D 1ZLAC 5B2JA 4KUDD 4CSRB 4J8WB 5CPJD 5AV6D 3AZEB 5C3IC 1P3AB 5CPID 3REJC 2F2AC 2IO5C 3W96C 5AY8C 5B32G 2HIOA 5BS7A 5B32C 5KDMB 3AZJB 3WKJC 3AZNB 5AVCA 2BYMB 5CPIC 4J8XB 3W98B 1P3AA 1EQZD 3MGRB 4DQYB 1M1AD 1AOIC 1S32B 3WA9C 3MGPC 2RVQC 5CP6B 3NQUA 4XUJA 3W97C 3LZ1D 3AFAB 3LELA 5G49A 5CPKB 5E5AC 1P34D 3EG5B 4UPKA 3LZ1C 1ID3B 3REKB 5CP6A 3REHD 1P3IC 3AL0C 3MVDB 2AROD 3TU4B 4G91C 4XZQA 1M18A 1P3FD 3REHC 4YS3B 2AROC 2NQBD 2YFWA 5AV8A 1A7WA 4NE6A 3B0CT 4YM6A 5F99C 4Z66C 3A6ND 4JJNB 3KXBD 3C1CD 3B6GD 4QLCC 2ZY2A 5B33A 4M6BA 5GT0A 1HQ3A 5B0YC 5AVBB 1JFIA 1KX5B 3UTBC 4J8WD 4HGAB 5B40C 3AZED 3W99B 4J8UB 3R45A 3AZJD 3AZND 2NZDC 4E44A 3W98D 3O62D 3MGRD 1KX3B 1S32D 4WU8A 2F8NG 3AZMA 1P3BC 3A1KA 3O62C 3AV2B 3AFAD 1P3LD 5CPKD 4AWLC 2BG1A 5GXQB 5GSUA 3C1BC 3MGQA 3AZGB 1F66A 1ID3D 3REKD 1P3LC 3REIC 3MVDD 3AZLC 5FUGB 3TU4D 2FJ7C 5GT3D 3X1UA 4CAYA 4YS3D 4ZBJC 3MNNB 2YFVB 5B24A 1P3MC 4LD9A 2Y2PA 3VH6A 1U35A 5GT3C 4JJND 1N1JA 5BT1D 3KUYB 3AYWA 3AN2B 4WJ3C 1P3KB 4NE5A 4UUZA 5DNMA 3RELB 3UTAA 1KX5D 3MGSD 2HUEB 3AZHA 1P3OC 2PYOA 3AZFB 3W99D 5B2IC 1P3KA 4WNNA 4J8UD 3AZKB 1WWIA 3MGSC 3X1VD 4DRBA 5AV9A 3AZIA 5BNXB 3WTPC 4Z5TB 3KWQA 5CHLB 5B31G 5B1MA 5B31C 3X1VC 2CV5A 1KX3D 5DNNB 3V9RA 4WU9D 3AV2D 3WAAA 3AV1A 3AZGD 3B6FC 4WU9C 1B6WA 4DRAA 3EPKA 1M19C 4WV4B 3LJAB 1ZLAA 5JA4A 4H9PA 3NQJA 1TAFA 5B1LD 3X1TC 2Y2QA 3B0DB 1KX4C 5B32A 3MNND 3WKJA 1P3GB 5CPIA 5B1LC 3KUYD 3AN2D 5B2JB 4X23C 1AOIA 1P3PC 3WA9A 3MGPA 3RELD 3W97A 2HIOB 5E5AA 4ZUXC 4R8PC 5AVCB 3WTPE 3RELC 3LZ1A 3AZKD 1P3IA 4KUDC 2Y2GA 4EO5B 5AV6C 5CPJC 3NQUB 4XUJB 3LELB 3REHA 3EPHA 5G49B 3VH6T 2AROA 1F1EA 5DNND 5F99A 4Z66A 4J8VD 4QLCA 3X1SD 1EQZC 1M1AC 4XZQB 3F6TA 2XD5A 2Y2HA 5B0YA 1M18B 4J8VC 3X1SC 5AV5B 3LJAD 2UWXA 3UTBA 2YFWB 2G5IC 5AV8B 5B40A 4YM6B 1P34C 5B33B 5GT0B 1HQ3B 5AV5A 1P3GD 2NZDA 1JFIB 1Z2CB 2JCHA 4G92B 1P3FC 5B2JD 1P3GC 2NQBC 3H0RC 3EPJA 1R4VA 3A6NC 3FDDA 1P3BA 3B6GC 2F8NA 3KXBC 5BO0A 3C1CC 2HIOD 3A1IA 3R45B 4WZSB 3C1BA 1P3AD 1P3LA 3REIA 4WU8B 3AZLA 4J8WC 3AZEC 2FJ7A 2BYKA 3AZMB 1P3AC 4NFTA 4XUJD 4J8XD 2CWEA 3LELD 5GSUB 3AZJC 1P3MA 2W8SA 1B67A 3MGQB 3AZNC 5GT3A 1F66B 4J8XC 3W98C 5CP6D 3MGRC 1S32C 2FFFB 4XZQD 1M18D 3X1UB 3EPLA 5CP6C 4CAYB 1BH8A 3AFAC 4LD9B 5B24B 5CPKC 3B0BA 1TZYA 5AV8D 1P3OA 4YM6D 1U35B 5B2IA 5JRGB 1N1JB 5B0ZA 3AYWB 5B33D 1ID3C 3REKC 3MGSA 5GT0D 1HQ3D 3MVDC 4UUZB 5DNMB 3TU4C 3WTPA 3UTAB 5JRGA 5B31A 3X1VA 2Y2KA 1ULYA 4YS3C 3LZ0A 3AZHB 2PYOB 4H9NA 4WNNB 4JJNC 4KHAA 5BT1C 5AVBD 1W2EA 5AV9B 3AZIB 4KGCA 3KWQB 3B6FA 4WU9A 5B1MB 5AVBC 2CV5B 1M19A 4H9RA 4WU8D 1KX5C 3V9RB 4HGAC 1H3OA 3AZMD 3W99C 1PZRA 3WAAB 4J8UC 3X1TA 1KX4A 5GSUD 3AV1B 2DF4C 1F66D 5B1LA 1ZLAB 1KX3C 4X23A 5JA4B 1P3PA 4H9PB 5C3IB 3UT9A 2Y2LA 3NQJB 5GXQD 1TAFB 3X1UD 3REJB 2IO5B 3W96B 5AY8B 4H9OA 1BH9A 3AV2C 4E45A 5B32B 5B24D 3WKJB 4LD9D 4ZUXA 4R8PA 1U35D 5GXQC 5CPIB 3AYWD 3AZGC 3REJA 1AOIB 3W96A 2F8NK 5AY8A 3MGPB 3WA9B 4KUDA 2RIQA 5DNMD 3P5JB 5CPJA 5AV6A 3W97B 3UTAD 5E5AB 3AZHD 2PYOD 3MNNC 1WWSA 1P3KD 3LZ1B 2ZY3A 3KUYC 1P3IB 3AN2C 1EQZA 1M1AA 5AV9D 4G91B 3AZID 1P3KC 4H9SC 3KWQD 3AZFD 4J8VA 3REHB 5B1MD 3X1SA 2AROB 2ZY4A 1Q9CA 2HUEC 3AZFC 5F99B 4Z66B 1P34A 4Z5TD 4QLCB 3WAAD 3AZKC 5B0YB 3IP4C 3AV1D 4Z5TC 1P3FA 1BFMA 1ZLAD 3UTBB 5B40B 5DNNC 2NQBA 3A6NA 3B6GA 3KXBA 3C1CA 5B32D 3WKJD 2NZDB 2L5AA 2ZY5A 4H9QA 1AOID 3LJAC 3MGPD 3WA9D 2RVQD 4CSRA 4J8WA 3AZEA 1P3BB 2F8NB 3O62B 5BO0B 3W97D 2VQRA 1KU5A 3KSYA 3B0DC 5E5AD 4AWLB 5KDMA 3AZJA 3C1BB 3AZNA 2BYMA 4J8XA 1P3LB 1P3ID 3W98A 3O62A 3MGRA 3REIB 5B2JC 3AZLB 1S32A 2FJ7B 2BYKB 5AVCD 2Y2MA 2HIOC 5BS7C 3AFAA 4ZBJB 5CPKA 1P3MB 5F99D 5GT3B 5AVCC 4Z66D 4QLCD 1ID3A 3REKA 3KFUG 3MVDA 5B0YD 3TU4A 4EO5C 4XUJC 2JE5A 1BH8B 3LELC 3UTBD 1TZYB 4YS3A 1P3OB 5B40D 5B2IB 5B0ZB 4JJNA 2DQNC 3MGSB 5AV5D 2NZDD 4XZQC 3WTPB 1M18C 5AVBA 5B31B 3X1VB 5AV5C 3LZ0B 1KX5A 3VH5A 5AV8C 4H9NB 4YM6C 1P3BD 3W99A 2F8ND 4KHAB 3VH5W 4J8UA 5B33C 4Z2MH 4KGCB 5BNVB 1HQ3C 5GT0C 3C1BD 2Y2NA 3B6FB 4WU9B 1M19B 4G92C 3REID 4H9RB 3AZLD 1KX3A 1H3OB 2FJ7D 5BNVA 3X1TB 2G5HC 3AV2A 1KX4B 1P3MD 2Y2OA 5GXQA 5B1LB 3AZGA 4X23B 1P3PB 4WU8C 5FUGA 3UT9B 3AZMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ D;  3VH6 W;  4H9O B;  1BH9 B;  1TZY D;  4ZUX B;  1P3O D;  4R8P B;  3MNN A;  2YFV A;  5GSU C;  5B2I D;  5B0Z D;  3MGQ C;  1F66 C;  3KUY A;  3AN2 A;  4KUD B;  1TZY C;  2LY8 A;  5CPJ B;  5AV6 B;  5B0Z C;  4H9S A;  3WTP D;  5JRG D;  3X1U C;  5B31 D;  3REL A;  3LZ0 D;  4LD9 C;  5B24 C;  1U35 C;  3AZF A;  5JRG C;  3AYW C;  1EQZ B;  3LZ0 C;  1M1A B;  3AZK A;  4NE3 A;  4KGC D;  3B0C W;  5DNM C;  3B6F D;  5BNX A;  4J8V B;  4Z5T A;  3X1S B;  1M19 D;  3UTA C;  4KGC C;  2PYO C;  3AZH C;  5DNN A;  1P34 B;  3X1T D;  2CV5 D;  1KX4 D;  5AV9 C;  3AZI C;  3KWQ C;  1P3F B;  2F8N H;  5B1M C;  3VH5 T;  2CV5 C;  4X23 D;  1P3P D;  3LJA A;  2NQB B;  3UT9 D;  3A6N B;  3B6G B;  3KXB B;  3C1C B;  2JSS A;  3WAA C;  4ZUX D;  3UT9 C;  4R8P D;  1P3G A;  1HTA A;  3AV1 C;  4Z2M G;  4H9Q B;  3REJ D;  3W96 D;  5AY8 D;  1ZLA C;  5B2J A;  4KUD D;  4CSR B;  4J8W B;  5CPJ D;  5AV6 D;  3AZE B;  5C3I C;  1P3A B;  5CPI D;  3REJ C;  2IO5 C;  3W96 C;  5AY8 C;  5B32 G;  2HIO A;  5BS7 A;  5B32 C;  5KDM B;  3AZJ B;  3WKJ C;  3AZN B;  5AVC A;  2BYM B;  5CPI C;  4J8X B;  3W98 B;  1P3A A;  1EQZ D;  3MGR B;  1M1A D;  1AOI C;  1S32 B;  3WA9 C;  3MGP C;  2RVQ C;  5CP6 B;  3NQU A;  4XUJ A;  3W97 C;  3LZ1 D;  3AFA B;  3LEL A;  5G49 A;  5CPK B;  5E5A C;  1P34 D;  3LZ1 C;  1ID3 B;  3REK B;  5CP6 A;  3REH D;  1P3I C;  3MVD B;  2ARO D;  3TU4 B;  4G91 C;  4XZQ A;  1M18 A;  1P3F D;  3REH C;  4YS3 B;  2ARO C;  2NQB D;  2YFW A;  5AV8 A;  1A7W A;  4YM6 A;  3B0C T;  4NE6 A;  5F99 C;  4Z66 C;  3A6N D;  4JJN B;  3KXB D;  3C1C D;  3B6G D;  4QLC C;  5B33 A;  4M6B A;  5GT0 A;  1HQ3 A;  5B0Y C;  5AVB B;  1JFI A;  1KX5 B;  3UTB C;  4J8W D;  4HGA B;  5B40 C;  3AZE D;  3W99 B;  4J8U B;  3R45 A;  3AZJ D;  3AZN D;  2NZD C;  4E44 A;  3W98 D;  3O62 D;  3MGR D;  1KX3 B;  1S32 D;  4WU8 A;  2F8N G;  3AZM A;  1P3B C;  3O62 C;  3AV2 B;  3AFA D;  1P3L D;  5CPK D;  4AWL C;  5GXQ B;  5GSU A;  3C1B C;  3MGQ A;  3AZG B;  1F66 A;  1ID3 D;  3REK D;  1P3L C;  3REI C;  3MVD D;  3AZL C;  5FUG B;  3TU4 D;  2FJ7 C;  5GT3 D;  3X1U A;  4CAY A;  4YS3 D;  4ZBJ C;  3MNN B;  2YFV B;  5B24 A;  1P3M C;  4LD9 A;  3VH6 A;  1U35 A;  5GT3 C;  4JJN D;  1N1J A;  5BT1 D;  3KUY B;  3AYW A;  3AN2 B;  1P3K B;  4NE5 A;  4UUZ A;  5DNM A;  3REL B;  3UTA A;  1KX5 D;  3MGS D;  2HUE B;  3AZH A;  1P3O C;  2PYO A;  3AZF B;  3W99 D;  5B2I C;  1P3K A;  4WNN A;  4J8U D;  3AZK B;  1WWI A;  3MGS C;  3X1V D;  4DRB A;  5AV9 A;  3AZI A;  5BNX B;  3WTP C;  4Z5T B;  3KWQ A;  5CHL B;  5B31 G;  5B1M A;  5B31 C;  3X1V C;  2CV5 A;  1KX3 D;  5DNN B;  3V9R A;  4WU9 D;  3AV2 D;  3WAA A;  3AV1 A;  3AZG D;  3B6F C;  4WU9 C;  1B6W A;  4DRA A;  1M19 C;  4WV4 B;  3LJA B;  1ZLA A;  5JA4 A;  4H9P A;  3NQJ A;  1TAF A;  5B1L D;  3X1T C;  3B0D B;  1KX4 C;  5B32 A;  3MNN D;  3WKJ A;  1P3G B;  5CPI A;  5B1L C;  3KUY D;  3AN2 D;  5B2J B;  4X23 C;  1AOI A;  1P3P C;  3WA9 A;  3MGP A;  3REL D;  3W97 A;  2HIO B;  5E5A A;  4ZUX C;  4R8P C;  5AVC B;  3WTP E;  3REL C;  3LZ1 A;  3AZK D;  1P3I A;  4KUD C;  5CPJ C;  4EO5 B;  5AV6 C;  3NQU B;  4XUJ B;  3LEL B;  3REH A;  5G49 B;  3VH6 T;  2ARO A;  1F1E A;  5DNN D;  5F99 A;  4Z66 A;  4J8V D;  4QLC A;  3X1S D;  1EQZ C;  1M1A C;  4XZQ B;  5B0Y A;  1M18 B;  4J8V C;  3X1S C;  5AV5 B;  3LJA D;  3UTB A;  2YFW B;  5AV8 B;  5B40 A;  4YM6 B;  1P34 C;  5B33 B;  5GT0 B;  1HQ3 B;  5AV5 A;  1P3G D;  2NZD A;  1JFI B;  4G92 B;  1P3F C;  5B2J D;  1P3G C;  2NQB C;  1R4V A;  3A6N C;  3B6G C;  1P3B A;  2F8N A;  3KXB C;  5BO0 A;  3C1C C;  2HIO D;  3R45 B;  4WZS B;  3C1B A;  1P3A D;  1P3L A;  3REI A;  4WU8 B;  3AZL A;  4J8W C;  3AZE C;  2FJ7 A;  2BYK A;  3AZM B;  1P3A C;  4NFT A;  4XUJ D;  4J8X D;  2CWE A;  3LEL D;  5GSU B;  3AZJ C;  1P3M A;  3AZN C;  1B67 A;  3MGQ B;  5GT3 A;  1F66 B;  4J8X C;  3W98 C;  5CP6 D;  3MGR C;  1S32 C;  4XZQ D;  1M18 D;  3X1U B;  5CP6 C;  4CAY B;  1BH8 A;  3AFA C;  4LD9 B;  5B24 B;  5CPK C;  3B0B A;  1TZY A;  5AV8 D;  1P3O A;  4YM6 D;  1U35 B;  5B2I A;  5JRG B;  1N1J B;  5B0Z A;  3AYW B;  5B33 D;  1ID3 C;  3REK C;  3MGS A;  5GT0 D;  1HQ3 D;  3MVD C;  4UUZ B;  5DNM B;  3TU4 C;  3WTP A;  3UTA B;  5JRG A;  5B31 A;  3X1V A;  1ULY A;  4YS3 C;  3LZ0 A;  3AZH B;  2PYO B;  4H9N A;  4WNN B;  4JJN C;  4KHA A;  5BT1 C;  5AVB D;  5AV9 B;  3AZI B;  4KGC A;  3KWQ B;  3B6F A;  4WU9 A;  5B1M B;  5AVB C;  2CV5 B;  1M19 A;  4H9R A;  4WU8 D;  1KX5 C;  3V9R B;  4HGA C;  1H3O A;  3AZM D;  3W99 C;  3WAA B;  4J8U C;  3X1T A;  1KX4 A;  5GSU D;  3AV1 B;  1F66 D;  5B1L A;  1ZLA B;  1KX3 C;  4X23 A;  5JA4 B;  1P3P A;  4H9P B;  5C3I B;  3UT9 A;  3NQJ B;  5GXQ D;  1TAF B;  3X1U D;  3REJ B;  2IO5 B;  3W96 B;  5AY8 B;  4H9O A;  1BH9 A;  3AV2 C;  4E45 A;  5B32 B;  5B24 D;  3WKJ B;  4LD9 D;  4ZUX A;  4R8P A;  1U35 D;  5GXQ C;  5CPI B;  3AYW D;  3AZG C;  3REJ A;  1AOI B;  3W96 A;  2F8N K;  5AY8 A;  3MGP B;  3WA9 B;  4KUD A;  5DNM D;  5CPJ A;  5AV6 A;  3W97 B;  3UTA D;  5E5A B;  3AZH D;  2PYO D;  3MNN C;  1WWS A;  1P3K D;  3LZ1 B;  3KUY C;  1P3I B;  3AN2 C;  1EQZ A;  1M1A A;  5AV9 D;  4G91 B;  3AZI D;  1P3K C;  4H9S C;  3KWQ D;  3AZF D;  4J8V A;  3REH B;  5B1M D;  3X1S A;  2ARO B;  1Q9C A;  2HUE C;  3AZF C;  5F99 B;  4Z66 B;  1P34 A;  4Z5T D;  4QLC B;  3WAA D;  3AZK C;  5B0Y B;  3AV1 D;  4Z5T C;  1P3F A;  1BFM A;  1ZLA D;  3UTB B;  5B40 B;  5DNN C;  2NQB A;  3A6N A;  3B6G A;  3KXB A;  3C1C A;  5B32 D;  3WKJ D;  2NZD B;  2L5A A;  4H9Q A;  1AOI D;  3LJA C;  3MGP D;  3WA9 D;  2RVQ D;  4CSR A;  4J8W A;  3AZE A;  1P3B B;  2F8N B;  3O62 B;  5BO0 B;  3W97 D;  1KU5 A;  3KSY A;  3B0D C;  5E5A D;  4AWL B;  5KDM A;  3AZJ A;  3C1B B;  3AZN A;  2BYM A;  4J8X A;  1P3L B;  1P3I D;  3W98 A;  3O62 A;  3MGR A;  3REI B;  5B2J C;  3AZL B;  1S32 A;  2FJ7 B;  2BYK B;  5AVC D;  2HIO C;  5BS7 C;  3AFA A;  4ZBJ B;  5CPK A;  1P3M B;  5F99 D;  5GT3 B;  5AVC C;  4Z66 D;  4QLC D;  1ID3 A;  3REK A;  3MVD A;  5B0Y D;  3TU4 A;  4EO5 C;  4XUJ C;  1BH8 B;  3LEL C;  3UTB D;  1TZY B;  4YS3 A;  1P3O B;  5B40 D;  5B2I B;  5B0Z B;  4JJN A;  3MGS B;  5AV5 D;  2NZD D;  4XZQ C;  3WTP B;  1M18 C;  5AVB A;  5B31 B;  3X1V B;  5AV5 C;  3LZ0 B;  1KX5 A;  3VH5 A;  5AV8 C;  4H9N B;  4YM6 C;  1P3B D;  3W99 A;  2F8N D;  4KHA B;  3VH5 W;  4J8U A;  5B33 C;  4Z2M H;  4KGC B;  5BNV B;  1HQ3 C;  5GT0 C;  3C1B D;  3B6F B;  4WU9 B;  1M19 B;  4G92 C;  3REI D;  4H9R B;  3AZL D;  1KX3 A;  1H3O B;  2FJ7 D;  5BNV A;  3X1T B;  3AV2 A;  1KX4 B;  1P3M D;  5GXQ A;  5B1L B;  3AZG A;  4X23 B;  1P3P B;  4WU8 C;  5FUG A;  3UT9 B;  3AZM C; 
#chains in the Genus database with same CATH topology
 3MGQ D;  3VH6 W;  4H9O B;  1BH9 B;  1TZY D;  4ZUX B;  1P3O D;  4R8P B;  3MNN A;  2YFV A;  5GSU C;  5B2I D;  5B0Z D;  3MGQ C;  2XD1 A;  1F66 C;  3KUY A;  3AN2 A;  1T3U A;  4KUD B;  1TZY C;  2J8P A;  2LY8 A;  5CPJ B;  5AV6 B;  5B0Z C;  4H9S A;  3WTP D;  5JRG D;  3X1U C;  3H0M C;  5B31 D;  3REL A;  3LZ0 D;  4LD9 C;  5B24 C;  1U35 C;  3AZF A;  5JRG C;  3AYW C;  1EQZ B;  3LZ0 C;  1M1A B;  3AZK A;  4NE3 A;  4KGC D;  3B0C W;  5DNM C;  3B6F D;  5BNX A;  2ZM5 A;  4J8V B;  4Z5T A;  3X1S B;  1M19 D;  3UTA C;  4KGC C;  2PYO C;  3AZH C;  5DNN A;  1P34 B;  3H0L C;  3X1T D;  2CV5 D;  1KX4 D;  5AV9 C;  3AZI C;  3KWQ C;  1P3F B;  2F8N H;  5B1M C;  3VH5 T;  2CV5 C;  4X23 D;  1P3P D;  2Y2J A;  3LJA A;  2NQB B;  3UT9 D;  3A6N B;  2Y2I A;  3B6G B;  3KXB B;  3C1C B;  2JSS A;  3WAA C;  4ZUX D;  3UT9 C;  4R8P D;  1P3G A;  1HTA A;  3AV1 C;  4Z2M G;  4H9Q B;  3REJ D;  3W96 D;  5AY8 D;  1ZLA C;  5B2J A;  4KUD D;  4CSR B;  4J8W B;  5CPJ D;  5AV6 D;  3AZE B;  5C3I C;  1P3A B;  5CPI D;  3REJ C;  2F2A C;  2IO5 C;  3W96 C;  5AY8 C;  5B32 G;  2HIO A;  5BS7 A;  5B32 C;  5KDM B;  3AZJ B;  3WKJ C;  3AZN B;  5AVC A;  2BYM B;  5CPI C;  4J8X B;  3W98 B;  1P3A A;  1EQZ D;  3MGR B;  4DQY B;  1M1A D;  1AOI C;  1S32 B;  3WA9 C;  3MGP C;  2RVQ C;  5CP6 B;  3NQU A;  4XUJ A;  3W97 C;  3LZ1 D;  3AFA B;  3LEL A;  5G49 A;  5CPK B;  5E5A C;  1P34 D;  3EG5 B;  4UPK A;  3LZ1 C;  1ID3 B;  3REK B;  5CP6 A;  3REH D;  1P3I C;  3AL0 C;  3MVD B;  2ARO D;  3TU4 B;  4G91 C;  4XZQ A;  1M18 A;  1P3F D;  3REH C;  4YS3 B;  2ARO C;  2NQB D;  2YFW A;  5AV8 A;  1A7W A;  4NE6 A;  3B0C T;  4YM6 A;  5F99 C;  4Z66 C;  3A6N D;  4JJN B;  3KXB D;  3C1C D;  3B6G D;  4QLC C;  2ZY2 A;  5B33 A;  4M6B A;  5GT0 A;  1HQ3 A;  5B0Y C;  5AVB B;  1JFI A;  1KX5 B;  3UTB C;  4J8W D;  4HGA B;  5B40 C;  3AZE D;  3W99 B;  4J8U B;  3R45 A;  3AZJ D;  3AZN D;  2NZD C;  4E44 A;  3W98 D;  3O62 D;  3MGR D;  1KX3 B;  1S32 D;  4WU8 A;  2F8N G;  3AZM A;  1P3B C;  3A1K A;  3O62 C;  3AV2 B;  3AFA D;  1P3L D;  5CPK D;  4AWL C;  2BG1 A;  5GXQ B;  5GSU A;  3C1B C;  3MGQ A;  3AZG B;  1F66 A;  1ID3 D;  3REK D;  1P3L C;  3REI C;  3MVD D;  3AZL C;  5FUG B;  3TU4 D;  2FJ7 C;  5GT3 D;  3X1U A;  4CAY A;  4YS3 D;  4ZBJ C;  3MNN B;  2YFV B;  5B24 A;  1P3M C;  4LD9 A;  2Y2P A;  3VH6 A;  1U35 A;  5GT3 C;  4JJN D;  1N1J A;  5BT1 D;  3KUY B;  3AYW A;  3AN2 B;  4WJ3 C;  1P3K B;  4NE5 A;  4UUZ A;  5DNM A;  3REL B;  3UTA A;  1KX5 D;  3MGS D;  2HUE B;  3AZH A;  1P3O C;  2PYO A;  3AZF B;  3W99 D;  5B2I C;  1P3K A;  4WNN A;  4J8U D;  3AZK B;  1WWI A;  3MGS C;  3X1V D;  4DRB A;  5AV9 A;  3AZI A;  5BNX B;  3WTP C;  4Z5T B;  3KWQ A;  5CHL B;  5B31 G;  5B1M A;  5B31 C;  3X1V C;  2CV5 A;  1KX3 D;  5DNN B;  3V9R A;  4WU9 D;  3AV2 D;  3WAA A;  3AV1 A;  3AZG D;  3B6F C;  4WU9 C;  1B6W A;  4DRA A;  3EPK A;  1M19 C;  4WV4 B;  3LJA B;  1ZLA A;  5JA4 A;  4H9P A;  3NQJ A;  1TAF A;  5B1L D;  3X1T C;  2Y2Q A;  3B0D B;  1KX4 C;  5B32 A;  3MNN D;  3WKJ A;  1P3G B;  5CPI A;  5B1L C;  3KUY D;  3AN2 D;  5B2J B;  4X23 C;  1AOI A;  1P3P C;  3WA9 A;  3MGP A;  3REL D;  3W97 A;  2HIO B;  5E5A A;  4ZUX C;  4R8P C;  5AVC B;  3WTP E;  3REL C;  3LZ1 A;  3AZK D;  1P3I A;  4KUD C;  2Y2G A;  4EO5 B;  5AV6 C;  5CPJ C;  3NQU B;  4XUJ B;  3LEL B;  3REH A;  3EPH A;  5G49 B;  3VH6 T;  2ARO A;  1F1E A;  5DNN D;  5F99 A;  4Z66 A;  4J8V D;  4QLC A;  3X1S D;  1EQZ C;  1M1A C;  4XZQ B;  3F6T A;  2XD5 A;  2Y2H A;  5B0Y A;  1M18 B;  4J8V C;  3X1S C;  5AV5 B;  3LJA D;  2UWX A;  3UTB A;  2YFW B;  2G5I C;  5AV8 B;  5B40 A;  4YM6 B;  1P34 C;  5B33 B;  5GT0 B;  1HQ3 B;  5AV5 A;  1P3G D;  2NZD A;  1JFI B;  1Z2C B;  2JCH A;  4G92 B;  1P3F C;  5B2J D;  1P3G C;  2NQB C;  3H0R C;  3EPJ A;  1R4V A;  3A6N C;  3FDD A;  1P3B A;  3B6G C;  2F8N A;  3KXB C;  5BO0 A;  3C1C C;  2HIO D;  3A1I A;  3R45 B;  4WZS B;  3C1B A;  1P3A D;  1P3L A;  3REI A;  4WU8 B;  3AZL A;  4J8W C;  3AZE C;  2FJ7 A;  2BYK A;  3AZM B;  1P3A C;  4NFT A;  4XUJ D;  4J8X D;  2CWE A;  3LEL D;  5GSU B;  3AZJ C;  1P3M A;  2W8S A;  1B67 A;  3MGQ B;  3AZN C;  5GT3 A;  1F66 B;  4J8X C;  3W98 C;  5CP6 D;  3MGR C;  1S32 C;  2FFF B;  4XZQ D;  1M18 D;  3X1U B;  3EPL A;  5CP6 C;  4CAY B;  1BH8 A;  3AFA C;  4LD9 B;  5B24 B;  5CPK C;  3B0B A;  1TZY A;  5AV8 D;  1P3O A;  4YM6 D;  1U35 B;  5B2I A;  5JRG B;  1N1J B;  5B0Z A;  3AYW B;  5B33 D;  1ID3 C;  3REK C;  3MGS A;  5GT0 D;  1HQ3 D;  3MVD C;  4UUZ B;  5DNM B;  3TU4 C;  3WTP A;  3UTA B;  5JRG A;  5B31 A;  3X1V A;  2Y2K A;  1ULY A;  4YS3 C;  3LZ0 A;  3AZH B;  2PYO B;  4H9N A;  4WNN B;  4JJN C;  4KHA A;  5BT1 C;  5AVB D;  1W2E A;  5AV9 B;  3AZI B;  4KGC A;  3KWQ B;  3B6F A;  4WU9 A;  5B1M B;  5AVB C;  2CV5 B;  1M19 A;  4H9R A;  4WU8 D;  1KX5 C;  3V9R B;  4HGA C;  1H3O A;  3AZM D;  3W99 C;  1PZR A;  3WAA B;  4J8U C;  3X1T A;  1KX4 A;  5GSU D;  3AV1 B;  2DF4 C;  1F66 D;  5B1L A;  1ZLA B;  1KX3 C;  4X23 A;  5JA4 B;  1P3P A;  4H9P B;  5C3I B;  3UT9 A;  2Y2L A;  3NQJ B;  5GXQ D;  1TAF B;  3X1U D;  3REJ B;  2IO5 B;  3W96 B;  5AY8 B;  4H9O A;  1BH9 A;  3AV2 C;  4E45 A;  5B32 B;  5B24 D;  3WKJ B;  4LD9 D;  4ZUX A;  4R8P A;  1U35 D;  5GXQ C;  5CPI B;  3AYW D;  3AZG C;  3REJ A;  1AOI B;  3W96 A;  2F8N K;  5AY8 A;  3MGP B;  3WA9 B;  4KUD A;  2RIQ A;  5DNM D;  3P5J B;  5CPJ A;  5AV6 A;  3W97 B;  3UTA D;  5E5A B;  3AZH D;  2PYO D;  3MNN C;  1WWS A;  1P3K D;  3LZ1 B;  2ZY3 A;  3KUY C;  1P3I B;  3AN2 C;  1EQZ A;  1M1A A;  5AV9 D;  4G91 B;  3AZI D;  1P3K C;  4H9S C;  3KWQ D;  3AZF D;  4J8V A;  3REH B;  5B1M D;  3X1S A;  2ARO B;  2ZY4 A;  1Q9C A;  2HUE C;  3AZF C;  5F99 B;  4Z66 B;  1P34 A;  4Z5T D;  4QLC B;  3WAA D;  3AZK C;  5B0Y B;  3IP4 C;  3AV1 D;  4Z5T C;  1P3F A;  1BFM A;  1ZLA D;  3UTB B;  5B40 B;  5DNN C;  2NQB A;  3A6N A;  3B6G A;  3KXB A;  3C1C A;  5B32 D;  3WKJ D;  2NZD B;  2L5A A;  2ZY5 A;  4H9Q A;  1AOI D;  3LJA C;  3MGP D;  3WA9 D;  2RVQ D;  4CSR A;  4J8W A;  3AZE A;  1P3B B;  2F8N B;  3O62 B;  5BO0 B;  3W97 D;  2VQR A;  1KU5 A;  3KSY A;  3B0D C;  5E5A D;  4AWL B;  5KDM A;  3AZJ A;  3C1B B;  3AZN A;  2BYM A;  4J8X A;  1P3L B;  1P3I D;  3W98 A;  3O62 A;  3MGR A;  3REI B;  5B2J C;  3AZL B;  1S32 A;  2FJ7 B;  2BYK B;  5AVC D;  2Y2M A;  2HIO C;  5BS7 C;  3AFA A;  4ZBJ B;  5CPK A;  1P3M B;  5F99 D;  5GT3 B;  5AVC C;  4Z66 D;  4QLC D;  1ID3 A;  3REK A;  3KFU G;  3MVD A;  5B0Y D;  3TU4 A;  4EO5 C;  4XUJ C;  2JE5 A;  1BH8 B;  3LEL C;  3UTB D;  1TZY B;  4YS3 A;  1P3O B;  5B40 D;  5B2I B;  5B0Z B;  4JJN A;  2DQN C;  3MGS B;  5AV5 D;  2NZD D;  4XZQ C;  3WTP B;  1M18 C;  5AVB A;  5B31 B;  3X1V B;  5AV5 C;  3LZ0 B;  1KX5 A;  3VH5 A;  5AV8 C;  4H9N B;  4YM6 C;  1P3B D;  3W99 A;  2F8N D;  4KHA B;  3VH5 W;  4J8U A;  5B33 C;  4Z2M H;  4KGC B;  5BNV B;  1HQ3 C;  5GT0 C;  3C1B D;  2Y2N A;  3B6F B;  4WU9 B;  1M19 B;  4G92 C;  3REI D;  4H9R B;  3AZL D;  1KX3 A;  1H3O B;  2FJ7 D;  5BNV A;  3X1T B;  2G5H C;  3AV2 A;  1KX4 B;  1P3M D;  2Y2O A;  5GXQ A;  5B1L B;  3AZG A;  4X23 B;  1P3P B;  4WU8 C;  5FUG A;  3UT9 B;  3AZM C; 
#chains in the Genus database with same CATH homology
 3MGQ D;  3VH6 W;  4H9O B;  1BH9 B;  1TZY D;  4ZUX B;  1P3O D;  4R8P B;  3MNN A;  2YFV A;  5GSU C;  5B2I D;  5B0Z D;  3MGQ C;  2XD1 A;  1F66 C;  3KUY A;  3AN2 A;  1T3U A;  4KUD B;  1TZY C;  2J8P A;  2LY8 A;  5CPJ B;  5AV6 B;  5B0Z C;  4H9S A;  3WTP D;  5JRG D;  3X1U C;  3H0M C;  5B31 D;  3REL A;  3LZ0 D;  4LD9 C;  5B24 C;  1U35 C;  3AZF A;  5JRG C;  3AYW C;  1EQZ B;  3LZ0 C;  1M1A B;  3AZK A;  4NE3 A;  4KGC D;  3B0C W;  5DNM C;  3B6F D;  5BNX A;  2ZM5 A;  4J8V B;  4Z5T A;  3X1S B;  1M19 D;  3UTA C;  4KGC C;  2PYO C;  3AZH C;  5DNN A;  1P34 B;  3H0L C;  3X1T D;  2CV5 D;  1KX4 D;  5AV9 C;  3AZI C;  3KWQ C;  1P3F B;  2F8N H;  5B1M C;  3VH5 T;  2CV5 C;  4X23 D;  1P3P D;  2Y2J A;  3LJA A;  2NQB B;  3UT9 D;  3A6N B;  2Y2I A;  3B6G B;  3KXB B;  3C1C B;  2JSS A;  3WAA C;  4ZUX D;  3UT9 C;  4R8P D;  1P3G A;  1HTA A;  3AV1 C;  4Z2M G;  4H9Q B;  3REJ D;  3W96 D;  5AY8 D;  1ZLA C;  5B2J A;  4KUD D;  4CSR B;  4J8W B;  5CPJ D;  5AV6 D;  3AZE B;  5C3I C;  1P3A B;  5CPI D;  3REJ C;  2F2A C;  2IO5 C;  3W96 C;  5AY8 C;  5B32 G;  2HIO A;  5BS7 A;  5B32 C;  5KDM B;  3AZJ B;  3WKJ C;  3AZN B;  5AVC A;  2BYM B;  5CPI C;  4J8X B;  3W98 B;  1P3A A;  1EQZ D;  3MGR B;  4DQY B;  1M1A D;  1AOI C;  1S32 B;  3WA9 C;  3MGP C;  2RVQ C;  5CP6 B;  3NQU A;  4XUJ A;  3W97 C;  3LZ1 D;  3AFA B;  3LEL A;  5G49 A;  5CPK B;  5E5A C;  1P34 D;  3EG5 B;  4UPK A;  3LZ1 C;  1ID3 B;  3REK B;  5CP6 A;  3REH D;  1P3I C;  3AL0 C;  3MVD B;  2ARO D;  3TU4 B;  4G91 C;  4XZQ A;  1M18 A;  1P3F D;  3REH C;  4YS3 B;  2ARO C;  2NQB D;  2YFW A;  5AV8 A;  1A7W A;  4NE6 A;  3B0C T;  4YM6 A;  5F99 C;  4Z66 C;  3A6N D;  4JJN B;  3KXB D;  3C1C D;  3B6G D;  4QLC C;  2ZY2 A;  5B33 A;  4M6B A;  5GT0 A;  1HQ3 A;  5B0Y C;  5AVB B;  1JFI A;  1KX5 B;  3UTB C;  4J8W D;  4HGA B;  5B40 C;  3AZE D;  3W99 B;  4J8U B;  3R45 A;  3AZJ D;  3AZN D;  2NZD C;  4E44 A;  3W98 D;  3O62 D;  3MGR D;  1KX3 B;  1S32 D;  4WU8 A;  2F8N G;  3AZM A;  1P3B C;  3A1K A;  3O62 C;  3AV2 B;  3AFA D;  1P3L D;  5CPK D;  4AWL C;  2BG1 A;  5GXQ B;  5GSU A;  3C1B C;  3MGQ A;  3AZG B;  1F66 A;  1ID3 D;  3REK D;  1P3L C;  3REI C;  3MVD D;  3AZL C;  5FUG B;  3TU4 D;  2FJ7 C;  5GT3 D;  3X1U A;  4CAY A;  4YS3 D;  4ZBJ C;  3MNN B;  2YFV B;  5B24 A;  1P3M C;  4LD9 A;  2Y2P A;  3VH6 A;  1U35 A;  5GT3 C;  4JJN D;  1N1J A;  5BT1 D;  3KUY B;  3AYW A;  3AN2 B;  4WJ3 C;  1P3K B;  4NE5 A;  4UUZ A;  5DNM A;  3REL B;  3UTA A;  1KX5 D;  3MGS D;  2HUE B;  3AZH A;  1P3O C;  2PYO A;  3AZF B;  3W99 D;  5B2I C;  1P3K A;  4WNN A;  4J8U D;  3AZK B;  1WWI A;  3MGS C;  3X1V D;  4DRB A;  5AV9 A;  3AZI A;  5BNX B;  3WTP C;  4Z5T B;  3KWQ A;  5CHL B;  5B31 G;  5B1M A;  5B31 C;  3X1V C;  2CV5 A;  1KX3 D;  5DNN B;  3V9R A;  4WU9 D;  3AV2 D;  3WAA A;  3AV1 A;  3AZG D;  3B6F C;  4WU9 C;  1B6W A;  4DRA A;  3EPK A;  1M19 C;  4WV4 B;  3LJA B;  1ZLA A;  5JA4 A;  4H9P A;  3NQJ A;  1TAF A;  5B1L D;  3X1T C;  2Y2Q A;  3B0D B;  1KX4 C;  5B32 A;  3MNN D;  3WKJ A;  1P3G B;  5CPI A;  5B1L C;  3KUY D;  3AN2 D;  5B2J B;  4X23 C;  1AOI A;  1P3P C;  3WA9 A;  3MGP A;  3REL D;  3W97 A;  2HIO B;  5E5A A;  4ZUX C;  4R8P C;  5AVC B;  3WTP E;  3REL C;  3LZ1 A;  3AZK D;  1P3I A;  4KUD C;  2Y2G A;  4EO5 B;  5AV6 C;  5CPJ C;  3NQU B;  4XUJ B;  3LEL B;  3REH A;  3EPH A;  5G49 B;  3VH6 T;  2ARO A;  1F1E A;  5DNN D;  5F99 A;  4Z66 A;  4J8V D;  4QLC A;  3X1S D;  1EQZ C;  1M1A C;  4XZQ B;  3F6T A;  2XD5 A;  2Y2H A;  5B0Y A;  1M18 B;  4J8V C;  3X1S C;  5AV5 B;  3LJA D;  2UWX A;  3UTB A;  2YFW B;  2G5I C;  5AV8 B;  5B40 A;  4YM6 B;  1P34 C;  5B33 B;  5GT0 B;  1HQ3 B;  5AV5 A;  1P3G D;  2NZD A;  1JFI B;  1Z2C B;  2JCH A;  4G92 B;  1P3F C;  5B2J D;  1P3G C;  2NQB C;  3H0R C;  3EPJ A;  1R4V A;  3A6N C;  3FDD A;  1P3B A;  3B6G C;  2F8N A;  3KXB C;  5BO0 A;  3C1C C;  2HIO D;  3A1I A;  3R45 B;  4WZS B;  3C1B A;  1P3A D;  1P3L A;  3REI A;  4WU8 B;  3AZL A;  4J8W C;  3AZE C;  2FJ7 A;  2BYK A;  3AZM B;  1P3A C;  4NFT A;  4XUJ D;  4J8X D;  2CWE A;  3LEL D;  5GSU B;  3AZJ C;  1P3M A;  2W8S A;  1B67 A;  3MGQ B;  3AZN C;  5GT3 A;  1F66 B;  4J8X C;  3W98 C;  5CP6 D;  3MGR C;  1S32 C;  2FFF B;  4XZQ D;  1M18 D;  3X1U B;  3EPL A;  5CP6 C;  4CAY B;  1BH8 A;  3AFA C;  4LD9 B;  5B24 B;  5CPK C;  3B0B A;  1TZY A;  5AV8 D;  1P3O A;  4YM6 D;  1U35 B;  5B2I A;  5JRG B;  1N1J B;  5B0Z A;  3AYW B;  5B33 D;  1ID3 C;  3REK C;  3MGS A;  5GT0 D;  1HQ3 D;  3MVD C;  4UUZ B;  5DNM B;  3TU4 C;  3WTP A;  3UTA B;  5JRG A;  5B31 A;  3X1V A;  2Y2K A;  1ULY A;  4YS3 C;  3LZ0 A;  3AZH B;  2PYO B;  4H9N A;  4WNN B;  4JJN C;  4KHA A;  5BT1 C;  5AVB D;  1W2E A;  5AV9 B;  3AZI B;  4KGC A;  3KWQ B;  3B6F A;  4WU9 A;  5B1M B;  5AVB C;  2CV5 B;  1M19 A;  4H9R A;  4WU8 D;  1KX5 C;  3V9R B;  4HGA C;  1H3O A;  3AZM D;  3W99 C;  1PZR A;  3WAA B;  4J8U C;  3X1T A;  1KX4 A;  5GSU D;  3AV1 B;  2DF4 C;  1F66 D;  5B1L A;  1ZLA B;  1KX3 C;  4X23 A;  5JA4 B;  1P3P A;  4H9P B;  5C3I B;  3UT9 A;  2Y2L A;  3NQJ B;  5GXQ D;  1TAF B;  3X1U D;  3REJ B;  2IO5 B;  3W96 B;  5AY8 B;  4H9O A;  1BH9 A;  3AV2 C;  4E45 A;  5B32 B;  5B24 D;  3WKJ B;  4LD9 D;  4ZUX A;  4R8P A;  1U35 D;  5GXQ C;  5CPI B;  3AYW D;  3AZG C;  3REJ A;  1AOI B;  3W96 A;  2F8N K;  5AY8 A;  3MGP B;  3WA9 B;  4KUD A;  2RIQ A;  5DNM D;  3P5J B;  5CPJ A;  5AV6 A;  3W97 B;  3UTA D;  5E5A B;  3AZH D;  2PYO D;  3MNN C;  1WWS A;  1P3K D;  3LZ1 B;  2ZY3 A;  3KUY C;  1P3I B;  3AN2 C;  1EQZ A;  1M1A A;  5AV9 D;  4G91 B;  3AZI D;  1P3K C;  4H9S C;  3KWQ D;  3AZF D;  4J8V A;  3REH B;  5B1M D;  3X1S A;  2ARO B;  2ZY4 A;  1Q9C A;  2HUE C;  3AZF C;  5F99 B;  4Z66 B;  1P34 A;  4Z5T D;  4QLC B;  3WAA D;  3AZK C;  5B0Y B;  3IP4 C;  3AV1 D;  4Z5T C;  1P3F A;  1BFM A;  1ZLA D;  3UTB B;  5B40 B;  5DNN C;  2NQB A;  3A6N A;  3B6G A;  3KXB A;  3C1C A;  5B32 D;  3WKJ D;  2NZD B;  2L5A A;  2ZY5 A;  4H9Q A;  1AOI D;  3LJA C;  3MGP D;  3WA9 D;  2RVQ D;  4CSR A;  4J8W A;  3AZE A;  1P3B B;  2F8N B;  3O62 B;  5BO0 B;  3W97 D;  2VQR A;  1KU5 A;  3KSY A;  3B0D C;  5E5A D;  4AWL B;  5KDM A;  3AZJ A;  3C1B B;  3AZN A;  2BYM A;  4J8X A;  1P3L B;  1P3I D;  3W98 A;  3O62 A;  3MGR A;  3REI B;  5B2J C;  3AZL B;  1S32 A;  2FJ7 B;  2BYK B;  5AVC D;  2Y2M A;  2HIO C;  5BS7 C;  3AFA A;  4ZBJ B;  5CPK A;  1P3M B;  5F99 D;  5GT3 B;  5AVC C;  4Z66 D;  4QLC D;  1ID3 A;  3REK A;  3KFU G;  3MVD A;  5B0Y D;  3TU4 A;  4EO5 C;  4XUJ C;  2JE5 A;  1BH8 B;  3LEL C;  3UTB D;  1TZY B;  4YS3 A;  1P3O B;  5B40 D;  5B2I B;  5B0Z B;  4JJN A;  2DQN C;  3MGS B;  5AV5 D;  2NZD D;  4XZQ C;  3WTP B;  1M18 C;  5AVB A;  5B31 B;  3X1V B;  5AV5 C;  3LZ0 B;  1KX5 A;  3VH5 A;  5AV8 C;  4H9N B;  4YM6 C;  1P3B D;  3W99 A;  2F8N D;  4KHA B;  3VH5 W;  4J8U A;  5B33 C;  4Z2M H;  4KGC B;  5BNV B;  1HQ3 C;  5GT0 C;  3C1B D;  2Y2N A;  3B6F B;  4WU9 B;  1M19 B;  4G92 C;  3REI D;  4H9R B;  3AZL D;  1KX3 A;  1H3O B;  2FJ7 D;  5BNV A;  3X1T B;  2G5H C;  3AV2 A;  1KX4 B;  1P3M D;  2Y2O A;  5GXQ A;  5B1L B;  3AZG A;  4X23 B;  1P3P B;  4WU8 C;  5FUG A;  3UT9 B;  3AZM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...