3X1TA

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tA00
5GSUA 1ULYA 5AV5B 3MGSB 4HGAC 1KX5A 5B32D 2F8NK 2RVQC 4LD9C 4KHAB 1P3FC 1P3LC 1P3BA 3B0DB 3REIA 1P3MD 4R8PD 4YS3A 5B1MA 5KDMA 3AV1B 2AROA 3AFAA 4KUDB 4H9PA 1KX4A 3AZMC 1TZYD 3WTPE 1P34D 3AZGB 1KX3B 1ZLAA 5G49B 3VH6A 4QLCA 4Z2MG 4JJNA 3REHD 5JRGA 3X1UA 1P3GC 4H9NB 5BT1D 3AN2C 1P3IB 2NZDA 5BNXA 5AV5C 1S32C 2NQBA 4Z66C 4X23A 1KX5D 1H3OA 3B0CW 3LZ1B 2CV5A 1P3BD 3REID 5B2JA 3B0DC 5B0YB 5B24B 4YS3D 5B1MD 2AROD 3AFAD 3X1TB 3REKB 3AV1C 2FJ7D 4AWLC 4KUDC 1P3KC 5B2IB 3W99B 4LD9A 1P3FA 1P3LA 5GXQA 1P3MB 4QLCD 1ZLAD 3AZNB 3WKJB 5JRGD 1Q9CA 2IO5B 5F99B 3C1BB 1BH9B 5CPIA 3KXBB 2NZDD 3AZMA 1P3IC 4X23D 2CV5D 4H9RA 3AZLB 3LZ1C 4KGCB 4XUJB 1BH8B 5B2JD 1P3GB 5B40B 5GSUB 5B24C 3B0BA 1P3GA 3O62D 5AV5A 1S32A 3REKC 4Z5TC 4Z66A 3C1CC 4ZBJB 2RVQD 5B2IC 4LD9D 1P3FD 1P3LD 5GXQD 3W99C 4KHAA 3AZNC 3MVDD 3WKJC 3MNNB 3AV1A 5CPID 2IO5C 5F99C 4KUDA 2LY8A 1KX4B 1P3KA 3AZMD 3KXBC 3NQUB 3AYWC 5GT0C 5G49A 4JJNB 3AZLC 4KGCC 4XUJC 3X1UB 5B40C 1P3GD 4H9NA 5BNXB 5CHLB 2BYMB 5AV5D 5AV6B 1P3IA 2NQBB 3MGSD 5B1LC 4ZBJC 3WTPB 3LZ1A 4ZUXB 5AV8C 5B24A 5CP6B 3AV1D 4KUDD 3MNNC 3REKA 4Z5TA 3C1CA 4LD9B 5B2IA 1KX3D 3AZGD 3KUYB 3W99A 4DRAA 3AZNA 2HUEB 3WKJA 3X1VC 5F99A 1P3PB 4G92C 3C1BA 1P3ID 3KXBA 5AV6C 4G91B 3MGPB 4YM6B 1M1AB 3TU4C 3AYWA 5GT0A 3LZ1D 3REJB 3AZLA 4KGCA 4XUJA 4ZUXC 3W98B 1HTAA 1WWSA 5B24D 5B40A 3AN2B 5CP6C 1S32B 3X1TD 3B6FB 3REKD 4Z66B 4H9QB 5B1LA 5B2ID 3WAAB 3W99D 5AV8A 2CWEA 3KUYC 4M6BA 3AZND 5B33B 5B31G 4CSRB 3WKJD 2HUEC 5BS7C 4AWLB 5F99D 3C1BD 3MNNA 1P3PC 1P3KB 1JFIB 3KXBD 1R4VA 1U35B 4Z2MH 4G91C 3MGPC 4YM6C 5CPKC 3MGRC 1M1AC 3NQUA 4WNNB 3AZLD 3KWQC 2BYKB 3REJC 4KGCD 4XUJD 4J8UC 3RELB 3W98C 5B40D 5GSUD 2YFWA 5AV6A 3A6NB 1A7WA 2BYMA 3AV2B 3B6FC 1EQZB 4UUZB 3AZKC 3WTPA 1P3OB 3WAAC 4CAYB 4ZUXA 3LELC 5B33C 3AZJC 1HQ3B 5CP6A 4Z5TB 3MNND 3C1CB 3AZIC 5AV9B 1KX4D 1AOIB 3KSYA 2PYOB 1U35C 3KUYA 2F8NA 4H9OB 4JJND 4J8XC 3X1UD 5BS7A 3RELC 3B6GB 1P3PA 4NE5A 5AV6D 2NQBD 5B32G 3A6NC 3MGPA 5GT0B 3UTAB 4YM6A 3AYWB 3AV2C 3MGRA 5CPJB 5CPKA 1M1AA 1EQZC 3WTPD 3KWQA 3REJA 4ZUXD 1P3OC 3W97B 3W98A 3W96B 3UT9B 1HQ3C 5CP6D 4E44A 3AN2A 3B6FA 5B1LB 5DNNB 4H9QA 5AV9C 5AV8B 1AOIC 1F66B 3WAAA 3KUYD 2F8ND 2PYOC 5AY8C 4WU9B 3LELA 5B33A 3AZJA 4CSRA 3X1SB 1P3PD 3B6GC 1JFIA 3AZHB 3MGQC 3MGPD 4YM6D 1U35A 5CPJC 1M1AD 3UTAC 3REJD 4WNNA 2BYKA 1N1JB 4WU8B 1TAFB 4J8XA 3X1VB 3W98D 4G92B 3W97C 3RELA 2YFWB 3W96C 3UT9C 3AN2D 5B0ZB 1S32D 3B6FD 4Z66D 3A6NA 3TU4B 3AV2A 5C3IB 3VH5T 4R8PC 4UUZA 3LJAB 1EQZA 5DNNC 3WAAD 1P3OA 1F66C 4CAYA 5AVCB 2F8NH 4J8WB 5B33D 4E45A 3AZJD 4WU9C 2HIOB 1KU5A 1HQ3A 1TZYC 3X1SC 1P3KD 5AV9A 1AOIA 3AZHC 1U35D 2F8NB 2PYOA 4H9OA 4WU8C 1M19B 3RELD 5FUGB 3VH5A 3B6GA 4NFTA 5B0ZC 3A6ND 3REIC 3AV2D 5CPKB 1ID3B 5E5AB 3MGRB 5CPJA 3UTAA 3LZ0B 5C3IC 3KWQB 1EQZD 3LJAC 4J8UB 1P3OD 2FJ7C 5AVCC 3W97A 1M18B 4J8WC 3W96A 1HQ3D 2HIOC 3UT9A 2YFVA 4Z5TD 4XZQB 4J8VB 3C1CD 5AV9D 4R8PA 3AZKB 1AOID 5DNNA 3WA9B 1F66A 2PYOD 3LELB 3AZJB 4WU9A 5AVBB 1TZYA 1M19C 3AZIB 3B6GD 3UTBB 3X1SA 5DNMB 3AZFB 5B31B 3AZHA 1BFMA 5CPJD 3AYWD 5GT0D 3UTAD 1ID3C 3VH6T 5E5AC 3LZ0C 4J8XB 3O62C 1N1JA 4WU8A 1TAFA 3W97D 3X1VA 3W96D 3UT9D 4EO5B 3AZEB 1M18C 5GXQC 5B0ZA 1B67A 3R45B 4XZQC 5GT3B 5B1LD 4J8VC 3TU4A 3MVDC 5DNND 1P3AB 5AV8D 3LJAA 1F66D 4H9SC 3WA9C 1WWIA 1B6WA 5CPIC 5AVCA 4WU9D 2FJ7A 4J8WA 2HIOA 5AVBC 3X1SD 3UTBC 5DNMC 3AZHD 3AZFC 5B31C 5AY8B 1F1EA 2JSSA 5BO0A 4WU8D 3X1VD 3VH5W 1M19A 3MGSC 3NQJB 3V9RA 5FUGA 3MGQB 4EO5C 3AZEC 5B0ZD 3TU4D 1ID3A 5E5AA 5GT3C 3LZ0A 3LJAD 1P3AC 3O62A 4J8UA 5AVCD 4J8WD 5B32B 2HIOD 1M18A 5BNVB 1KX3C 2YFVB 3AZGC 4XZQA 5JA4A 4R8PB 4J8VA 3MVDA 3AZKA 4H9SA 3WA9A 1TZYB 1P34B 5AVBA 1M19D 3AZIA 3REHB 3UTBA 5DNMA 3AZFA 5B31A 5CPKD 1ID3D 5E5AD 3MGRD 5B0YC 4NE3A 3LZ0D 3KWQD 4J8UD 4NE6A 3X1TC 1KX5B 3MGSA 1M18D 5B32C 3AZEA 1P3BB 3REIB 4XZQD 4J8VD 1P3MC 3R45A 4YS3B 5B1MB 5KDMB 5GT3A 3AZKD 3B0CT 2AROB 3AFAB 1P3AA 3WA9D 4H9PB 2FJ7B 3LELD 3C1BC 5AVBD 3VH6W 1P34C 1KX3A 3AZGA 4QLCB 1ZLAB 3AZID 3UTBD 5DNMD 3REHC 5JRGB 3AZFD 5B31D 5AY8A 5GSUC 5BO0B 5BT1C 4J8XD 4WV4B 2NZDB 4WZSB 4X23B 1H3OB 2CV5B 3V9RB 1KX5C 3NQJA 3AZED 3MGQA 1P3BC 5B2JB 5GT3D 5B0YA 4YS3C 5B1MC 2F8NG 3O62B 1P3AD 2AROC 3AFAC 3X1TA 4HGAB 5B32A 1KX4C 1P3FB 1P3LB 5GXQB 2L5AA 5BNVA 5JA4B 4QLCC 1P3MA 1ZLAC 3MVDB 4JJNC 5JRGC 3X1UC 5AY8D 5CPIB 1BH9A 3AZMB 2NZDC 1P34A 2NQBC 4H9RB 4X23C 2CV5C 3WTPC 3MGQD 3REHA 1BH8A 5B2JC 5B0YD 4DRBA
chains in the Genus database with same CATH superfamily
5GSUA 1ULYA 4UPKA 5AV5B 3MGSB 4HGAC 1KX5A 5B32D 2F8NK 2RVQC 4LD9C 4KHAB 1P3FC 1P3LC 1P3BA 3B0DB 3REIA 1P3MD 4R8PD 4YS3A 2ZY4A 5B1MA 5KDMA 3AV1B 2AROA 3AFAA 4KUDB 4H9PA 3P5JB 1KX4A 3AZMC 1TZYD 3WTPE 1P34D 3AZGB 1KX3B 1ZLAA 5G49B 3VH6A 4QLCA 4Z2MG 4JJNA 3REHD 5JRGA 3X1UA 1P3GC 4H9NB 5BT1D 3AN2C 3A1IA 1P3IB 2NZDA 5BNXA 5AV5C 1S32C 2NQBA 3EPLA 4Z66C 4X23A 1KX5D 1H3OA 3B0CW 3LZ1B 2CV5A 1P3BD 3REID 5B2JA 3AL0C 3B0DC 5B0YB 5B24B 4YS3D 5B1MD 2AROD 3AFAD 3X1TB 3REKB 3AV1C 2FJ7D 4AWLC 4KUDC 1P3KC 5B2IB 3A1KA 3W99B 4LD9A 2BG1A 1P3FA 1P3LA 5GXQA 1P3MB 4QLCD 1ZLAD 3AZNB 3WKJB 5JRGD 1Q9CA 2IO5B 5F99B 3C1BB 1BH9B 5CPIA 3IP4C 3KXBB 2NZDD 3AZMA 1P3IC 4X23D 2CV5D 4H9RA 3AZLB 3LZ1C 4KGCB 4XUJB 2XD5A 1BH8B 2Y2JA 5B2JD 1P3GB 5B40B 5GSUB 5B24C 3B0BA 1P3GA 3O62D 4DQYB 5AV5A 2JE5A 2Y2NA 3EPJA 3REKC 1S32A 4Z5TC 4Z66A 3C1CC 4ZBJB 2RVQD 5B2IC 4LD9D 1P3FD 1P3LD 5GXQD 3W99C 4KHAA 1T3UA 3AZNC 3MVDD 3WKJC 2FFFB 3MNNB 3AV1A 5CPID 2IO5C 5F99C 4KUDA 2LY8A 2JCHA 1KX4B 1P3KA 3AZMD 3KXBC 3NQUB 3AYWC 5GT0C 2UWXA 5G49A 4JJNB 3AZLC 4KGCC 4XUJC 3X1UB 5B40C 1P3GD 1Z2CB 4H9NA 5BNXB 5CHLB 2BYMB 5AV5D 5AV6B 1P3IA 2NQBB 3MGSD 5B1LC 4ZBJC 3WTPB 3LZ1A 4ZUXB 5AV8C 5B24A 5CP6B 3AV1D 4KUDD 3MNNC 3REKA 4Z5TA 3C1CA 4LD9B 5B2IA 1KX3D 3AZGD 3KUYB 3W99A 4DRAA 3AZNA 1PZRA 2HUEB 3WKJA 3X1VC 5F99A 1P3PB 4G92C 3C1BA 2ZM5A 1P3ID 2DQNC 3KXBA 5AV6C 4G91B 3MGPB 4YM6B 1M1AB 3TU4C 3AYWA 5GT0A 3LZ1D 3REJB 3AZLA 4KGCA 4XUJA 4ZUXC 2F2AC 3W98B 1HTAA 1WWSA 5B24D 5B40A 3AN2B 5CP6C 1S32B 3X1TD 3B6FB 3REKD 4Z66B 4H9QB 5B1LA 5B2ID 3WAAB 3W99D 5AV8A 2CWEA 3KUYC 4M6BA 3AZND 5B33B 5B31G 4CSRB 3WKJD 2HUEC 2Y2KA 5BS7C 4AWLB 5F99D 3C1BD 3MNNA 1P3PC 1P3KB 1JFIB 3KXBD 1R4VA 1U35B 4Z2MH 4G91C 3MGPC 4YM6C 2G5HC 5CPKC 3MGRC 1M1AC 3NQUA 4WNNB 3AZLD 3KWQC 2BYKB 3REJC 4KGCD 4XUJD 4J8UC 3RELB 3W98C 5B40D 5GSUD 2YFWA 5AV6A 3A6NB 1A7WA 2BYMA 3AV2B 3B6FC 1EQZB 4UUZB 3AZKC 3WTPA 1P3OB 3WAAC 4CAYB 4ZUXA 3LELC 2Y2OA 5B33C 3AZJC 1HQ3B 5CP6A 4Z5TB 3MNND 3C1CB 3AZIC 5AV9B 1KX4D 1AOIB 3KSYA 2PYOB 2J8PA 3KUYA 1U35C 2F8NA 4H9OB 4JJND 4J8XC 3X1UD 2ZY3A 5BS7A 3RELC 3B6GB 1P3PA 4NE5A 5AV6D 2NQBD 5B32G 3A6NC 3MGPA 5GT0B 3UTAB 4YM6A 3AYWB 3AV2C 3MGRA 5CPJB 5CPKA 1M1AA 1EQZC 3WTPD 3KWQA 3REJA 4ZUXD 1P3OC 3W97B 3W98A 3W96B 3UT9B 1HQ3C 5CP6D 4E44A 3AN2A 3B6FA 2W8SA 5B1LB 5DNNB 4H9QA 5AV9C 2VQRA 5AV8B 1AOIC 1F66B 3WAAA 3KUYD 2F8ND 2PYOC 5AY8C 4WU9B 3LELA 5B33A 3AZJA 4CSRA 3X1SB 1P3PD 3B6GC 1JFIA 3AZHB 3MGQC 3MGPD 2G5IC 4YM6D 1U35A 5CPJC 1M1AD 3UTAC 3REJD 4WNNA 2BYKA 1N1JB 4WU8B 1TAFB 4J8XA 3X1VB 3W98D 4G92B 3W97C 3RELA 2YFWB 3W96C 3UT9C 3AN2D 5B0ZB 1S32D 3B6FD 4Z66D 3A6NA 3TU4B 3AV2A 5C3IB 3VH5T 4R8PC 4UUZA 3LJAB 1EQZA 5DNNC 3WAAD 1P3OA 1F66C 4CAYA 5AVCB 2F8NH 4J8WB 5B33D 4E45A 3AZJD 4WU9C 2HIOB 1KU5A 1HQ3A 1TZYC 2Y2LA 3X1SC 1P3KD 5AV9A 1AOIA 3AZHC 1U35D 2F8NB 2PYOA 4WJ3C 4H9OA 4WU8C 1M19B 3RELD 5FUGB 3VH5A 3B6GA 4NFTA 5B0ZC 3A6ND 3REIC 3AV2D 5CPKB 1ID3B 5E5AB 3MGRB 3F6TA 5CPJA 3UTAA 3LZ0B 5C3IC 3KWQB 1EQZD 3LJAC 4J8UB 1P3OD 2FJ7C 5AVCC 3W97A 1M18B 2Y2GA 4J8WC 3W96A 1HQ3D 2HIOC 3UT9A 2Y2IA 2YFVA 4Z5TD 4XZQB 3C1CD 4J8VB 5AV9D 4R8PA 3AZKB 1AOID 5DNNA 3WA9B 1F66A 2PYOD 3LELB 3AZJB 4WU9A 5AVBB 1TZYA 1M19C 3AZIB 3B6GD 3UTBB 3X1SA 5DNMB 3AZFB 5B31B 3AZHA 1BFMA 5CPJD 3AYWD 5GT0D 3UTAD 1ID3C 3VH6T 5E5AC 3LZ0C 4J8XB 3O62C 1N1JA 4WU8A 1TAFA 3W97D 3X1VA 3W96D 3UT9D 4EO5B 3AZEB 1M18C 5GXQC 5B0ZA 1B67A 3R45B 4XZQC 5GT3B 5B1LD 4J8VC 3TU4A 3MVDC 5DNND 1P3AB 5AV8D 3LJAA 1F66D 4H9SC 3WA9C 1WWIA 1B6WA 5CPIC 5AVCA 4WU9D 2FJ7A 4J8WA 2HIOA 5AVBC 3X1SD 3UTBC 5DNMC 3AZHD 3AZFC 5B31C 5AY8B 1F1EA 2JSSA 5BO0A 3FDDA 4WU8D 1W2EA 3X1VD 3VH5W 1M19A 3MGSC 3NQJB 3V9RA 5FUGA 3MGQB 4EO5C 3AZEC 5B0ZD 3TU4D 2XD1A 1ID3A 5E5AA 5GT3C 3LZ0A 3LJAD 1P3AC 2Y2PA 3O62A 4J8UA 5AVCD 4J8WD 5B32B 2HIOD 1M18A 5BNVB 1KX3C 2YFVB 3AZGC 4XZQA 5JA4A 4R8PB 4J8VA 3MVDA 3EPHA 3AZKA 4H9SA 3WA9A 3EG5B 1TZYB 1P34B 5AVBA 1M19D 3AZIA 3REHB 3UTBA 5DNMA 3AZFA 5B31A 5CPKD 1ID3D 5E5AD 3MGRD 2RIQA 5B0YC 4NE3A 3LZ0D 3KWQD 4J8UD 4NE6A 3X1TC 1KX5B 3MGSA 1M18D 2DF4C 5B32C 3AZEA 1P3BB 3REIB 4XZQD 4J8VD 1P3MC 3R45A 4YS3B 3KFUG 5B1MB 5KDMB 5GT3A 3AZKD 2AROB 3B0CT 3AFAB 1P3AA 3WA9D 4H9PB 2FJ7B 3EPKA 3LELD 3C1BC 5AVBD 3VH6W 1P34C 1KX3A 3AZGA 4QLCB 1ZLAB 3AZID 3UTBD 5DNMD 3REHC 5JRGB 3AZFD 5B31D 5AY8A 5GSUC 5BO0B 2ZY5A 5BT1C 4J8XD 4WV4B 2NZDB 4WZSB 3H0RC 4X23B 1H3OB 2CV5B 3V9RB 1KX5C 3NQJA 3AZED 3MGQA 1P3BC 5B2JB 5GT3D 5B0YA 4YS3C 5B1MC 2F8NG 3O62B 1P3AD 2AROC 3AFAC 3X1TA 4HGAB 3H0MC 5B32A 1KX4C 1P3FB 1P3LB 5GXQB 2L5AA 5BNVA 5JA4B 4QLCC 1P3MA 1ZLAC 3MVDB 4JJNC 2Y2HA 5JRGC 3X1UC 5AY8D 5CPIB 1BH9A 2Y2QA 3AZMB 2NZDC 3H0LC 1P34A 2NQBC 4H9RB 4X23C 2CV5C 2Y2MA 3WTPC 3MGQD 3REHA 2ZY2A 1BH8A 5B2JC 5B0YD 4DRBA
chains in the Genus database with same CATH topology
5GSUA 1ULYA 4UPKA 5AV5B 3MGSB 4HGAC 1KX5A 5B32D 2F8NK 2RVQC 4LD9C 4KHAB 1P3FC 1P3LC 1P3BA 3B0DB 3REIA 1P3MD 4R8PD 4YS3A 2ZY4A 5B1MA 5KDMA 3AV1B 2AROA 3AFAA 4KUDB 4H9PA 3P5JB 1KX4A 3AZMC 1TZYD 3WTPE 1P34D 3AZGB 1KX3B 1ZLAA 5G49B 3VH6A 4QLCA 4Z2MG 4JJNA 3REHD 5JRGA 3X1UA 1P3GC 4H9NB 5BT1D 3AN2C 3A1IA 1P3IB 2NZDA 5BNXA 5AV5C 1S32C 2NQBA 3EPLA 4Z66C 4X23A 1KX5D 1H3OA 3B0CW 3LZ1B 2CV5A 1P3BD 3REID 5B2JA 3AL0C 3B0DC 5B0YB 5B24B 4YS3D 5B1MD 2AROD 3AFAD 3X1TB 3REKB 3AV1C 2FJ7D 4AWLC 4KUDC 1P3KC 5B2IB 3A1KA 3W99B 4LD9A 2BG1A 1P3FA 1P3LA 5GXQA 1P3MB 4QLCD 1ZLAD 3AZNB 3WKJB 5JRGD 1Q9CA 2IO5B 5F99B 3C1BB 1BH9B 5CPIA 3IP4C 3KXBB 2NZDD 3AZMA 1P3IC 4X23D 2CV5D 4H9RA 3AZLB 3LZ1C 4KGCB 4XUJB 2XD5A 1BH8B 2Y2JA 5B2JD 1P3GB 5B40B 5GSUB 5B24C 3B0BA 1P3GA 3O62D 4DQYB 5AV5A 2JE5A 2Y2NA 3EPJA 3REKC 1S32A 4Z5TC 4Z66A 3C1CC 4ZBJB 2RVQD 5B2IC 4LD9D 1P3FD 1P3LD 5GXQD 3W99C 4KHAA 1T3UA 3AZNC 3MVDD 3WKJC 2FFFB 3MNNB 3AV1A 5CPID 2IO5C 5F99C 4KUDA 2LY8A 2JCHA 1KX4B 1P3KA 3AZMD 3KXBC 3NQUB 3AYWC 5GT0C 2UWXA 5G49A 4JJNB 3AZLC 4KGCC 4XUJC 3X1UB 5B40C 1P3GD 1Z2CB 4H9NA 5BNXB 5CHLB 2BYMB 5AV5D 5AV6B 1P3IA 2NQBB 3MGSD 5B1LC 4ZBJC 3WTPB 3LZ1A 4ZUXB 5AV8C 5B24A 5CP6B 3AV1D 4KUDD 3MNNC 3REKA 4Z5TA 3C1CA 4LD9B 5B2IA 1KX3D 3AZGD 3KUYB 3W99A 4DRAA 3AZNA 1PZRA 2HUEB 3WKJA 3X1VC 5F99A 1P3PB 4G92C 3C1BA 2ZM5A 1P3ID 2DQNC 3KXBA 5AV6C 4G91B 3MGPB 4YM6B 1M1AB 3TU4C 3AYWA 5GT0A 3LZ1D 3REJB 3AZLA 4KGCA 4XUJA 4ZUXC 2F2AC 3W98B 1HTAA 1WWSA 5B24D 5B40A 3AN2B 5CP6C 1S32B 3X1TD 3B6FB 3REKD 4Z66B 4H9QB 5B1LA 5B2ID 3WAAB 3W99D 5AV8A 2CWEA 3KUYC 4M6BA 3AZND 5B33B 5B31G 4CSRB 3WKJD 2HUEC 2Y2KA 5BS7C 4AWLB 5F99D 3C1BD 3MNNA 1P3PC 1P3KB 1JFIB 3KXBD 1R4VA 1U35B 4Z2MH 4G91C 3MGPC 4YM6C 2G5HC 5CPKC 3MGRC 1M1AC 3NQUA 4WNNB 3AZLD 3KWQC 2BYKB 3REJC 4KGCD 4XUJD 4J8UC 3RELB 3W98C 5B40D 5GSUD 2YFWA 5AV6A 3A6NB 1A7WA 2BYMA 3AV2B 3B6FC 1EQZB 4UUZB 3AZKC 3WTPA 1P3OB 3WAAC 4CAYB 4ZUXA 3LELC 2Y2OA 5B33C 3AZJC 1HQ3B 5CP6A 4Z5TB 3MNND 3C1CB 3AZIC 5AV9B 1KX4D 1AOIB 3KSYA 2PYOB 2J8PA 3KUYA 1U35C 2F8NA 4H9OB 4JJND 4J8XC 3X1UD 2ZY3A 5BS7A 3RELC 3B6GB 1P3PA 4NE5A 5AV6D 2NQBD 5B32G 3A6NC 3MGPA 5GT0B 3UTAB 4YM6A 3AYWB 3AV2C 3MGRA 5CPJB 5CPKA 1M1AA 1EQZC 3WTPD 3KWQA 3REJA 4ZUXD 1P3OC 3W97B 3W98A 3W96B 3UT9B 1HQ3C 5CP6D 4E44A 3AN2A 3B6FA 2W8SA 5B1LB 5DNNB 4H9QA 5AV9C 2VQRA 5AV8B 1AOIC 1F66B 3WAAA 3KUYD 2F8ND 2PYOC 5AY8C 4WU9B 3LELA 5B33A 3AZJA 4CSRA 3X1SB 1P3PD 3B6GC 1JFIA 3AZHB 3MGQC 3MGPD 2G5IC 4YM6D 1U35A 5CPJC 1M1AD 3UTAC 3REJD 4WNNA 2BYKA 1N1JB 4WU8B 1TAFB 4J8XA 3X1VB 3W98D 4G92B 3W97C 3RELA 2YFWB 3W96C 3UT9C 3AN2D 5B0ZB 1S32D 3B6FD 4Z66D 3A6NA 3TU4B 3AV2A 5C3IB 3VH5T 4R8PC 4UUZA 3LJAB 1EQZA 5DNNC 3WAAD 1P3OA 1F66C 4CAYA 5AVCB 2F8NH 4J8WB 5B33D 4E45A 3AZJD 4WU9C 2HIOB 1KU5A 1HQ3A 1TZYC 2Y2LA 3X1SC 1P3KD 5AV9A 1AOIA 3AZHC 1U35D 2F8NB 2PYOA 4WJ3C 4H9OA 4WU8C 1M19B 3RELD 5FUGB 3VH5A 3B6GA 4NFTA 5B0ZC 3A6ND 3REIC 3AV2D 5CPKB 1ID3B 5E5AB 3MGRB 3F6TA 5CPJA 3UTAA 3LZ0B 5C3IC 3KWQB 1EQZD 3LJAC 4J8UB 1P3OD 2FJ7C 5AVCC 3W97A 1M18B 2Y2GA 4J8WC 3W96A 1HQ3D 2HIOC 3UT9A 2Y2IA 2YFVA 4Z5TD 4XZQB 3C1CD 4J8VB 5AV9D 4R8PA 3AZKB 1AOID 5DNNA 3WA9B 1F66A 2PYOD 3LELB 3AZJB 4WU9A 5AVBB 1TZYA 1M19C 3AZIB 3B6GD 3UTBB 3X1SA 5DNMB 3AZFB 5B31B 3AZHA 1BFMA 5CPJD 3AYWD 5GT0D 3UTAD 1ID3C 3VH6T 5E5AC 3LZ0C 4J8XB 3O62C 1N1JA 4WU8A 1TAFA 3W97D 3X1VA 3W96D 3UT9D 4EO5B 3AZEB 1M18C 5GXQC 5B0ZA 1B67A 3R45B 4XZQC 5GT3B 5B1LD 4J8VC 3TU4A 3MVDC 5DNND 1P3AB 5AV8D 3LJAA 1F66D 4H9SC 3WA9C 1WWIA 1B6WA 5CPIC 5AVCA 4WU9D 2FJ7A 4J8WA 2HIOA 5AVBC 3X1SD 3UTBC 5DNMC 3AZHD 3AZFC 5B31C 5AY8B 1F1EA 2JSSA 5BO0A 3FDDA 4WU8D 1W2EA 3X1VD 3VH5W 1M19A 3MGSC 3NQJB 3V9RA 5FUGA 3MGQB 4EO5C 3AZEC 5B0ZD 3TU4D 2XD1A 1ID3A 5E5AA 5GT3C 3LZ0A 3LJAD 1P3AC 2Y2PA 3O62A 4J8UA 5AVCD 4J8WD 5B32B 2HIOD 1M18A 5BNVB 1KX3C 2YFVB 3AZGC 4XZQA 5JA4A 4R8PB 4J8VA 3MVDA 3EPHA 3AZKA 4H9SA 3WA9A 3EG5B 1TZYB 1P34B 5AVBA 1M19D 3AZIA 3REHB 3UTBA 5DNMA 3AZFA 5B31A 5CPKD 1ID3D 5E5AD 3MGRD 2RIQA 5B0YC 4NE3A 3LZ0D 3KWQD 4J8UD 4NE6A 3X1TC 1KX5B 3MGSA 1M18D 2DF4C 5B32C 3AZEA 1P3BB 3REIB 4XZQD 4J8VD 1P3MC 3R45A 4YS3B 3KFUG 5B1MB 5KDMB 5GT3A 3AZKD 2AROB 3B0CT 3AFAB 1P3AA 3WA9D 4H9PB 2FJ7B 3EPKA 3LELD 3C1BC 5AVBD 3VH6W 1P34C 1KX3A 3AZGA 4QLCB 1ZLAB 3AZID 3UTBD 5DNMD 3REHC 5JRGB 3AZFD 5B31D 5AY8A 5GSUC 5BO0B 2ZY5A 5BT1C 4J8XD 4WV4B 2NZDB 4WZSB 3H0RC 4X23B 1H3OB 2CV5B 3V9RB 1KX5C 3NQJA 3AZED 3MGQA 1P3BC 5B2JB 5GT3D 5B0YA 4YS3C 5B1MC 2F8NG 3O62B 1P3AD 2AROC 3AFAC 3X1TA 4HGAB 3H0MC 5B32A 1KX4C 1P3FB 1P3LB 5GXQB 2L5AA 5BNVA 5JA4B 4QLCC 1P3MA 1ZLAC 3MVDB 4JJNC 2Y2HA 5JRGC 3X1UC 5AY8D 5CPIB 1BH9A 2Y2QA 3AZMB 2NZDC 3H0LC 1P34A 2NQBC 4H9RB 4X23C 2CV5C 2Y2MA 3WTPC 3MGQD 3REHA 2ZY2A 1BH8A 5B2JC 5B0YD 4DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU A;  1ULY A;  5AV5 B;  3MGS B;  4HGA C;  1KX5 A;  5B32 D;  2F8N K;  2RVQ C;  4LD9 C;  4KHA B;  1P3F C;  1P3L C;  1P3B A;  3B0D B;  3REI A;  1P3M D;  4R8P D;  4YS3 A;  5B1M A;  5KDM A;  3AV1 B;  2ARO A;  3AFA A;  4KUD B;  4H9P A;  1KX4 A;  3AZM C;  1TZY D;  3WTP E;  1P34 D;  3AZG B;  1KX3 B;  1ZLA A;  5G49 B;  3VH6 A;  4QLC A;  4Z2M G;  4JJN A;  3REH D;  5JRG A;  3X1U A;  1P3G C;  4H9N B;  5BT1 D;  3AN2 C;  1P3I B;  2NZD A;  5BNX A;  5AV5 C;  1S32 C;  2NQB A;  4Z66 C;  4X23 A;  1KX5 D;  1H3O A;  3B0C W;  3LZ1 B;  2CV5 A;  1P3B D;  3REI D;  5B2J A;  3B0D C;  5B0Y B;  5B24 B;  4YS3 D;  5B1M D;  2ARO D;  3AFA D;  3X1T B;  3REK B;  3AV1 C;  2FJ7 D;  4AWL C;  4KUD C;  1P3K C;  5B2I B;  3W99 B;  4LD9 A;  1P3F A;  1P3L A;  5GXQ A;  1P3M B;  4QLC D;  1ZLA D;  3AZN B;  3WKJ B;  5JRG D;  1Q9C A;  2IO5 B;  5F99 B;  3C1B B;  1BH9 B;  5CPI A;  3KXB B;  2NZD D;  3AZM A;  1P3I C;  4X23 D;  2CV5 D;  4H9R A;  3AZL B;  3LZ1 C;  4KGC B;  4XUJ B;  1BH8 B;  5B2J D;  1P3G B;  5B40 B;  5GSU B;  5B24 C;  3B0B A;  1P3G A;  3O62 D;  5AV5 A;  1S32 A;  3REK C;  4Z5T C;  4Z66 A;  3C1C C;  4ZBJ B;  2RVQ D;  5B2I C;  4LD9 D;  1P3F D;  1P3L D;  5GXQ D;  3W99 C;  4KHA A;  3AZN C;  3MVD D;  3WKJ C;  3MNN B;  3AV1 A;  5CPI D;  2IO5 C;  5F99 C;  4KUD A;  2LY8 A;  1KX4 B;  1P3K A;  3AZM D;  3KXB C;  3NQU B;  3AYW C;  5GT0 C;  5G49 A;  4JJN B;  3AZL C;  4KGC C;  4XUJ C;  3X1U B;  5B40 C;  1P3G D;  4H9N A;  5BNX B;  5CHL B;  2BYM B;  5AV5 D;  5AV6 B;  1P3I A;  2NQB B;  3MGS D;  5B1L C;  4ZBJ C;  3WTP B;  3LZ1 A;  4ZUX B;  5AV8 C;  5B24 A;  5CP6 B;  3AV1 D;  4KUD D;  3MNN C;  3REK A;  4Z5T A;  3C1C A;  4LD9 B;  5B2I A;  1KX3 D;  3AZG D;  3KUY B;  3W99 A;  4DRA A;  3AZN A;  2HUE B;  3WKJ A;  3X1V C;  5F99 A;  1P3P B;  4G92 C;  3C1B A;  1P3I D;  3KXB A;  5AV6 C;  4G91 B;  3MGP B;  4YM6 B;  1M1A B;  3TU4 C;  3AYW A;  5GT0 A;  3LZ1 D;  3REJ B;  3AZL A;  4KGC A;  4XUJ A;  4ZUX C;  3W98 B;  1HTA A;  1WWS A;  5B24 D;  5B40 A;  3AN2 B;  5CP6 C;  1S32 B;  3X1T D;  3B6F B;  3REK D;  4Z66 B;  4H9Q B;  5B1L A;  5B2I D;  3WAA B;  3W99 D;  5AV8 A;  2CWE A;  3KUY C;  4M6B A;  3AZN D;  5B33 B;  5B31 G;  4CSR B;  3WKJ D;  2HUE C;  5BS7 C;  4AWL B;  5F99 D;  3C1B D;  3MNN A;  1P3P C;  1P3K B;  1JFI B;  3KXB D;  1R4V A;  1U35 B;  4Z2M H;  4G91 C;  3MGP C;  4YM6 C;  5CPK C;  3MGR C;  1M1A C;  3NQU A;  4WNN B;  3AZL D;  3KWQ C;  2BYK B;  3REJ C;  4KGC D;  4XUJ D;  4J8U C;  3REL B;  3W98 C;  5B40 D;  5GSU D;  2YFW A;  5AV6 A;  3A6N B;  1A7W A;  2BYM A;  3AV2 B;  3B6F C;  1EQZ B;  4UUZ B;  3AZK C;  3WTP A;  1P3O B;  3WAA C;  4CAY B;  4ZUX A;  3LEL C;  5B33 C;  3AZJ C;  1HQ3 B;  5CP6 A;  4Z5T B;  3MNN D;  3C1C B;  3AZI C;  5AV9 B;  1KX4 D;  1AOI B;  3KSY A;  2PYO B;  1U35 C;  3KUY A;  2F8N A;  4H9O B;  4JJN D;  4J8X C;  3X1U D;  5BS7 A;  3REL C;  3B6G B;  1P3P A;  4NE5 A;  5AV6 D;  2NQB D;  5B32 G;  3A6N C;  3MGP A;  5GT0 B;  3UTA B;  4YM6 A;  3AYW B;  3AV2 C;  3MGR A;  5CPJ B;  5CPK A;  1M1A A;  1EQZ C;  3WTP D;  3KWQ A;  3REJ A;  4ZUX D;  1P3O C;  3W97 B;  3W98 A;  3W96 B;  3UT9 B;  1HQ3 C;  5CP6 D;  4E44 A;  3AN2 A;  3B6F A;  5B1L B;  5DNN B;  4H9Q A;  5AV9 C;  5AV8 B;  1AOI C;  1F66 B;  3WAA A;  3KUY D;  2F8N D;  2PYO C;  5AY8 C;  4WU9 B;  3LEL A;  5B33 A;  3AZJ A;  4CSR A;  3X1S B;  1P3P D;  3B6G C;  1JFI A;  3AZH B;  3MGQ C;  3MGP D;  4YM6 D;  1U35 A;  5CPJ C;  1M1A D;  3UTA C;  3REJ D;  4WNN A;  2BYK A;  1N1J B;  4WU8 B;  1TAF B;  4J8X A;  3X1V B;  3W98 D;  4G92 B;  3W97 C;  3REL A;  2YFW B;  3W96 C;  3UT9 C;  3AN2 D;  5B0Z B;  1S32 D;  3B6F D;  4Z66 D;  3A6N A;  3TU4 B;  3AV2 A;  5C3I B;  3VH5 T;  4R8P C;  4UUZ A;  3LJA B;  1EQZ A;  5DNN C;  3WAA D;  1P3O A;  1F66 C;  4CAY A;  5AVC B;  2F8N H;  4J8W B;  5B33 D;  4E45 A;  3AZJ D;  4WU9 C;  2HIO B;  1KU5 A;  1HQ3 A;  1TZY C;  3X1S C;  1P3K D;  5AV9 A;  1AOI A;  3AZH C;  1U35 D;  2F8N B;  2PYO A;  4H9O A;  4WU8 C;  1M19 B;  3REL D;  5FUG B;  3VH5 A;  3B6G A;  4NFT A;  5B0Z C;  3A6N D;  3REI C;  3AV2 D;  5CPK B;  1ID3 B;  5E5A B;  3MGR B;  5CPJ A;  3UTA A;  3LZ0 B;  5C3I C;  3KWQ B;  1EQZ D;  3LJA C;  4J8U B;  1P3O D;  2FJ7 C;  5AVC C;  3W97 A;  1M18 B;  4J8W C;  3W96 A;  1HQ3 D;  2HIO C;  3UT9 A;  2YFV A;  4Z5T D;  4XZQ B;  4J8V B;  3C1C D;  5AV9 D;  4R8P A;  3AZK B;  1AOI D;  5DNN A;  3WA9 B;  1F66 A;  2PYO D;  3LEL B;  3AZJ B;  4WU9 A;  5AVB B;  1TZY A;  1M19 C;  3AZI B;  3B6G D;  3UTB B;  3X1S A;  5DNM B;  3AZF B;  5B31 B;  3AZH A;  1BFM A;  5CPJ D;  3AYW D;  5GT0 D;  3UTA D;  1ID3 C;  3VH6 T;  5E5A C;  3LZ0 C;  4J8X B;  3O62 C;  1N1J A;  4WU8 A;  1TAF A;  3W97 D;  3X1V A;  3W96 D;  3UT9 D;  4EO5 B;  3AZE B;  1M18 C;  5GXQ C;  5B0Z A;  1B67 A;  3R45 B;  4XZQ C;  5GT3 B;  5B1L D;  4J8V C;  3TU4 A;  3MVD C;  5DNN D;  1P3A B;  5AV8 D;  3LJA A;  1F66 D;  4H9S C;  3WA9 C;  1WWI A;  1B6W A;  5CPI C;  5AVC A;  4WU9 D;  2FJ7 A;  4J8W A;  2HIO A;  5AVB C;  3X1S D;  3UTB C;  5DNM C;  3AZH D;  3AZF C;  5B31 C;  5AY8 B;  1F1E A;  2JSS A;  5BO0 A;  4WU8 D;  3X1V D;  3VH5 W;  1M19 A;  3MGS C;  3NQJ B;  3V9R A;  5FUG A;  3MGQ B;  4EO5 C;  3AZE C;  5B0Z D;  3TU4 D;  1ID3 A;  5E5A A;  5GT3 C;  3LZ0 A;  3LJA D;  1P3A C;  3O62 A;  4J8U A;  5AVC D;  4J8W D;  5B32 B;  2HIO D;  1M18 A;  5BNV B;  1KX3 C;  2YFV B;  3AZG C;  4XZQ A;  5JA4 A;  4R8P B;  4J8V A;  3MVD A;  3AZK A;  4H9S A;  3WA9 A;  1TZY B;  1P34 B;  5AVB A;  1M19 D;  3AZI A;  3REH B;  3UTB A;  5DNM A;  3AZF A;  5B31 A;  5CPK D;  1ID3 D;  5E5A D;  3MGR D;  5B0Y C;  4NE3 A;  3LZ0 D;  3KWQ D;  4J8U D;  4NE6 A;  3X1T C;  1KX5 B;  3MGS A;  1M18 D;  5B32 C;  3AZE A;  1P3B B;  3REI B;  4XZQ D;  4J8V D;  1P3M C;  3R45 A;  4YS3 B;  5B1M B;  5KDM B;  5GT3 A;  3AZK D;  3B0C T;  2ARO B;  3AFA B;  1P3A A;  3WA9 D;  4H9P B;  2FJ7 B;  3LEL D;  3C1B C;  5AVB D;  3VH6 W;  1P34 C;  1KX3 A;  3AZG A;  4QLC B;  1ZLA B;  3AZI D;  3UTB D;  5DNM D;  3REH C;  5JRG B;  3AZF D;  5B31 D;  5AY8 A;  5GSU C;  5BO0 B;  5BT1 C;  4J8X D;  4WV4 B;  2NZD B;  4WZS B;  4X23 B;  1H3O B;  2CV5 B;  3V9R B;  1KX5 C;  3NQJ A;  3AZE D;  3MGQ A;  1P3B C;  5B2J B;  5GT3 D;  5B0Y A;  4YS3 C;  5B1M C;  2F8N G;  3O62 B;  1P3A D;  2ARO C;  3AFA C;  3X1T A;  4HGA B;  5B32 A;  1KX4 C;  1P3F B;  1P3L B;  5GXQ B;  2L5A A;  5BNV A;  5JA4 B;  4QLC C;  1P3M A;  1ZLA C;  3MVD B;  4JJN C;  5JRG C;  3X1U C;  5AY8 D;  5CPI B;  1BH9 A;  3AZM B;  2NZD C;  1P34 A;  2NQB C;  4H9R B;  4X23 C;  2CV5 C;  3WTP C;  3MGQ D;  3REH A;  1BH8 A;  5B2J C;  5B0Y D;  4DRB A; 
#chains in the Genus database with same CATH topology
 5GSU A;  1ULY A;  4UPK A;  5AV5 B;  3MGS B;  4HGA C;  1KX5 A;  5B32 D;  2F8N K;  2RVQ C;  4LD9 C;  4KHA B;  1P3F C;  1P3L C;  1P3B A;  3B0D B;  3REI A;  1P3M D;  4R8P D;  4YS3 A;  2ZY4 A;  5B1M A;  5KDM A;  3AV1 B;  2ARO A;  3AFA A;  4KUD B;  4H9P A;  3P5J B;  1KX4 A;  3AZM C;  1TZY D;  3WTP E;  1P34 D;  3AZG B;  1KX3 B;  1ZLA A;  5G49 B;  3VH6 A;  4QLC A;  4Z2M G;  4JJN A;  3REH D;  5JRG A;  3X1U A;  1P3G C;  4H9N B;  5BT1 D;  3AN2 C;  3A1I A;  1P3I B;  2NZD A;  5BNX A;  5AV5 C;  1S32 C;  2NQB A;  3EPL A;  4Z66 C;  4X23 A;  1KX5 D;  1H3O A;  3B0C W;  3LZ1 B;  2CV5 A;  1P3B D;  3REI D;  5B2J A;  3AL0 C;  3B0D C;  5B0Y B;  5B24 B;  4YS3 D;  5B1M D;  2ARO D;  3AFA D;  3X1T B;  3REK B;  3AV1 C;  2FJ7 D;  4AWL C;  4KUD C;  1P3K C;  5B2I B;  3A1K A;  3W99 B;  4LD9 A;  2BG1 A;  1P3F A;  1P3L A;  5GXQ A;  1P3M B;  4QLC D;  1ZLA D;  3AZN B;  3WKJ B;  5JRG D;  1Q9C A;  2IO5 B;  5F99 B;  3C1B B;  1BH9 B;  5CPI A;  3IP4 C;  3KXB B;  2NZD D;  3AZM A;  1P3I C;  4X23 D;  2CV5 D;  4H9R A;  3AZL B;  3LZ1 C;  4KGC B;  4XUJ B;  2XD5 A;  1BH8 B;  2Y2J A;  5B2J D;  1P3G B;  5B40 B;  5GSU B;  5B24 C;  3B0B A;  1P3G A;  3O62 D;  4DQY B;  5AV5 A;  2JE5 A;  2Y2N A;  3EPJ A;  3REK C;  1S32 A;  4Z5T C;  4Z66 A;  3C1C C;  4ZBJ B;  2RVQ D;  5B2I C;  4LD9 D;  1P3F D;  1P3L D;  5GXQ D;  3W99 C;  4KHA A;  1T3U A;  3AZN C;  3MVD D;  3WKJ C;  2FFF B;  3MNN B;  3AV1 A;  5CPI D;  2IO5 C;  5F99 C;  4KUD A;  2LY8 A;  2JCH A;  1KX4 B;  1P3K A;  3AZM D;  3KXB C;  3NQU B;  3AYW C;  5GT0 C;  2UWX A;  5G49 A;  4JJN B;  3AZL C;  4KGC C;  4XUJ C;  3X1U B;  5B40 C;  1P3G D;  1Z2C B;  4H9N A;  5BNX B;  5CHL B;  2BYM B;  5AV5 D;  5AV6 B;  1P3I A;  2NQB B;  3MGS D;  5B1L C;  4ZBJ C;  3WTP B;  3LZ1 A;  4ZUX B;  5AV8 C;  5B24 A;  5CP6 B;  3AV1 D;  4KUD D;  3MNN C;  3REK A;  4Z5T A;  3C1C A;  4LD9 B;  5B2I A;  1KX3 D;  3AZG D;  3KUY B;  3W99 A;  4DRA A;  3AZN A;  1PZR A;  2HUE B;  3WKJ A;  3X1V C;  5F99 A;  1P3P B;  4G92 C;  3C1B A;  2ZM5 A;  1P3I D;  2DQN C;  3KXB A;  5AV6 C;  4G91 B;  3MGP B;  4YM6 B;  1M1A B;  3TU4 C;  3AYW A;  5GT0 A;  3LZ1 D;  3REJ B;  3AZL A;  4KGC A;  4XUJ A;  4ZUX C;  2F2A C;  3W98 B;  1HTA A;  1WWS A;  5B24 D;  5B40 A;  3AN2 B;  5CP6 C;  1S32 B;  3X1T D;  3B6F B;  3REK D;  4Z66 B;  4H9Q B;  5B1L A;  5B2I D;  3WAA B;  3W99 D;  5AV8 A;  2CWE A;  3KUY C;  4M6B A;  3AZN D;  5B33 B;  5B31 G;  4CSR B;  3WKJ D;  2HUE C;  2Y2K A;  5BS7 C;  4AWL B;  5F99 D;  3C1B D;  3MNN A;  1P3P C;  1P3K B;  1JFI B;  3KXB D;  1R4V A;  1U35 B;  4Z2M H;  4G91 C;  3MGP C;  4YM6 C;  2G5H C;  5CPK C;  3MGR C;  1M1A C;  3NQU A;  4WNN B;  3AZL D;  3KWQ C;  2BYK B;  3REJ C;  4KGC D;  4XUJ D;  4J8U C;  3REL B;  3W98 C;  5B40 D;  5GSU D;  2YFW A;  5AV6 A;  3A6N B;  1A7W A;  2BYM A;  3AV2 B;  3B6F C;  1EQZ B;  4UUZ B;  3AZK C;  3WTP A;  1P3O B;  3WAA C;  4CAY B;  4ZUX A;  3LEL C;  2Y2O A;  5B33 C;  3AZJ C;  1HQ3 B;  5CP6 A;  4Z5T B;  3MNN D;  3C1C B;  3AZI C;  5AV9 B;  1KX4 D;  1AOI B;  3KSY A;  2PYO B;  2J8P A;  3KUY A;  1U35 C;  2F8N A;  4H9O B;  4JJN D;  4J8X C;  3X1U D;  2ZY3 A;  5BS7 A;  3REL C;  3B6G B;  1P3P A;  4NE5 A;  5AV6 D;  2NQB D;  5B32 G;  3A6N C;  3MGP A;  5GT0 B;  3UTA B;  4YM6 A;  3AYW B;  3AV2 C;  3MGR A;  5CPJ B;  5CPK A;  1M1A A;  1EQZ C;  3WTP D;  3KWQ A;  3REJ A;  4ZUX D;  1P3O C;  3W97 B;  3W98 A;  3W96 B;  3UT9 B;  1HQ3 C;  5CP6 D;  4E44 A;  3AN2 A;  3B6F A;  2W8S A;  5B1L B;  5DNN B;  4H9Q A;  5AV9 C;  2VQR A;  5AV8 B;  1AOI C;  1F66 B;  3WAA A;  3KUY D;  2F8N D;  2PYO C;  5AY8 C;  4WU9 B;  3LEL A;  5B33 A;  3AZJ A;  4CSR A;  3X1S B;  1P3P D;  3B6G C;  1JFI A;  3AZH B;  3MGQ C;  3MGP D;  2G5I C;  4YM6 D;  1U35 A;  5CPJ C;  1M1A D;  3UTA C;  3REJ D;  4WNN A;  2BYK A;  1N1J B;  4WU8 B;  1TAF B;  4J8X A;  3X1V B;  3W98 D;  4G92 B;  3W97 C;  3REL A;  2YFW B;  3W96 C;  3UT9 C;  3AN2 D;  5B0Z B;  1S32 D;  3B6F D;  4Z66 D;  3A6N A;  3TU4 B;  3AV2 A;  5C3I B;  3VH5 T;  4R8P C;  4UUZ A;  3LJA B;  1EQZ A;  5DNN C;  3WAA D;  1P3O A;  1F66 C;  4CAY A;  5AVC B;  2F8N H;  4J8W B;  5B33 D;  4E45 A;  3AZJ D;  4WU9 C;  2HIO B;  1KU5 A;  1HQ3 A;  1TZY C;  2Y2L A;  3X1S C;  1P3K D;  5AV9 A;  1AOI A;  3AZH C;  1U35 D;  2F8N B;  2PYO A;  4WJ3 C;  4H9O A;  4WU8 C;  1M19 B;  3REL D;  5FUG B;  3VH5 A;  3B6G A;  4NFT A;  5B0Z C;  3A6N D;  3REI C;  3AV2 D;  5CPK B;  1ID3 B;  5E5A B;  3MGR B;  3F6T A;  5CPJ A;  3UTA A;  3LZ0 B;  5C3I C;  3KWQ B;  1EQZ D;  3LJA C;  4J8U B;  1P3O D;  2FJ7 C;  5AVC C;  3W97 A;  1M18 B;  2Y2G A;  4J8W C;  3W96 A;  1HQ3 D;  2HIO C;  3UT9 A;  2Y2I A;  2YFV A;  4Z5T D;  4XZQ B;  3C1C D;  4J8V B;  5AV9 D;  4R8P A;  3AZK B;  1AOI D;  5DNN A;  3WA9 B;  1F66 A;  2PYO D;  3LEL B;  3AZJ B;  4WU9 A;  5AVB B;  1TZY A;  1M19 C;  3AZI B;  3B6G D;  3UTB B;  3X1S A;  5DNM B;  3AZF B;  5B31 B;  3AZH A;  1BFM A;  5CPJ D;  3AYW D;  5GT0 D;  3UTA D;  1ID3 C;  3VH6 T;  5E5A C;  3LZ0 C;  4J8X B;  3O62 C;  1N1J A;  4WU8 A;  1TAF A;  3W97 D;  3X1V A;  3W96 D;  3UT9 D;  4EO5 B;  3AZE B;  1M18 C;  5GXQ C;  5B0Z A;  1B67 A;  3R45 B;  4XZQ C;  5GT3 B;  5B1L D;  4J8V C;  3TU4 A;  3MVD C;  5DNN D;  1P3A B;  5AV8 D;  3LJA A;  1F66 D;  4H9S C;  3WA9 C;  1WWI A;  1B6W A;  5CPI C;  5AVC A;  4WU9 D;  2FJ7 A;  4J8W A;  2HIO A;  5AVB C;  3X1S D;  3UTB C;  5DNM C;  3AZH D;  3AZF C;  5B31 C;  5AY8 B;  1F1E A;  2JSS A;  5BO0 A;  3FDD A;  4WU8 D;  1W2E A;  3X1V D;  3VH5 W;  1M19 A;  3MGS C;  3NQJ B;  3V9R A;  5FUG A;  3MGQ B;  4EO5 C;  3AZE C;  5B0Z D;  3TU4 D;  2XD1 A;  1ID3 A;  5E5A A;  5GT3 C;  3LZ0 A;  3LJA D;  1P3A C;  2Y2P A;  3O62 A;  4J8U A;  5AVC D;  4J8W D;  5B32 B;  2HIO D;  1M18 A;  5BNV B;  1KX3 C;  2YFV B;  3AZG C;  4XZQ A;  5JA4 A;  4R8P B;  4J8V A;  3MVD A;  3EPH A;  3AZK A;  4H9S A;  3WA9 A;  3EG5 B;  1TZY B;  1P34 B;  5AVB A;  1M19 D;  3AZI A;  3REH B;  3UTB A;  5DNM A;  3AZF A;  5B31 A;  5CPK D;  1ID3 D;  5E5A D;  3MGR D;  2RIQ A;  5B0Y C;  4NE3 A;  3LZ0 D;  3KWQ D;  4J8U D;  4NE6 A;  3X1T C;  1KX5 B;  3MGS A;  1M18 D;  2DF4 C;  5B32 C;  3AZE A;  1P3B B;  3REI B;  4XZQ D;  4J8V D;  1P3M C;  3R45 A;  4YS3 B;  3KFU G;  5B1M B;  5KDM B;  5GT3 A;  3AZK D;  2ARO B;  3B0C T;  3AFA B;  1P3A A;  3WA9 D;  4H9P B;  2FJ7 B;  3EPK A;  3LEL D;  3C1B C;  5AVB D;  3VH6 W;  1P34 C;  1KX3 A;  3AZG A;  4QLC B;  1ZLA B;  3AZI D;  3UTB D;  5DNM D;  3REH C;  5JRG B;  3AZF D;  5B31 D;  5AY8 A;  5GSU C;  5BO0 B;  2ZY5 A;  5BT1 C;  4J8X D;  4WV4 B;  2NZD B;  4WZS B;  3H0R C;  4X23 B;  1H3O B;  2CV5 B;  3V9R B;  1KX5 C;  3NQJ A;  3AZE D;  3MGQ A;  1P3B C;  5B2J B;  5GT3 D;  5B0Y A;  4YS3 C;  5B1M C;  2F8N G;  3O62 B;  1P3A D;  2ARO C;  3AFA C;  3X1T A;  4HGA B;  3H0M C;  5B32 A;  1KX4 C;  1P3F B;  1P3L B;  5GXQ B;  2L5A A;  5BNV A;  5JA4 B;  4QLC C;  1P3M A;  1ZLA C;  3MVD B;  4JJN C;  2Y2H A;  5JRG C;  3X1U C;  5AY8 D;  5CPI B;  1BH9 A;  2Y2Q A;  3AZM B;  2NZD C;  3H0L C;  1P34 A;  2NQB C;  4H9R B;  4X23 C;  2CV5 C;  2Y2M A;  3WTP C;  3MGQ D;  3REH A;  2ZY2 A;  1BH8 A;  5B2J C;  5B0Y D;  4DRB A; 
#chains in the Genus database with same CATH homology
 5GSU A;  1ULY A;  4UPK A;  5AV5 B;  3MGS B;  4HGA C;  1KX5 A;  5B32 D;  2F8N K;  2RVQ C;  4LD9 C;  4KHA B;  1P3F C;  1P3L C;  1P3B A;  3B0D B;  3REI A;  1P3M D;  4R8P D;  4YS3 A;  2ZY4 A;  5B1M A;  5KDM A;  3AV1 B;  2ARO A;  3AFA A;  4KUD B;  4H9P A;  3P5J B;  1KX4 A;  3AZM C;  1TZY D;  3WTP E;  1P34 D;  3AZG B;  1KX3 B;  1ZLA A;  5G49 B;  3VH6 A;  4QLC A;  4Z2M G;  4JJN A;  3REH D;  5JRG A;  3X1U A;  1P3G C;  4H9N B;  5BT1 D;  3AN2 C;  3A1I A;  1P3I B;  2NZD A;  5BNX A;  5AV5 C;  1S32 C;  2NQB A;  3EPL A;  4Z66 C;  4X23 A;  1KX5 D;  1H3O A;  3B0C W;  3LZ1 B;  2CV5 A;  1P3B D;  3REI D;  5B2J A;  3AL0 C;  3B0D C;  5B0Y B;  5B24 B;  4YS3 D;  5B1M D;  2ARO D;  3AFA D;  3X1T B;  3REK B;  3AV1 C;  2FJ7 D;  4AWL C;  4KUD C;  1P3K C;  5B2I B;  3A1K A;  3W99 B;  4LD9 A;  2BG1 A;  1P3F A;  1P3L A;  5GXQ A;  1P3M B;  4QLC D;  1ZLA D;  3AZN B;  3WKJ B;  5JRG D;  1Q9C A;  2IO5 B;  5F99 B;  3C1B B;  1BH9 B;  5CPI A;  3IP4 C;  3KXB B;  2NZD D;  3AZM A;  1P3I C;  4X23 D;  2CV5 D;  4H9R A;  3AZL B;  3LZ1 C;  4KGC B;  4XUJ B;  2XD5 A;  1BH8 B;  2Y2J A;  5B2J D;  1P3G B;  5B40 B;  5GSU B;  5B24 C;  3B0B A;  1P3G A;  3O62 D;  4DQY B;  5AV5 A;  2JE5 A;  2Y2N A;  3EPJ A;  3REK C;  1S32 A;  4Z5T C;  4Z66 A;  3C1C C;  4ZBJ B;  2RVQ D;  5B2I C;  4LD9 D;  1P3F D;  1P3L D;  5GXQ D;  3W99 C;  4KHA A;  1T3U A;  3AZN C;  3MVD D;  3WKJ C;  2FFF B;  3MNN B;  3AV1 A;  5CPI D;  2IO5 C;  5F99 C;  4KUD A;  2LY8 A;  2JCH A;  1KX4 B;  1P3K A;  3AZM D;  3KXB C;  3NQU B;  3AYW C;  5GT0 C;  2UWX A;  5G49 A;  4JJN B;  3AZL C;  4KGC C;  4XUJ C;  3X1U B;  5B40 C;  1P3G D;  1Z2C B;  4H9N A;  5BNX B;  5CHL B;  2BYM B;  5AV5 D;  5AV6 B;  1P3I A;  2NQB B;  3MGS D;  5B1L C;  4ZBJ C;  3WTP B;  3LZ1 A;  4ZUX B;  5AV8 C;  5B24 A;  5CP6 B;  3AV1 D;  4KUD D;  3MNN C;  3REK A;  4Z5T A;  3C1C A;  4LD9 B;  5B2I A;  1KX3 D;  3AZG D;  3KUY B;  3W99 A;  4DRA A;  3AZN A;  1PZR A;  2HUE B;  3WKJ A;  3X1V C;  5F99 A;  1P3P B;  4G92 C;  3C1B A;  2ZM5 A;  1P3I D;  2DQN C;  3KXB A;  5AV6 C;  4G91 B;  3MGP B;  4YM6 B;  1M1A B;  3TU4 C;  3AYW A;  5GT0 A;  3LZ1 D;  3REJ B;  3AZL A;  4KGC A;  4XUJ A;  4ZUX C;  2F2A C;  3W98 B;  1HTA A;  1WWS A;  5B24 D;  5B40 A;  3AN2 B;  5CP6 C;  1S32 B;  3X1T D;  3B6F B;  3REK D;  4Z66 B;  4H9Q B;  5B1L A;  5B2I D;  3WAA B;  3W99 D;  5AV8 A;  2CWE A;  3KUY C;  4M6B A;  3AZN D;  5B33 B;  5B31 G;  4CSR B;  3WKJ D;  2HUE C;  2Y2K A;  5BS7 C;  4AWL B;  5F99 D;  3C1B D;  3MNN A;  1P3P C;  1P3K B;  1JFI B;  3KXB D;  1R4V A;  1U35 B;  4Z2M H;  4G91 C;  3MGP C;  4YM6 C;  2G5H C;  5CPK C;  3MGR C;  1M1A C;  3NQU A;  4WNN B;  3AZL D;  3KWQ C;  2BYK B;  3REJ C;  4KGC D;  4XUJ D;  4J8U C;  3REL B;  3W98 C;  5B40 D;  5GSU D;  2YFW A;  5AV6 A;  3A6N B;  1A7W A;  2BYM A;  3AV2 B;  3B6F C;  1EQZ B;  4UUZ B;  3AZK C;  3WTP A;  1P3O B;  3WAA C;  4CAY B;  4ZUX A;  3LEL C;  2Y2O A;  5B33 C;  3AZJ C;  1HQ3 B;  5CP6 A;  4Z5T B;  3MNN D;  3C1C B;  3AZI C;  5AV9 B;  1KX4 D;  1AOI B;  3KSY A;  2PYO B;  2J8P A;  3KUY A;  1U35 C;  2F8N A;  4H9O B;  4JJN D;  4J8X C;  3X1U D;  2ZY3 A;  5BS7 A;  3REL C;  3B6G B;  1P3P A;  4NE5 A;  5AV6 D;  2NQB D;  5B32 G;  3A6N C;  3MGP A;  5GT0 B;  3UTA B;  4YM6 A;  3AYW B;  3AV2 C;  3MGR A;  5CPJ B;  5CPK A;  1M1A A;  1EQZ C;  3WTP D;  3KWQ A;  3REJ A;  4ZUX D;  1P3O C;  3W97 B;  3W98 A;  3W96 B;  3UT9 B;  1HQ3 C;  5CP6 D;  4E44 A;  3AN2 A;  3B6F A;  2W8S A;  5B1L B;  5DNN B;  4H9Q A;  5AV9 C;  2VQR A;  5AV8 B;  1AOI C;  1F66 B;  3WAA A;  3KUY D;  2F8N D;  2PYO C;  5AY8 C;  4WU9 B;  3LEL A;  5B33 A;  3AZJ A;  4CSR A;  3X1S B;  1P3P D;  3B6G C;  1JFI A;  3AZH B;  3MGQ C;  3MGP D;  2G5I C;  4YM6 D;  1U35 A;  5CPJ C;  1M1A D;  3UTA C;  3REJ D;  4WNN A;  2BYK A;  1N1J B;  4WU8 B;  1TAF B;  4J8X A;  3X1V B;  3W98 D;  4G92 B;  3W97 C;  3REL A;  2YFW B;  3W96 C;  3UT9 C;  3AN2 D;  5B0Z B;  1S32 D;  3B6F D;  4Z66 D;  3A6N A;  3TU4 B;  3AV2 A;  5C3I B;  3VH5 T;  4R8P C;  4UUZ A;  3LJA B;  1EQZ A;  5DNN C;  3WAA D;  1P3O A;  1F66 C;  4CAY A;  5AVC B;  2F8N H;  4J8W B;  5B33 D;  4E45 A;  3AZJ D;  4WU9 C;  2HIO B;  1KU5 A;  1HQ3 A;  1TZY C;  2Y2L A;  3X1S C;  1P3K D;  5AV9 A;  1AOI A;  3AZH C;  1U35 D;  2F8N B;  2PYO A;  4WJ3 C;  4H9O A;  4WU8 C;  1M19 B;  3REL D;  5FUG B;  3VH5 A;  3B6G A;  4NFT A;  5B0Z C;  3A6N D;  3REI C;  3AV2 D;  5CPK B;  1ID3 B;  5E5A B;  3MGR B;  3F6T A;  5CPJ A;  3UTA A;  3LZ0 B;  5C3I C;  3KWQ B;  1EQZ D;  3LJA C;  4J8U B;  1P3O D;  2FJ7 C;  5AVC C;  3W97 A;  1M18 B;  2Y2G A;  4J8W C;  3W96 A;  1HQ3 D;  2HIO C;  3UT9 A;  2Y2I A;  2YFV A;  4Z5T D;  4XZQ B;  3C1C D;  4J8V B;  5AV9 D;  4R8P A;  3AZK B;  1AOI D;  5DNN A;  3WA9 B;  1F66 A;  2PYO D;  3LEL B;  3AZJ B;  4WU9 A;  5AVB B;  1TZY A;  1M19 C;  3AZI B;  3B6G D;  3UTB B;  3X1S A;  5DNM B;  3AZF B;  5B31 B;  3AZH A;  1BFM A;  5CPJ D;  3AYW D;  5GT0 D;  3UTA D;  1ID3 C;  3VH6 T;  5E5A C;  3LZ0 C;  4J8X B;  3O62 C;  1N1J A;  4WU8 A;  1TAF A;  3W97 D;  3X1V A;  3W96 D;  3UT9 D;  4EO5 B;  3AZE B;  1M18 C;  5GXQ C;  5B0Z A;  1B67 A;  3R45 B;  4XZQ C;  5GT3 B;  5B1L D;  4J8V C;  3TU4 A;  3MVD C;  5DNN D;  1P3A B;  5AV8 D;  3LJA A;  1F66 D;  4H9S C;  3WA9 C;  1WWI A;  1B6W A;  5CPI C;  5AVC A;  4WU9 D;  2FJ7 A;  4J8W A;  2HIO A;  5AVB C;  3X1S D;  3UTB C;  5DNM C;  3AZH D;  3AZF C;  5B31 C;  5AY8 B;  1F1E A;  2JSS A;  5BO0 A;  3FDD A;  4WU8 D;  1W2E A;  3X1V D;  3VH5 W;  1M19 A;  3MGS C;  3NQJ B;  3V9R A;  5FUG A;  3MGQ B;  4EO5 C;  3AZE C;  5B0Z D;  3TU4 D;  2XD1 A;  1ID3 A;  5E5A A;  5GT3 C;  3LZ0 A;  3LJA D;  1P3A C;  2Y2P A;  3O62 A;  4J8U A;  5AVC D;  4J8W D;  5B32 B;  2HIO D;  1M18 A;  5BNV B;  1KX3 C;  2YFV B;  3AZG C;  4XZQ A;  5JA4 A;  4R8P B;  4J8V A;  3MVD A;  3EPH A;  3AZK A;  4H9S A;  3WA9 A;  3EG5 B;  1TZY B;  1P34 B;  5AVB A;  1M19 D;  3AZI A;  3REH B;  3UTB A;  5DNM A;  3AZF A;  5B31 A;  5CPK D;  1ID3 D;  5E5A D;  3MGR D;  2RIQ A;  5B0Y C;  4NE3 A;  3LZ0 D;  3KWQ D;  4J8U D;  4NE6 A;  3X1T C;  1KX5 B;  3MGS A;  1M18 D;  2DF4 C;  5B32 C;  3AZE A;  1P3B B;  3REI B;  4XZQ D;  4J8V D;  1P3M C;  3R45 A;  4YS3 B;  3KFU G;  5B1M B;  5KDM B;  5GT3 A;  3AZK D;  2ARO B;  3B0C T;  3AFA B;  1P3A A;  3WA9 D;  4H9P B;  2FJ7 B;  3EPK A;  3LEL D;  3C1B C;  5AVB D;  3VH6 W;  1P34 C;  1KX3 A;  3AZG A;  4QLC B;  1ZLA B;  3AZI D;  3UTB D;  5DNM D;  3REH C;  5JRG B;  3AZF D;  5B31 D;  5AY8 A;  5GSU C;  5BO0 B;  2ZY5 A;  5BT1 C;  4J8X D;  4WV4 B;  2NZD B;  4WZS B;  3H0R C;  4X23 B;  1H3O B;  2CV5 B;  3V9R B;  1KX5 C;  3NQJ A;  3AZE D;  3MGQ A;  1P3B C;  5B2J B;  5GT3 D;  5B0Y A;  4YS3 C;  5B1M C;  2F8N G;  3O62 B;  1P3A D;  2ARO C;  3AFA C;  3X1T A;  4HGA B;  3H0M C;  5B32 A;  1KX4 C;  1P3F B;  1P3L B;  5GXQ B;  2L5A A;  5BNV A;  5JA4 B;  4QLC C;  1P3M A;  1ZLA C;  3MVD B;  4JJN C;  2Y2H A;  5JRG C;  3X1U C;  5AY8 D;  5CPI B;  1BH9 A;  2Y2Q A;  3AZM B;  2NZD C;  3H0L C;  1P34 A;  2NQB C;  4H9R B;  4X23 C;  2CV5 C;  2Y2M A;  3WTP C;  3MGQ D;  3REH A;  2ZY2 A;  1BH8 A;  5B2J C;  5B0Y D;  4DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...