1KX5C

X-ray structure of the nucleosome core particle, ncp147, at 1.9 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 128
sequence length 128
chains with identical sequence G
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx5C00
5JA4B 1AOIB 4WU9A 2YFVA 3REKA 3AV1D 2PYOC 3C1CC 1P3KB 3X1SA 5B1MA 1P3IA 3WTPE 3MGQD 5F99C 3LJAC 3REIC 3W97A 5JRGA 2PYOB 3MNNA 4J8VD 3AZLA 4XUJC 5BNVA 1P3LC 1R4VA 5CPKD 4J8XC 1KX4C 1P3AB 3WA9D 3C1CD 1WWIA 3RELC 1F66D 1HQ3D 5B32B 1S32D 4XUJB 5GSUA 1EQZC 4J8XB 5B2JA 1KX4B 3X1VA 3AZMC 4KGCC 4Z66C 3RELB 3O62D 4HGAC 3LELC 5CPIA 3UT9B 1B67A 3WKJA 2FJ7C 4J8UA 3LZ0A 3W96C 3AZMB 3AFAC 1M19C 3KXBD 1KX5B 3AZFB 4HGAB 3KWQC 1EQZD 3AZID 5AVCB 2BYMB 2FJ7B 4WV4B 2BYKB 4R8PD 5BNXA 3R45B 1ID3B 4AWLB 3LELD 5B32G 1M1AA 5AV5A 3KWQB 4WNNA 5C3IB 2HIOB 4YM6B 4WU8D 2NZDC 2CWEA 5B40C 5DNNB 4Z5TD 3UTBD 3AV2C 4JJNA 4G92B 1JFIB 1P3OA 4CAYA 4X23D 2NZDB 5GT0C 5B40B 3AZEC 1P3BC 3AV1A 1P34D 3VH6A 3NQJB 5B24D 4ZBJC 1BFMA 3VH5A 3MGPC 3X1TC 4XZQD 5B0YB 3W98D 5GT0B 5B0ZD 4DRBA 3MGQA 3REHB 3AZEB 4LD9D 1P3PC 3AZJC 3W99C 2L5AA 4J8VA 2HUEB 3KUYD 3AZKC 3MGSB 5GXQD 5CPKA 3MGPB 3X1TB 4J8WA 5AV9C 5AV8D 4WU9B 3B6GD 3C1CA 1F66A 3WA9A 1P3PB 3AZJB 4H9PA 4H9RB 5CP6D 1HQ3A 2YFVB 1S32A 3AZKB 5BO0A 5B33D 3X1SB 5AV9B 1P3IB 2CV5C 3A6NC 3O62A 3X1UC 5DNMD 5JRGB 3AZGC 3MNNB 3MGRD 4H9NB 3AZND 2JSSA 3C1BD 3AZLB 2F8NH 2YFWB 3KXBA 3UTAD 5E5AD 3AZIA 2CV5D 5BS7A 4R8PA 1KU5A 3VH5T 1BH9A 5B2JB 2LY8A 3X1VB 1P3FD 4QLCD 3MVDC 4H9QB 3B6FC 5B2IC 2F8ND 4ZUXD 4J8UB 4WU8A 4Z5TA 3B0CW 4YS3D 3TU4D 3UTBA 2RVQC 1AOIC 1B6WA 5B1LD 4KUDD 4X23A 5CPJD 3WAAB 5BNXB 1P34A 1TZYD 1M1AB 5B24A 3B6FD 5AV6D 5AV5B 5GT3C 4XZQA 1M18C 3W98A 5B0ZA 4LD9A 3LZ1C 3V9RB 3KUYA 1P3AC 5GXQA 2AROD 1P3KD 5GT3B 5B31D 3AZHC 1M18B 5AV8A 5B32C 4CAYB 3B6GA 1U35C 3LZ1B 5AVBC 5CP6A 3WTPC 3AV1B 5B33A 2PYOD 3AZHB 1N1JB 3UT9C 1U35B 3MGQB 1ULYA 5AVBB 2NQBC 5F99D 5DNMA 3LJAD 3REID 3WTPB 3MGRA 3AZNA 4J8VB 3C1BA 1KX5C 3AZFC 4XUJD 1P3GB 1P3LD 4J8WB 4J8XD 5AVCC 1KX4D 3UTAA 2NQBB 3WA9B 1F66B 4H9PB 3RELD 5E5AA 1HQ3B 1ID3C 4AWLC 2CV5A 3REJC 2IO5C 4Z2MH 1P3FA 5C3IC 5KDMB 4QLCA 2HIOC 4YM6C 3AZMD 1TAFA 4Z66D 4KGCD 1KX5D 4H9OA 5DNNC 2F8NA 4ZUXA 3REJB 2FJ7D 4G92C 2IO5B 3W96D 4YS3A 3TU4A 3AFAD 4KHAB 1M19D 3AYWC 5B1LA 3KWQD 3AZIB 4KUDA 4E44A 4H9SA 4G91B 5CPJA 4R8PB 1ZLAA 4EO5B 1KX3C 3AN2C 5B0YC 1TZYA 3B6FA 5AV6A 3REHC 3AYWB 5AY8C 2HUEC 1Q9CA 3MGSC 1P3MC 1KX3B 3AN2B 2NZDD 5B40D 4Z5TB 4WU9C 2AROA 3AV2D 1P3KA 5B31A 5AY8B 3REKC 1P3MB 3X1SC 5GT0D 5B1MC 3NQUB 3AZED 1P3BD 1P3IC 1P34B 2PYOA 5JRGC 4XZQB 3REKB 3X1TD 3MGPD 3W97C 3MNNC 3W98B 5B0ZB 3AZLC 5F99A 5B1MB 3LJAA 3REIA 1P3PD 3AZJD 3W99D 3KUYB 4NE6A 5GXQB 4XUJA 3AZKD 1P3LA 3W97B 3X1SD 4J8XA 5AV9D 1KX4A 5BNVB 5GSUC 3RELA 5B2JC 3X1VC 5B33B 1EQZA 5CPIC 3VH6W 3AZMA 3A6ND 1BH8A 5GSUB 3VH5W 3X1UD 4Z66A 4J8UC 5DNMB 3WKJC 4KGCA 3LELA 3B0DC 3C1BB 3AZGD 2FJ7A 3W96A 2BYKA 5CPIB 4NE5A 3R45A 5BT1C 3AFAA 1M19A 4UUZA 3WKJB 5FUGA 3LZ0B 3WAAC 4M6BA 3KWQA 3B0DB 1M1AC 5AV5C 4QLCB 3MVDD 4H9OB 5B2ID 4JJNC 4WNNB 4NFTA 5B40A 1P3OC 3WAAD 2NZDA 5G49A 2RVQD 3AV2A 1AOID 3AV1C 4KUDB 5CPJB 4JJNB 3B0CT 1ZLAB 5GT0A 3AZEA 1P3OB 1P3BA 1TZYB 3MGQC 5AV6B 3MGPA 5GT3D 3X1TA 1M18D 4J8VC 1P3GC 5CPKC 1P3PA 3LZ1D 4J8WC 4H9RA 3AZJA 3W99A 2F8NG 3AZKA 2AROB 3WA9C 1P3AD 1F66C 5B31B 1HQ3C 5AV9A 3AZHD 1S32C 4CSRA 5B32D 1U35D 4DRAA 5CPKB 5AVBD 1H3OA 1F1EA 3WTPD 3C1CB 3O62C 4H9NA 1S32B 1P3GD 4J8WD 3UT9D 2YFWA 5BO0B 5CHLB 3A6NA 3X1UA 5F99B 3LJAB 2NQBD 3REIB 3AZGA 3KXBC 3O62B 3AZFD 1P3LB 3AZIC 5AVCD 4G91C 5BS7C 4R8PC 1HTAA 4EO5C 1ID3D 3KXBB 5B31G 4H9QA 2F8NK 1EQZB 3REJD 4KGCB 1BH8B 2HIOD 4Z66B 4YM6D 3MVDA 4WU8C 1BH9B 3LELB 4Z5TC 5DNND 5B2IA 3UTBC 3W96B 3WAAA 3AFAB 1M19B 4UUZB 5FUGB 5JA4A 4WU8B 4X23C 1AOIA 3AYWD 3UTBB 1P34C 3KSYA 5B24C 1KX3D 3V9RA 4XZQC 3AN2D 1A7WA 3W98C 4X23B 5B0YD 5B0ZC 4LD9C 3REHD 5GT3A 1M18A 5B24B 5AY8D 3KUYC 5GXQC 3MGSD 1P3MD 3LZ1A 5AV8C 5G49B 4LD9B 3B6GC 1P3AA 3AV2B 4WU9D 5CP6C 3AZHA 1N1JA 5B32A 3REKD 5B33C 1U35A 5AVBA 1P3BB 5B1MD 5AV8B 1P3ID 3WTPA 3B6GB 5CP6B 4ZBJB 5DNMC 4Z2MG 1P3GA 5JRGD 3MGRC 3B0BA 3UT9A 4NE3A 3AZNC 3MNND 3C1BC 3W97D 2NQBA 3AZLD 3W99B 3UTAC 1KX5A 3AZFA 3LZ0C 5E5AC 3MGRB 3AZNB 4CSRB 5AVCA 2BYMA 5KDMA 4WZSB 5GSUD 1ID3A 5B2JD 1H3OB 1P3FC 3UTAB 3X1VD 4QLCC 3REJA 5E5AB 5CPID 2CV5B 3A6NB 2HIOA 4ZUXC 4YM6A 4KHAA 3X1UB 3WKJD 4J8UD 3LZ0D 1P3FB 4YS3C 5DNNA 3TU4C 3AZGB 1TAFB 3VH6T 1JFIA 5B1LC 2F8NB 5BT1D 1WWSA 4ZUXB 4KUDC 4H9SC 5CPJC 1ZLAC 3AYWA 4YS3B 4E45A 3TU4B 1TZYC 5AV6C 1M1AD 3NQJA 5AV5D 5B1LB 1KX3A 3AN2A 5B0YA 3MVDB 3REHA 3B6FB 5B2IB 5AY8A 2AROC 3MGSA 1P3KC 4JJND 1P3MA 1ZLAD 5B31C 1P3OD 3NQUA
chains in the Genus database with same CATH superfamily
5JA4B 1AOIB 4WU9A 2YFVA 3EPLA 3REKA 3AV1D 2PYOC 3C1CC 1P3KB 3X1SA 2DF4C 5B1MA 1P3IA 3WTPE 3MGQD 5F99C 3LJAC 3REIC 3W97A 5JRGA 2PYOB 3MNNA 4J8VD 3AZLA 4XUJC 5BNVA 1P3LC 1R4VA 5CPKD 4J8XC 1KX4C 1P3AB 3WA9D 3C1CD 1WWIA 3RELC 1F66D 1HQ3D 5B32B 1S32D 2W8SA 4XUJB 2Y2QA 5GSUA 1EQZC 4J8XB 4KGCA 5B2JA 1KX4B 3X1VA 3AZMC 4KGCC 4Z66C 3RELB 3O62D 4HGAC 3LELC 2ZM5A 5CPIA 3UT9B 1B67A 3WKJA 2FJ7C 4J8UA 3LZ0A 3W96C 3AZMB 3AFAC 1M19C 3KXBD 1KX5B 3AZFB 4HGAB 3KWQC 1EQZD 3AZID 5AVCB 2BYMB 2JCHA 2FJ7B 4WV4B 2BG1A 2BYKB 4R8PD 5BNXA 3R45B 1ID3B 4AWLB 3LELD 5B32G 1M1AA 3F6TA 5AV5A 3KWQB 4WNNA 5C3IB 2HIOB 4YM6B 4WU8D 2NZDC 2CWEA 5B40C 2RIQA 5DNNB 4Z5TD 3UTBD 3AV2C 4JJNA 4G92B 1JFIB 1P3OA 4CAYA 3AL0C 4X23D 2NZDB 5GT0C 5B40B 3AZEC 1P3BC 3AV1A 1P34D 3VH6A 3NQJB 5B24D 4ZBJC 1BFMA 3VH5A 3MGPC 3X1TC 2Y2JA 5B0YB 4XZQD 3W98D 5GT0B 5B0ZD 4DRBA 3MGQA 3REHB 3AZEB 4LD9D 1P3PC 3AZJC 3W99C 2Y2LA 3H0RC 2L5AA 4J8VA 2HUEB 3KUYD 3AZKC 3MGSB 5GXQD 4DQYB 5CPKA 3MGPB 3X1TB 4J8WA 5AV9C 5AV8D 4WU9B 3B6GD 3C1CA 1F66A 3WA9A 1P3PB 3AZJB 4H9PA 4H9RB 5CP6D 1HQ3A 2YFVB 1S32A 3AZKB 5BO0A 5B33D 3X1SB 5AV9B 1P3IB 2CV5C 3A6NC 2ZY5A 3O62A 3X1UC 5DNMD 5JRGB 3AZGC 3MNNB 3MGRD 4H9NB 3AZND 2JSSA 3C1BD 3AZLB 2F8NH 2VQRA 2YFWB 3KXBA 3UTAD 4UPKA 5E5AD 3AZIA 2CV5D 5BS7A 4R8PA 2F2AC 1KU5A 3VH5T 1BH9A 5B2JB 2LY8A 3X1VB 1P3FD 4QLCD 3MVDC 4H9QB 3B6FC 5B2IC 2F8ND 4ZUXD 4J8UB 4WU8A 4Z5TA 3B0CW 4YS3D 3TU4D 3UTBA 2RVQC 1AOIC 1B6WA 3IP4C 5B1LD 4KUDD 2FFFB 4X23A 5CPJD 3WAAB 5BNXB 1P34A 1TZYD 1M1AB 5B24A 3B6FD 5AV6D 5AV5B 5GT3C 4XZQA 1M18C 3W98A 5B0ZA 4LD9A 3LZ1C 3V9RB 3KUYA 1P3AC 5GXQA 2AROD 1P3KD 5GT3B 5B31D 3AZHC 1M18B 5AV8A 5B32C 4CAYB 3B6GA 1U35C 2DQNC 3LZ1B 5AVBC 5CP6A 3WTPC 3AV1B 5B33A 2PYOD 3AZHB 1N1JB 3UT9C 1U35B 3MGQB 1ULYA 5AVBB 2NQBC 5F99D 5DNMA 3LJAD 3REID 3WTPB 3MGRA 3AZNA 4J8VB 3C1BA 1KX5C 3AZFC 4XUJD 1P3GB 1P3LD 3A1KA 4J8WB 4J8XD 5AVCC 1KX4D 3UTAA 2NQBB 3WA9B 1F66B 4H9PB 3RELD 5E5AA 1HQ3B 1ID3C 4AWLC 2CV5A 3REJC 2IO5C 4Z2MH 1P3FA 5C3IC 5KDMB 4QLCA 2HIOC 4YM6C 3AZMD 1TAFA 4Z66D 4KGCD 1KX5D 4H9OA 5DNNC 2F8NA 4ZUXA 3REJB 3EPKA 2FJ7D 4G92C 2IO5B 3W96D 4YS3A 3TU4A 1T3UA 3AFAD 4KHAB 1M19D 2ZY3A 3AYWC 5B1LA 3KWQD 3AZIB 4KUDA 4E44A 4H9SA 4G91B 5CPJA 4R8PB 1ZLAA 4EO5B 1KX3C 3AN2C 5B0YC 1TZYA 3B6FA 5AV6A 3REHC 3AYWB 1PZRA 2ZY4A 5AY8C 2HUEC 1Q9CA 3MGSC 1P3MC 1KX3B 3AN2B 2NZDD 5B40D 4Z5TB 3P5JB 2Y2NA 4WU9C 2AROA 3AV2D 1P3KA 5B31A 5AY8B 3REKC 1P3MB 3X1SC 5GT0D 5B1MC 3NQUB 3AZED 1P3BD 2Y2IA 1P3IC 1P34B 2PYOA 5JRGC 4XZQB 3REKB 3X1TD 3MGPD 3W97C 3MNNC 3W98B 5B0ZB 3AZLC 5F99A 5B1MB 3LJAA 3REIA 1P3PD 3AZJD 3W99D 3KUYB 2XD1A 4NE6A 5GXQB 4XUJA 3AZKD 1P3LA 3W97B 3X1SD 4J8XA 5AV9D 1KX4A 5BNVB 2G5IC 5GSUC 3RELA 5B2JC 3X1VC 5B33B 1EQZA 2Y2KA 3H0LC 3VH6W 5CPIC 1W2EA 3AZMA 3A6ND 1BH8A 5GSUB 3VH5W 2Y2MA 3X1UD 4Z66A 5DNMB 4J8UC 3WKJC 3LELA 3B0DC 3C1BB 3AZGD 2FJ7A 3W96A 2BYKA 5CPIB 4NE5A 3R45A 2Y2PA 5BT1C 3AFAA 4UUZA 1M19A 5FUGA 3WKJB 3LZ0B 3FDDA 3WAAC 2Y2HA 4M6BA 3KWQA 3B0DB 1M1AC 5AV5C 4QLCB 3MVDD 4H9OB 5B2ID 4JJNC 4WNNB 4NFTA 5B40A 1P3OC 3WAAD 2NZDA 5G49A 2RVQD 3AV2A 1AOID 3AV1C 4KUDB 5CPJB 4JJNB 3B0CT 1ZLAB 5GT0A 3AZEA 1P3OB 1P3BA 2J8PA 1TZYB 3MGQC 5AV6B 3MGPA 5GT3D 3X1TA 1M18D 4J8VC 1P3GC 5CPKC 1P3PA 3LZ1D 4J8WC 4H9RA 3AZJA 3W99A 2F8NG 3AZKA 2AROB 3WA9C 1P3AD 2Y2OA 1F66C 5B31B 1HQ3C 5AV9A 3AZHD 1S32C 4CSRA 5B32D 2ZY2A 1U35D 4DRAA 5CPKB 5AVBD 1H3OA 1F1EA 3WTPD 3C1CB 3O62C 4H9NA 2UWXA 1S32B 1P3GD 4J8WD 3UT9D 2YFWA 5BO0B 5CHLB 3A6NA 3X1UA 5F99B 3LJAB 2NQBD 3REIB 3AZGA 3KXBC 3O62B 3AZFD 1P3LB 3AZIC 5AVCD 4G91C 5BS7C 4R8PC 1HTAA 4EO5C 1ID3D 3KXBB 5B31G 4H9QA 2F8NK 1EQZB 3REJD 4KGCB 1BH8B 2HIOD 4Z66B 4YM6D 3MVDA 4WU8C 1BH9B 3LELB 4Z5TC 5DNND 5B2IA 3UTBC 4WJ3C 3W96B 3EG5B 3WAAA 3AFAB 1M19B 4UUZB 5FUGB 1Z2CB 5JA4A 4WU8B 4X23C 1AOIA 3AYWD 3UTBB 1P34C 3KSYA 5B24C 1KX3D 3V9RA 4XZQC 3AN2D 1A7WA 3W98C 4X23B 5B0YD 5B0ZC 4LD9C 3REHD 5GT3A 1M18A 5B24B 5AY8D 3KUYC 5GXQC 3MGSD 1P3MD 3LZ1A 5AV8C 5G49B 4LD9B 3B6GC 1P3AA 3AV2B 4WU9D 5CP6C 3AZHA 1N1JA 5B32A 3REKD 5B33C 1U35A 5AVBA 1P3BB 5B1MD 5AV8B 1P3ID 3WTPA 3B6GB 5CP6B 4ZBJB 5DNMC 4Z2MG 1P3GA 5JRGD 3MGRC 3B0BA 3UT9A 4NE3A 3AZNC 3MNND 3C1BC 3W97D 2NQBA 3AZLD 3W99B 3UTAC 1KX5A 3AZFA 3LZ0C 5E5AC 3MGRB 3AZNB 3H0MC 4CSRB 5AVCA 2BYMA 5KDMA 4WZSB 3A1IA 2XD5A 5GSUD 1ID3A 5B2JD 1H3OB 1P3FC 3UTAB 3X1VD 4QLCC 1P3OD 3REJA 5E5AB 3KFUG 5CPID 2CV5B 2Y2GA 2HIOA 4ZUXC 4YM6A 4KHAA 3X1UB 3A6NB 3WKJD 4J8UD 3LZ0D 1P3FB 4YS3C 5DNNA 3TU4C 3AZGB 1TAFB 3VH6T 1JFIA 5B1LC 2F8NB 5BT1D 1WWSA 4ZUXB 4KUDC 4H9SC 5CPJC 1ZLAC 3AYWA 4YS3B 2JE5A 4E45A 3TU4B 1TZYC 5AV6C 1M1AD 3NQJA 5AV5D 5B1LB 1KX3A 3AN2A 5B0YA 3MVDB 3REHA 2G5HC 5B2IB 3B6FB 5AY8A 2AROC 3MGSA 1P3KC 4JJND 1P3MA 1ZLAD 5B31C 3EPHA 3EPJA 3NQUA
chains in the Genus database with same CATH topology
5JA4B 1AOIB 4WU9A 2YFVA 3EPLA 3REKA 3AV1D 2PYOC 3C1CC 1P3KB 3X1SA 2DF4C 5B1MA 1P3IA 3WTPE 3MGQD 5F99C 3LJAC 3REIC 3W97A 5JRGA 2PYOB 3MNNA 4J8VD 3AZLA 4XUJC 5BNVA 1P3LC 1R4VA 5CPKD 4J8XC 1KX4C 1P3AB 3WA9D 3C1CD 1WWIA 3RELC 1F66D 1HQ3D 5B32B 1S32D 2W8SA 4XUJB 2Y2QA 5GSUA 1EQZC 4J8XB 4KGCA 5B2JA 1KX4B 3X1VA 3AZMC 4KGCC 4Z66C 3RELB 3O62D 4HGAC 3LELC 2ZM5A 5CPIA 3UT9B 1B67A 3WKJA 2FJ7C 4J8UA 3LZ0A 3W96C 3AZMB 3AFAC 1M19C 3KXBD 1KX5B 3AZFB 4HGAB 3KWQC 1EQZD 3AZID 5AVCB 2BYMB 2JCHA 2FJ7B 4WV4B 2BG1A 2BYKB 4R8PD 5BNXA 3R45B 1ID3B 4AWLB 3LELD 5B32G 1M1AA 3F6TA 5AV5A 3KWQB 4WNNA 5C3IB 2HIOB 4YM6B 4WU8D 2NZDC 2CWEA 5B40C 2RIQA 5DNNB 4Z5TD 3UTBD 3AV2C 4JJNA 4G92B 1JFIB 1P3OA 4CAYA 3AL0C 4X23D 2NZDB 5GT0C 5B40B 3AZEC 1P3BC 3AV1A 1P34D 3VH6A 3NQJB 5B24D 4ZBJC 1BFMA 3VH5A 3MGPC 3X1TC 2Y2JA 5B0YB 4XZQD 3W98D 5GT0B 5B0ZD 4DRBA 3MGQA 3REHB 3AZEB 4LD9D 1P3PC 3AZJC 3W99C 2Y2LA 3H0RC 2L5AA 4J8VA 2HUEB 3KUYD 3AZKC 3MGSB 5GXQD 4DQYB 5CPKA 3MGPB 3X1TB 4J8WA 5AV9C 5AV8D 4WU9B 3B6GD 3C1CA 1F66A 3WA9A 1P3PB 3AZJB 4H9PA 4H9RB 5CP6D 1HQ3A 2YFVB 1S32A 3AZKB 5BO0A 5B33D 3X1SB 5AV9B 1P3IB 2CV5C 3A6NC 2ZY5A 3O62A 3X1UC 5DNMD 5JRGB 3AZGC 3MNNB 3MGRD 4H9NB 3AZND 2JSSA 3C1BD 3AZLB 2F8NH 2VQRA 2YFWB 3KXBA 3UTAD 4UPKA 5E5AD 3AZIA 2CV5D 5BS7A 4R8PA 2F2AC 1KU5A 3VH5T 1BH9A 5B2JB 2LY8A 3X1VB 1P3FD 4QLCD 3MVDC 4H9QB 3B6FC 5B2IC 2F8ND 4ZUXD 4J8UB 4WU8A 4Z5TA 3B0CW 4YS3D 3TU4D 3UTBA 2RVQC 1AOIC 1B6WA 3IP4C 5B1LD 4KUDD 2FFFB 4X23A 5CPJD 3WAAB 5BNXB 1P34A 1TZYD 1M1AB 5B24A 3B6FD 5AV6D 5AV5B 5GT3C 4XZQA 1M18C 3W98A 5B0ZA 4LD9A 3LZ1C 3V9RB 3KUYA 1P3AC 5GXQA 2AROD 1P3KD 5GT3B 5B31D 3AZHC 1M18B 5AV8A 5B32C 4CAYB 3B6GA 1U35C 2DQNC 3LZ1B 5AVBC 5CP6A 3WTPC 3AV1B 5B33A 2PYOD 3AZHB 1N1JB 3UT9C 1U35B 3MGQB 1ULYA 5AVBB 2NQBC 5F99D 5DNMA 3LJAD 3REID 3WTPB 3MGRA 3AZNA 4J8VB 3C1BA 1KX5C 3AZFC 4XUJD 1P3GB 1P3LD 3A1KA 4J8WB 4J8XD 5AVCC 1KX4D 3UTAA 2NQBB 3WA9B 1F66B 4H9PB 3RELD 5E5AA 1HQ3B 1ID3C 4AWLC 2CV5A 3REJC 2IO5C 4Z2MH 1P3FA 5C3IC 5KDMB 4QLCA 2HIOC 4YM6C 3AZMD 1TAFA 4Z66D 4KGCD 1KX5D 4H9OA 5DNNC 2F8NA 4ZUXA 3REJB 3EPKA 2FJ7D 4G92C 2IO5B 3W96D 4YS3A 3TU4A 1T3UA 3AFAD 4KHAB 1M19D 2ZY3A 3AYWC 5B1LA 3KWQD 3AZIB 4KUDA 4E44A 4H9SA 4G91B 5CPJA 4R8PB 1ZLAA 4EO5B 1KX3C 3AN2C 5B0YC 1TZYA 3B6FA 5AV6A 3REHC 3AYWB 1PZRA 2ZY4A 5AY8C 2HUEC 1Q9CA 3MGSC 1P3MC 1KX3B 3AN2B 2NZDD 5B40D 4Z5TB 3P5JB 2Y2NA 4WU9C 2AROA 3AV2D 1P3KA 5B31A 5AY8B 3REKC 1P3MB 3X1SC 5GT0D 5B1MC 3NQUB 3AZED 1P3BD 2Y2IA 1P3IC 1P34B 2PYOA 5JRGC 4XZQB 3REKB 3X1TD 3MGPD 3W97C 3MNNC 3W98B 5B0ZB 3AZLC 5F99A 5B1MB 3LJAA 3REIA 1P3PD 3AZJD 3W99D 3KUYB 2XD1A 4NE6A 5GXQB 4XUJA 3AZKD 1P3LA 3W97B 3X1SD 4J8XA 5AV9D 1KX4A 5BNVB 2G5IC 5GSUC 3RELA 5B2JC 3X1VC 5B33B 1EQZA 2Y2KA 3H0LC 3VH6W 5CPIC 1W2EA 3AZMA 3A6ND 1BH8A 5GSUB 3VH5W 2Y2MA 3X1UD 4Z66A 5DNMB 4J8UC 3WKJC 3LELA 3B0DC 3C1BB 3AZGD 2FJ7A 3W96A 2BYKA 5CPIB 4NE5A 3R45A 2Y2PA 5BT1C 3AFAA 4UUZA 1M19A 5FUGA 3WKJB 3LZ0B 3FDDA 3WAAC 2Y2HA 4M6BA 3KWQA 3B0DB 1M1AC 5AV5C 4QLCB 3MVDD 4H9OB 5B2ID 4JJNC 4WNNB 4NFTA 5B40A 1P3OC 3WAAD 2NZDA 5G49A 2RVQD 3AV2A 1AOID 3AV1C 4KUDB 5CPJB 4JJNB 3B0CT 1ZLAB 5GT0A 3AZEA 1P3OB 1P3BA 2J8PA 1TZYB 3MGQC 5AV6B 3MGPA 5GT3D 3X1TA 1M18D 4J8VC 1P3GC 5CPKC 1P3PA 3LZ1D 4J8WC 4H9RA 3AZJA 3W99A 2F8NG 3AZKA 2AROB 3WA9C 1P3AD 2Y2OA 1F66C 5B31B 1HQ3C 5AV9A 3AZHD 1S32C 4CSRA 5B32D 2ZY2A 1U35D 4DRAA 5CPKB 5AVBD 1H3OA 1F1EA 3WTPD 3C1CB 3O62C 4H9NA 2UWXA 1S32B 1P3GD 4J8WD 3UT9D 2YFWA 5BO0B 5CHLB 3A6NA 3X1UA 5F99B 3LJAB 2NQBD 3REIB 3AZGA 3KXBC 3O62B 3AZFD 1P3LB 3AZIC 5AVCD 4G91C 5BS7C 4R8PC 1HTAA 4EO5C 1ID3D 3KXBB 5B31G 4H9QA 2F8NK 1EQZB 3REJD 4KGCB 1BH8B 2HIOD 4Z66B 4YM6D 3MVDA 4WU8C 1BH9B 3LELB 4Z5TC 5DNND 5B2IA 3UTBC 4WJ3C 3W96B 3EG5B 3WAAA 3AFAB 1M19B 4UUZB 5FUGB 1Z2CB 5JA4A 4WU8B 4X23C 1AOIA 3AYWD 3UTBB 1P34C 3KSYA 5B24C 1KX3D 3V9RA 4XZQC 3AN2D 1A7WA 3W98C 4X23B 5B0YD 5B0ZC 4LD9C 3REHD 5GT3A 1M18A 5B24B 5AY8D 3KUYC 5GXQC 3MGSD 1P3MD 3LZ1A 5AV8C 5G49B 4LD9B 3B6GC 1P3AA 3AV2B 4WU9D 5CP6C 3AZHA 1N1JA 5B32A 3REKD 5B33C 1U35A 5AVBA 1P3BB 5B1MD 5AV8B 1P3ID 3WTPA 3B6GB 5CP6B 4ZBJB 5DNMC 4Z2MG 1P3GA 5JRGD 3MGRC 3B0BA 3UT9A 4NE3A 3AZNC 3MNND 3C1BC 3W97D 2NQBA 3AZLD 3W99B 3UTAC 1KX5A 3AZFA 3LZ0C 5E5AC 3MGRB 3AZNB 3H0MC 4CSRB 5AVCA 2BYMA 5KDMA 4WZSB 3A1IA 2XD5A 5GSUD 1ID3A 5B2JD 1H3OB 1P3FC 3UTAB 3X1VD 4QLCC 1P3OD 3REJA 5E5AB 3KFUG 5CPID 2CV5B 2Y2GA 2HIOA 4ZUXC 4YM6A 4KHAA 3X1UB 3A6NB 3WKJD 4J8UD 3LZ0D 1P3FB 4YS3C 5DNNA 3TU4C 3AZGB 1TAFB 3VH6T 1JFIA 5B1LC 2F8NB 5BT1D 1WWSA 4ZUXB 4KUDC 4H9SC 5CPJC 1ZLAC 3AYWA 4YS3B 2JE5A 4E45A 3TU4B 1TZYC 5AV6C 1M1AD 3NQJA 5AV5D 5B1LB 1KX3A 3AN2A 5B0YA 3MVDB 3REHA 2G5HC 5B2IB 3B6FB 5AY8A 2AROC 3MGSA 1P3KC 4JJND 1P3MA 1ZLAD 5B31C 3EPHA 3EPJA 3NQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 B;  1AOI B;  4WU9 A;  2YFV A;  3REK A;  3AV1 D;  2PYO C;  3C1C C;  1P3K B;  3X1S A;  5B1M A;  1P3I A;  3WTP E;  3MGQ D;  5F99 C;  3LJA C;  3REI C;  3W97 A;  5JRG A;  2PYO B;  3MNN A;  4J8V D;  3AZL A;  4XUJ C;  5BNV A;  1P3L C;  1R4V A;  5CPK D;  4J8X C;  1KX4 C;  1P3A B;  3WA9 D;  3C1C D;  1WWI A;  3REL C;  1F66 D;  1HQ3 D;  5B32 B;  1S32 D;  4XUJ B;  5GSU A;  1EQZ C;  4J8X B;  5B2J A;  1KX4 B;  3X1V A;  3AZM C;  4KGC C;  4Z66 C;  3REL B;  3O62 D;  4HGA C;  3LEL C;  5CPI A;  3UT9 B;  1B67 A;  3WKJ A;  2FJ7 C;  4J8U A;  3LZ0 A;  3W96 C;  3AZM B;  3AFA C;  1M19 C;  3KXB D;  1KX5 B;  3AZF B;  4HGA B;  3KWQ C;  1EQZ D;  3AZI D;  5AVC B;  2BYM B;  2FJ7 B;  4WV4 B;  2BYK B;  4R8P D;  5BNX A;  3R45 B;  1ID3 B;  4AWL B;  3LEL D;  5B32 G;  1M1A A;  5AV5 A;  3KWQ B;  4WNN A;  5C3I B;  2HIO B;  4YM6 B;  4WU8 D;  2NZD C;  2CWE A;  5B40 C;  5DNN B;  4Z5T D;  3UTB D;  3AV2 C;  4JJN A;  4G92 B;  1JFI B;  1P3O A;  4CAY A;  4X23 D;  2NZD B;  5GT0 C;  5B40 B;  3AZE C;  1P3B C;  3AV1 A;  1P34 D;  3VH6 A;  3NQJ B;  5B24 D;  4ZBJ C;  1BFM A;  3VH5 A;  3MGP C;  3X1T C;  4XZQ D;  5B0Y B;  3W98 D;  5GT0 B;  5B0Z D;  4DRB A;  3MGQ A;  3REH B;  3AZE B;  4LD9 D;  1P3P C;  3AZJ C;  3W99 C;  2L5A A;  4J8V A;  2HUE B;  3KUY D;  3AZK C;  3MGS B;  5GXQ D;  5CPK A;  3MGP B;  3X1T B;  4J8W A;  5AV9 C;  5AV8 D;  4WU9 B;  3B6G D;  3C1C A;  1F66 A;  3WA9 A;  1P3P B;  3AZJ B;  4H9P A;  4H9R B;  5CP6 D;  1HQ3 A;  2YFV B;  1S32 A;  3AZK B;  5BO0 A;  5B33 D;  3X1S B;  5AV9 B;  1P3I B;  2CV5 C;  3A6N C;  3O62 A;  3X1U C;  5DNM D;  5JRG B;  3AZG C;  3MNN B;  3MGR D;  4H9N B;  3AZN D;  2JSS A;  3C1B D;  3AZL B;  2F8N H;  2YFW B;  3KXB A;  3UTA D;  5E5A D;  3AZI A;  2CV5 D;  5BS7 A;  4R8P A;  1KU5 A;  3VH5 T;  1BH9 A;  5B2J B;  2LY8 A;  3X1V B;  1P3F D;  4QLC D;  3MVD C;  4H9Q B;  3B6F C;  5B2I C;  2F8N D;  4ZUX D;  4J8U B;  4WU8 A;  4Z5T A;  3B0C W;  4YS3 D;  3TU4 D;  3UTB A;  2RVQ C;  1AOI C;  1B6W A;  5B1L D;  4KUD D;  4X23 A;  5CPJ D;  3WAA B;  5BNX B;  1P34 A;  1TZY D;  1M1A B;  5B24 A;  3B6F D;  5AV6 D;  5AV5 B;  5GT3 C;  4XZQ A;  1M18 C;  3W98 A;  5B0Z A;  4LD9 A;  3LZ1 C;  3V9R B;  3KUY A;  1P3A C;  5GXQ A;  2ARO D;  1P3K D;  5GT3 B;  5B31 D;  3AZH C;  1M18 B;  5AV8 A;  5B32 C;  4CAY B;  3B6G A;  1U35 C;  3LZ1 B;  5AVB C;  5CP6 A;  3WTP C;  3AV1 B;  5B33 A;  2PYO D;  3AZH B;  1N1J B;  3UT9 C;  1U35 B;  3MGQ B;  1ULY A;  5AVB B;  2NQB C;  5F99 D;  5DNM A;  3LJA D;  3REI D;  3WTP B;  3MGR A;  3AZN A;  4J8V B;  3C1B A;  1KX5 C;  3AZF C;  4XUJ D;  1P3G B;  1P3L D;  4J8W B;  4J8X D;  5AVC C;  1KX4 D;  3UTA A;  2NQB B;  3WA9 B;  1F66 B;  4H9P B;  3REL D;  5E5A A;  1HQ3 B;  1ID3 C;  4AWL C;  2CV5 A;  3REJ C;  2IO5 C;  4Z2M H;  1P3F A;  5C3I C;  5KDM B;  4QLC A;  2HIO C;  4YM6 C;  3AZM D;  1TAF A;  4Z66 D;  4KGC D;  1KX5 D;  4H9O A;  5DNN C;  2F8N A;  4ZUX A;  3REJ B;  2FJ7 D;  4G92 C;  2IO5 B;  3W96 D;  4YS3 A;  3TU4 A;  3AFA D;  4KHA B;  1M19 D;  3AYW C;  5B1L A;  3KWQ D;  3AZI B;  4KUD A;  4E44 A;  4H9S A;  4G91 B;  5CPJ A;  4R8P B;  1ZLA A;  4EO5 B;  1KX3 C;  3AN2 C;  5B0Y C;  1TZY A;  3B6F A;  5AV6 A;  3REH C;  3AYW B;  5AY8 C;  2HUE C;  1Q9C A;  3MGS C;  1P3M C;  1KX3 B;  3AN2 B;  2NZD D;  5B40 D;  4Z5T B;  4WU9 C;  2ARO A;  3AV2 D;  1P3K A;  5B31 A;  5AY8 B;  3REK C;  1P3M B;  3X1S C;  5GT0 D;  5B1M C;  3NQU B;  3AZE D;  1P3B D;  1P3I C;  1P34 B;  2PYO A;  5JRG C;  4XZQ B;  3REK B;  3X1T D;  3MGP D;  3W97 C;  3MNN C;  3W98 B;  5B0Z B;  3AZL C;  5F99 A;  5B1M B;  3LJA A;  3REI A;  1P3P D;  3AZJ D;  3W99 D;  3KUY B;  4NE6 A;  5GXQ B;  4XUJ A;  3AZK D;  1P3L A;  3W97 B;  3X1S D;  4J8X A;  5AV9 D;  1KX4 A;  5BNV B;  5GSU C;  3REL A;  5B2J C;  3X1V C;  5B33 B;  1EQZ A;  5CPI C;  3VH6 W;  3AZM A;  3A6N D;  1BH8 A;  5GSU B;  3VH5 W;  3X1U D;  4Z66 A;  4J8U C;  5DNM B;  3WKJ C;  4KGC A;  3LEL A;  3B0D C;  3C1B B;  3AZG D;  2FJ7 A;  3W96 A;  2BYK A;  5CPI B;  4NE5 A;  3R45 A;  5BT1 C;  3AFA A;  1M19 A;  4UUZ A;  3WKJ B;  5FUG A;  3LZ0 B;  3WAA C;  4M6B A;  3KWQ A;  3B0D B;  1M1A C;  5AV5 C;  4QLC B;  3MVD D;  4H9O B;  5B2I D;  4JJN C;  4WNN B;  4NFT A;  5B40 A;  1P3O C;  3WAA D;  2NZD A;  5G49 A;  2RVQ D;  3AV2 A;  1AOI D;  3AV1 C;  4KUD B;  5CPJ B;  4JJN B;  3B0C T;  1ZLA B;  5GT0 A;  3AZE A;  1P3O B;  1P3B A;  1TZY B;  3MGQ C;  5AV6 B;  3MGP A;  5GT3 D;  3X1T A;  1M18 D;  4J8V C;  1P3G C;  5CPK C;  1P3P A;  3LZ1 D;  4J8W C;  4H9R A;  3AZJ A;  3W99 A;  2F8N G;  3AZK A;  2ARO B;  3WA9 C;  1P3A D;  1F66 C;  5B31 B;  1HQ3 C;  5AV9 A;  3AZH D;  1S32 C;  4CSR A;  5B32 D;  1U35 D;  4DRA A;  5CPK B;  5AVB D;  1H3O A;  1F1E A;  3WTP D;  3C1C B;  3O62 C;  4H9N A;  1S32 B;  1P3G D;  4J8W D;  3UT9 D;  2YFW A;  5BO0 B;  5CHL B;  3A6N A;  3X1U A;  5F99 B;  3LJA B;  2NQB D;  3REI B;  3AZG A;  3KXB C;  3O62 B;  3AZF D;  1P3L B;  3AZI C;  5AVC D;  4G91 C;  5BS7 C;  4R8P C;  1HTA A;  4EO5 C;  1ID3 D;  3KXB B;  5B31 G;  4H9Q A;  2F8N K;  1EQZ B;  3REJ D;  4KGC B;  1BH8 B;  2HIO D;  4Z66 B;  4YM6 D;  3MVD A;  4WU8 C;  1BH9 B;  3LEL B;  4Z5T C;  5DNN D;  5B2I A;  3UTB C;  3W96 B;  3WAA A;  3AFA B;  1M19 B;  4UUZ B;  5FUG B;  5JA4 A;  4WU8 B;  4X23 C;  1AOI A;  3AYW D;  3UTB B;  1P34 C;  3KSY A;  5B24 C;  1KX3 D;  3V9R A;  4XZQ C;  3AN2 D;  1A7W A;  3W98 C;  4X23 B;  5B0Y D;  5B0Z C;  4LD9 C;  3REH D;  5GT3 A;  1M18 A;  5B24 B;  5AY8 D;  3KUY C;  5GXQ C;  3MGS D;  1P3M D;  3LZ1 A;  5AV8 C;  5G49 B;  4LD9 B;  3B6G C;  1P3A A;  3AV2 B;  4WU9 D;  5CP6 C;  3AZH A;  1N1J A;  5B32 A;  3REK D;  5B33 C;  1U35 A;  5AVB A;  1P3B B;  5B1M D;  5AV8 B;  1P3I D;  3WTP A;  3B6G B;  5CP6 B;  4ZBJ B;  5DNM C;  4Z2M G;  1P3G A;  5JRG D;  3MGR C;  3B0B A;  3UT9 A;  4NE3 A;  3AZN C;  3MNN D;  3C1B C;  3W97 D;  2NQB A;  3AZL D;  3W99 B;  3UTA C;  1KX5 A;  3AZF A;  3LZ0 C;  5E5A C;  3MGR B;  3AZN B;  4CSR B;  5AVC A;  2BYM A;  5KDM A;  4WZS B;  5GSU D;  1ID3 A;  5B2J D;  1H3O B;  1P3F C;  3UTA B;  3X1V D;  4QLC C;  3REJ A;  5E5A B;  5CPI D;  2CV5 B;  3A6N B;  2HIO A;  4ZUX C;  4YM6 A;  4KHA A;  3X1U B;  3WKJ D;  4J8U D;  3LZ0 D;  1P3F B;  4YS3 C;  5DNN A;  3TU4 C;  3AZG B;  1TAF B;  3VH6 T;  1JFI A;  5B1L C;  2F8N B;  5BT1 D;  1WWS A;  4ZUX B;  4KUD C;  4H9S C;  5CPJ C;  1ZLA C;  3AYW A;  4YS3 B;  4E45 A;  3TU4 B;  1TZY C;  5AV6 C;  1M1A D;  3NQJ A;  5AV5 D;  5B1L B;  1KX3 A;  3AN2 A;  5B0Y A;  3MVD B;  3REH A;  3B6F B;  5B2I B;  5AY8 A;  2ARO C;  3MGS A;  1P3K C;  4JJN D;  1P3M A;  1ZLA D;  5B31 C;  1P3O D;  3NQU A; 
#chains in the Genus database with same CATH topology
 5JA4 B;  1AOI B;  4WU9 A;  2YFV A;  3EPL A;  3REK A;  3AV1 D;  2PYO C;  3C1C C;  1P3K B;  3X1S A;  2DF4 C;  5B1M A;  1P3I A;  3WTP E;  3MGQ D;  5F99 C;  3LJA C;  3REI C;  3W97 A;  5JRG A;  2PYO B;  3MNN A;  4J8V D;  3AZL A;  4XUJ C;  5BNV A;  1P3L C;  1R4V A;  5CPK D;  4J8X C;  1KX4 C;  1P3A B;  3WA9 D;  3C1C D;  1WWI A;  3REL C;  1F66 D;  1HQ3 D;  5B32 B;  1S32 D;  2W8S A;  4XUJ B;  2Y2Q A;  5GSU A;  1EQZ C;  4J8X B;  4KGC A;  5B2J A;  1KX4 B;  3X1V A;  3AZM C;  4KGC C;  4Z66 C;  3REL B;  3O62 D;  4HGA C;  3LEL C;  2ZM5 A;  5CPI A;  3UT9 B;  1B67 A;  3WKJ A;  2FJ7 C;  4J8U A;  3LZ0 A;  3W96 C;  3AZM B;  3AFA C;  1M19 C;  3KXB D;  1KX5 B;  3AZF B;  4HGA B;  3KWQ C;  1EQZ D;  3AZI D;  5AVC B;  2BYM B;  2JCH A;  2FJ7 B;  4WV4 B;  2BG1 A;  2BYK B;  4R8P D;  5BNX A;  3R45 B;  1ID3 B;  4AWL B;  3LEL D;  5B32 G;  1M1A A;  3F6T A;  5AV5 A;  3KWQ B;  4WNN A;  5C3I B;  2HIO B;  4YM6 B;  4WU8 D;  2NZD C;  2CWE A;  5B40 C;  2RIQ A;  5DNN B;  4Z5T D;  3UTB D;  3AV2 C;  4JJN A;  4G92 B;  1JFI B;  1P3O A;  4CAY A;  3AL0 C;  4X23 D;  2NZD B;  5GT0 C;  5B40 B;  3AZE C;  1P3B C;  3AV1 A;  1P34 D;  3VH6 A;  3NQJ B;  5B24 D;  4ZBJ C;  1BFM A;  3VH5 A;  3MGP C;  3X1T C;  2Y2J A;  5B0Y B;  4XZQ D;  3W98 D;  5GT0 B;  5B0Z D;  4DRB A;  3MGQ A;  3REH B;  3AZE B;  4LD9 D;  1P3P C;  3AZJ C;  3W99 C;  2Y2L A;  3H0R C;  2L5A A;  4J8V A;  2HUE B;  3KUY D;  3AZK C;  3MGS B;  5GXQ D;  4DQY B;  5CPK A;  3MGP B;  3X1T B;  4J8W A;  5AV9 C;  5AV8 D;  4WU9 B;  3B6G D;  3C1C A;  1F66 A;  3WA9 A;  1P3P B;  3AZJ B;  4H9P A;  4H9R B;  5CP6 D;  1HQ3 A;  2YFV B;  1S32 A;  3AZK B;  5BO0 A;  5B33 D;  3X1S B;  5AV9 B;  1P3I B;  2CV5 C;  3A6N C;  2ZY5 A;  3O62 A;  3X1U C;  5DNM D;  5JRG B;  3AZG C;  3MNN B;  3MGR D;  4H9N B;  3AZN D;  2JSS A;  3C1B D;  3AZL B;  2F8N H;  2VQR A;  2YFW B;  3KXB A;  3UTA D;  4UPK A;  5E5A D;  3AZI A;  2CV5 D;  5BS7 A;  4R8P A;  2F2A C;  1KU5 A;  3VH5 T;  1BH9 A;  5B2J B;  2LY8 A;  3X1V B;  1P3F D;  4QLC D;  3MVD C;  4H9Q B;  3B6F C;  5B2I C;  2F8N D;  4ZUX D;  4J8U B;  4WU8 A;  4Z5T A;  3B0C W;  4YS3 D;  3TU4 D;  3UTB A;  2RVQ C;  1AOI C;  1B6W A;  3IP4 C;  5B1L D;  4KUD D;  2FFF B;  4X23 A;  5CPJ D;  3WAA B;  5BNX B;  1P34 A;  1TZY D;  1M1A B;  5B24 A;  3B6F D;  5AV6 D;  5AV5 B;  5GT3 C;  4XZQ A;  1M18 C;  3W98 A;  5B0Z A;  4LD9 A;  3LZ1 C;  3V9R B;  3KUY A;  1P3A C;  5GXQ A;  2ARO D;  1P3K D;  5GT3 B;  5B31 D;  3AZH C;  1M18 B;  5AV8 A;  5B32 C;  4CAY B;  3B6G A;  1U35 C;  2DQN C;  3LZ1 B;  5AVB C;  5CP6 A;  3WTP C;  3AV1 B;  5B33 A;  2PYO D;  3AZH B;  1N1J B;  3UT9 C;  1U35 B;  3MGQ B;  1ULY A;  5AVB B;  2NQB C;  5F99 D;  5DNM A;  3LJA D;  3REI D;  3WTP B;  3MGR A;  3AZN A;  4J8V B;  3C1B A;  1KX5 C;  3AZF C;  4XUJ D;  1P3G B;  1P3L D;  3A1K A;  4J8W B;  4J8X D;  5AVC C;  1KX4 D;  3UTA A;  2NQB B;  3WA9 B;  1F66 B;  4H9P B;  3REL D;  5E5A A;  1HQ3 B;  1ID3 C;  4AWL C;  2CV5 A;  3REJ C;  2IO5 C;  4Z2M H;  1P3F A;  5C3I C;  5KDM B;  4QLC A;  2HIO C;  4YM6 C;  3AZM D;  1TAF A;  4Z66 D;  4KGC D;  1KX5 D;  4H9O A;  5DNN C;  2F8N A;  4ZUX A;  3REJ B;  3EPK A;  2FJ7 D;  4G92 C;  2IO5 B;  3W96 D;  4YS3 A;  3TU4 A;  1T3U A;  3AFA D;  4KHA B;  1M19 D;  2ZY3 A;  3AYW C;  5B1L A;  3KWQ D;  3AZI B;  4KUD A;  4E44 A;  4H9S A;  4G91 B;  5CPJ A;  4R8P B;  1ZLA A;  4EO5 B;  1KX3 C;  3AN2 C;  5B0Y C;  1TZY A;  3B6F A;  5AV6 A;  3REH C;  3AYW B;  1PZR A;  2ZY4 A;  5AY8 C;  2HUE C;  1Q9C A;  3MGS C;  1P3M C;  1KX3 B;  3AN2 B;  2NZD D;  5B40 D;  4Z5T B;  3P5J B;  2Y2N A;  4WU9 C;  2ARO A;  3AV2 D;  1P3K A;  5B31 A;  5AY8 B;  3REK C;  1P3M B;  3X1S C;  5GT0 D;  5B1M C;  3NQU B;  3AZE D;  1P3B D;  2Y2I A;  1P3I C;  1P34 B;  2PYO A;  5JRG C;  4XZQ B;  3REK B;  3X1T D;  3MGP D;  3W97 C;  3MNN C;  3W98 B;  5B0Z B;  3AZL C;  5F99 A;  5B1M B;  3LJA A;  3REI A;  1P3P D;  3AZJ D;  3W99 D;  3KUY B;  2XD1 A;  4NE6 A;  5GXQ B;  4XUJ A;  3AZK D;  1P3L A;  3W97 B;  3X1S D;  4J8X A;  5AV9 D;  1KX4 A;  5BNV B;  2G5I C;  5GSU C;  3REL A;  5B2J C;  3X1V C;  5B33 B;  1EQZ A;  2Y2K A;  3H0L C;  3VH6 W;  5CPI C;  1W2E A;  3AZM A;  3A6N D;  1BH8 A;  5GSU B;  3VH5 W;  2Y2M A;  3X1U D;  4Z66 A;  5DNM B;  4J8U C;  3WKJ C;  3LEL A;  3B0D C;  3C1B B;  3AZG D;  2FJ7 A;  3W96 A;  2BYK A;  5CPI B;  4NE5 A;  3R45 A;  2Y2P A;  5BT1 C;  3AFA A;  4UUZ A;  1M19 A;  5FUG A;  3WKJ B;  3LZ0 B;  3FDD A;  3WAA C;  2Y2H A;  4M6B A;  3KWQ A;  3B0D B;  1M1A C;  5AV5 C;  4QLC B;  3MVD D;  4H9O B;  5B2I D;  4JJN C;  4WNN B;  4NFT A;  5B40 A;  1P3O C;  3WAA D;  2NZD A;  5G49 A;  2RVQ D;  3AV2 A;  1AOI D;  3AV1 C;  4KUD B;  5CPJ B;  4JJN B;  3B0C T;  1ZLA B;  5GT0 A;  3AZE A;  1P3O B;  1P3B A;  2J8P A;  1TZY B;  3MGQ C;  5AV6 B;  3MGP A;  5GT3 D;  3X1T A;  1M18 D;  4J8V C;  1P3G C;  5CPK C;  1P3P A;  3LZ1 D;  4J8W C;  4H9R A;  3AZJ A;  3W99 A;  2F8N G;  3AZK A;  2ARO B;  3WA9 C;  1P3A D;  2Y2O A;  1F66 C;  5B31 B;  1HQ3 C;  5AV9 A;  3AZH D;  1S32 C;  4CSR A;  5B32 D;  2ZY2 A;  1U35 D;  4DRA A;  5CPK B;  5AVB D;  1H3O A;  1F1E A;  3WTP D;  3C1C B;  3O62 C;  4H9N A;  2UWX A;  1S32 B;  1P3G D;  4J8W D;  3UT9 D;  2YFW A;  5BO0 B;  5CHL B;  3A6N A;  3X1U A;  5F99 B;  3LJA B;  2NQB D;  3REI B;  3AZG A;  3KXB C;  3O62 B;  3AZF D;  1P3L B;  3AZI C;  5AVC D;  4G91 C;  5BS7 C;  4R8P C;  1HTA A;  4EO5 C;  1ID3 D;  3KXB B;  5B31 G;  4H9Q A;  2F8N K;  1EQZ B;  3REJ D;  4KGC B;  1BH8 B;  2HIO D;  4Z66 B;  4YM6 D;  3MVD A;  4WU8 C;  1BH9 B;  3LEL B;  4Z5T C;  5DNN D;  5B2I A;  3UTB C;  4WJ3 C;  3W96 B;  3EG5 B;  3WAA A;  3AFA B;  1M19 B;  4UUZ B;  5FUG B;  1Z2C B;  5JA4 A;  4WU8 B;  4X23 C;  1AOI A;  3AYW D;  3UTB B;  1P34 C;  3KSY A;  5B24 C;  1KX3 D;  3V9R A;  4XZQ C;  3AN2 D;  1A7W A;  3W98 C;  4X23 B;  5B0Y D;  5B0Z C;  4LD9 C;  3REH D;  5GT3 A;  1M18 A;  5B24 B;  5AY8 D;  3KUY C;  5GXQ C;  3MGS D;  1P3M D;  3LZ1 A;  5AV8 C;  5G49 B;  4LD9 B;  3B6G C;  1P3A A;  3AV2 B;  4WU9 D;  5CP6 C;  3AZH A;  1N1J A;  5B32 A;  3REK D;  5B33 C;  1U35 A;  5AVB A;  1P3B B;  5B1M D;  5AV8 B;  1P3I D;  3WTP A;  3B6G B;  5CP6 B;  4ZBJ B;  5DNM C;  4Z2M G;  1P3G A;  5JRG D;  3MGR C;  3B0B A;  3UT9 A;  4NE3 A;  3AZN C;  3MNN D;  3C1B C;  3W97 D;  2NQB A;  3AZL D;  3W99 B;  3UTA C;  1KX5 A;  3AZF A;  3LZ0 C;  5E5A C;  3MGR B;  3AZN B;  3H0M C;  4CSR B;  5AVC A;  2BYM A;  5KDM A;  4WZS B;  3A1I A;  2XD5 A;  5GSU D;  1ID3 A;  5B2J D;  1H3O B;  1P3F C;  3UTA B;  3X1V D;  4QLC C;  1P3O D;  3REJ A;  5E5A B;  3KFU G;  5CPI D;  2CV5 B;  2Y2G A;  2HIO A;  4ZUX C;  4YM6 A;  4KHA A;  3X1U B;  3A6N B;  3WKJ D;  4J8U D;  3LZ0 D;  1P3F B;  4YS3 C;  5DNN A;  3TU4 C;  3AZG B;  1TAF B;  3VH6 T;  1JFI A;  5B1L C;  2F8N B;  5BT1 D;  1WWS A;  4ZUX B;  4KUD C;  4H9S C;  5CPJ C;  1ZLA C;  3AYW A;  4YS3 B;  2JE5 A;  4E45 A;  3TU4 B;  1TZY C;  5AV6 C;  1M1A D;  3NQJ A;  5AV5 D;  5B1L B;  1KX3 A;  3AN2 A;  5B0Y A;  3MVD B;  3REH A;  2G5H C;  5B2I B;  3B6F B;  5AY8 A;  2ARO C;  3MGS A;  1P3K C;  4JJN D;  1P3M A;  1ZLA D;  5B31 C;  3EPH A;  3EPJ A;  3NQU A; 
#chains in the Genus database with same CATH homology
 5JA4 B;  1AOI B;  4WU9 A;  2YFV A;  3EPL A;  3REK A;  3AV1 D;  2PYO C;  3C1C C;  1P3K B;  3X1S A;  2DF4 C;  5B1M A;  1P3I A;  3WTP E;  3MGQ D;  5F99 C;  3LJA C;  3REI C;  3W97 A;  5JRG A;  2PYO B;  3MNN A;  4J8V D;  3AZL A;  4XUJ C;  5BNV A;  1P3L C;  1R4V A;  5CPK D;  4J8X C;  1KX4 C;  1P3A B;  3WA9 D;  3C1C D;  1WWI A;  3REL C;  1F66 D;  1HQ3 D;  5B32 B;  1S32 D;  2W8S A;  4XUJ B;  2Y2Q A;  5GSU A;  1EQZ C;  4J8X B;  4KGC A;  5B2J A;  1KX4 B;  3X1V A;  3AZM C;  4KGC C;  4Z66 C;  3REL B;  3O62 D;  4HGA C;  3LEL C;  2ZM5 A;  5CPI A;  3UT9 B;  1B67 A;  3WKJ A;  2FJ7 C;  4J8U A;  3LZ0 A;  3W96 C;  3AZM B;  3AFA C;  1M19 C;  3KXB D;  1KX5 B;  3AZF B;  4HGA B;  3KWQ C;  1EQZ D;  3AZI D;  5AVC B;  2BYM B;  2JCH A;  2FJ7 B;  4WV4 B;  2BG1 A;  2BYK B;  4R8P D;  5BNX A;  3R45 B;  1ID3 B;  4AWL B;  3LEL D;  5B32 G;  1M1A A;  3F6T A;  5AV5 A;  3KWQ B;  4WNN A;  5C3I B;  2HIO B;  4YM6 B;  4WU8 D;  2NZD C;  2CWE A;  5B40 C;  2RIQ A;  5DNN B;  4Z5T D;  3UTB D;  3AV2 C;  4JJN A;  4G92 B;  1JFI B;  1P3O A;  4CAY A;  3AL0 C;  4X23 D;  2NZD B;  5GT0 C;  5B40 B;  3AZE C;  1P3B C;  3AV1 A;  1P34 D;  3VH6 A;  3NQJ B;  5B24 D;  4ZBJ C;  1BFM A;  3VH5 A;  3MGP C;  3X1T C;  2Y2J A;  5B0Y B;  4XZQ D;  3W98 D;  5GT0 B;  5B0Z D;  4DRB A;  3MGQ A;  3REH B;  3AZE B;  4LD9 D;  1P3P C;  3AZJ C;  3W99 C;  2Y2L A;  3H0R C;  2L5A A;  4J8V A;  2HUE B;  3KUY D;  3AZK C;  3MGS B;  5GXQ D;  4DQY B;  5CPK A;  3MGP B;  3X1T B;  4J8W A;  5AV9 C;  5AV8 D;  4WU9 B;  3B6G D;  3C1C A;  1F66 A;  3WA9 A;  1P3P B;  3AZJ B;  4H9P A;  4H9R B;  5CP6 D;  1HQ3 A;  2YFV B;  1S32 A;  3AZK B;  5BO0 A;  5B33 D;  3X1S B;  5AV9 B;  1P3I B;  2CV5 C;  3A6N C;  2ZY5 A;  3O62 A;  3X1U C;  5DNM D;  5JRG B;  3AZG C;  3MNN B;  3MGR D;  4H9N B;  3AZN D;  2JSS A;  3C1B D;  3AZL B;  2F8N H;  2VQR A;  2YFW B;  3KXB A;  3UTA D;  4UPK A;  5E5A D;  3AZI A;  2CV5 D;  5BS7 A;  4R8P A;  2F2A C;  1KU5 A;  3VH5 T;  1BH9 A;  5B2J B;  2LY8 A;  3X1V B;  1P3F D;  4QLC D;  3MVD C;  4H9Q B;  3B6F C;  5B2I C;  2F8N D;  4ZUX D;  4J8U B;  4WU8 A;  4Z5T A;  3B0C W;  4YS3 D;  3TU4 D;  3UTB A;  2RVQ C;  1AOI C;  1B6W A;  3IP4 C;  5B1L D;  4KUD D;  2FFF B;  4X23 A;  5CPJ D;  3WAA B;  5BNX B;  1P34 A;  1TZY D;  1M1A B;  5B24 A;  3B6F D;  5AV6 D;  5AV5 B;  5GT3 C;  4XZQ A;  1M18 C;  3W98 A;  5B0Z A;  4LD9 A;  3LZ1 C;  3V9R B;  3KUY A;  1P3A C;  5GXQ A;  2ARO D;  1P3K D;  5GT3 B;  5B31 D;  3AZH C;  1M18 B;  5AV8 A;  5B32 C;  4CAY B;  3B6G A;  1U35 C;  2DQN C;  3LZ1 B;  5AVB C;  5CP6 A;  3WTP C;  3AV1 B;  5B33 A;  2PYO D;  3AZH B;  1N1J B;  3UT9 C;  1U35 B;  3MGQ B;  1ULY A;  5AVB B;  2NQB C;  5F99 D;  5DNM A;  3LJA D;  3REI D;  3WTP B;  3MGR A;  3AZN A;  4J8V B;  3C1B A;  1KX5 C;  3AZF C;  4XUJ D;  1P3G B;  1P3L D;  3A1K A;  4J8W B;  4J8X D;  5AVC C;  1KX4 D;  3UTA A;  2NQB B;  3WA9 B;  1F66 B;  4H9P B;  3REL D;  5E5A A;  1HQ3 B;  1ID3 C;  4AWL C;  2CV5 A;  3REJ C;  2IO5 C;  4Z2M H;  1P3F A;  5C3I C;  5KDM B;  4QLC A;  2HIO C;  4YM6 C;  3AZM D;  1TAF A;  4Z66 D;  4KGC D;  1KX5 D;  4H9O A;  5DNN C;  2F8N A;  4ZUX A;  3REJ B;  3EPK A;  2FJ7 D;  4G92 C;  2IO5 B;  3W96 D;  4YS3 A;  3TU4 A;  1T3U A;  3AFA D;  4KHA B;  1M19 D;  2ZY3 A;  3AYW C;  5B1L A;  3KWQ D;  3AZI B;  4KUD A;  4E44 A;  4H9S A;  4G91 B;  5CPJ A;  4R8P B;  1ZLA A;  4EO5 B;  1KX3 C;  3AN2 C;  5B0Y C;  1TZY A;  3B6F A;  5AV6 A;  3REH C;  3AYW B;  1PZR A;  2ZY4 A;  5AY8 C;  2HUE C;  1Q9C A;  3MGS C;  1P3M C;  1KX3 B;  3AN2 B;  2NZD D;  5B40 D;  4Z5T B;  3P5J B;  2Y2N A;  4WU9 C;  2ARO A;  3AV2 D;  1P3K A;  5B31 A;  5AY8 B;  3REK C;  1P3M B;  3X1S C;  5GT0 D;  5B1M C;  3NQU B;  3AZE D;  1P3B D;  2Y2I A;  1P3I C;  1P34 B;  2PYO A;  5JRG C;  4XZQ B;  3REK B;  3X1T D;  3MGP D;  3W97 C;  3MNN C;  3W98 B;  5B0Z B;  3AZL C;  5F99 A;  5B1M B;  3LJA A;  3REI A;  1P3P D;  3AZJ D;  3W99 D;  3KUY B;  2XD1 A;  4NE6 A;  5GXQ B;  4XUJ A;  3AZK D;  1P3L A;  3W97 B;  3X1S D;  4J8X A;  5AV9 D;  1KX4 A;  5BNV B;  2G5I C;  5GSU C;  3REL A;  5B2J C;  3X1V C;  5B33 B;  1EQZ A;  2Y2K A;  3H0L C;  3VH6 W;  5CPI C;  1W2E A;  3AZM A;  3A6N D;  1BH8 A;  5GSU B;  3VH5 W;  2Y2M A;  3X1U D;  4Z66 A;  5DNM B;  4J8U C;  3WKJ C;  3LEL A;  3B0D C;  3C1B B;  3AZG D;  2FJ7 A;  3W96 A;  2BYK A;  5CPI B;  4NE5 A;  3R45 A;  2Y2P A;  5BT1 C;  3AFA A;  4UUZ A;  1M19 A;  5FUG A;  3WKJ B;  3LZ0 B;  3FDD A;  3WAA C;  2Y2H A;  4M6B A;  3KWQ A;  3B0D B;  1M1A C;  5AV5 C;  4QLC B;  3MVD D;  4H9O B;  5B2I D;  4JJN C;  4WNN B;  4NFT A;  5B40 A;  1P3O C;  3WAA D;  2NZD A;  5G49 A;  2RVQ D;  3AV2 A;  1AOI D;  3AV1 C;  4KUD B;  5CPJ B;  4JJN B;  3B0C T;  1ZLA B;  5GT0 A;  3AZE A;  1P3O B;  1P3B A;  2J8P A;  1TZY B;  3MGQ C;  5AV6 B;  3MGP A;  5GT3 D;  3X1T A;  1M18 D;  4J8V C;  1P3G C;  5CPK C;  1P3P A;  3LZ1 D;  4J8W C;  4H9R A;  3AZJ A;  3W99 A;  2F8N G;  3AZK A;  2ARO B;  3WA9 C;  1P3A D;  2Y2O A;  1F66 C;  5B31 B;  1HQ3 C;  5AV9 A;  3AZH D;  1S32 C;  4CSR A;  5B32 D;  2ZY2 A;  1U35 D;  4DRA A;  5CPK B;  5AVB D;  1H3O A;  1F1E A;  3WTP D;  3C1C B;  3O62 C;  4H9N A;  2UWX A;  1S32 B;  1P3G D;  4J8W D;  3UT9 D;  2YFW A;  5BO0 B;  5CHL B;  3A6N A;  3X1U A;  5F99 B;  3LJA B;  2NQB D;  3REI B;  3AZG A;  3KXB C;  3O62 B;  3AZF D;  1P3L B;  3AZI C;  5AVC D;  4G91 C;  5BS7 C;  4R8P C;  1HTA A;  4EO5 C;  1ID3 D;  3KXB B;  5B31 G;  4H9Q A;  2F8N K;  1EQZ B;  3REJ D;  4KGC B;  1BH8 B;  2HIO D;  4Z66 B;  4YM6 D;  3MVD A;  4WU8 C;  1BH9 B;  3LEL B;  4Z5T C;  5DNN D;  5B2I A;  3UTB C;  4WJ3 C;  3W96 B;  3EG5 B;  3WAA A;  3AFA B;  1M19 B;  4UUZ B;  5FUG B;  1Z2C B;  5JA4 A;  4WU8 B;  4X23 C;  1AOI A;  3AYW D;  3UTB B;  1P34 C;  3KSY A;  5B24 C;  1KX3 D;  3V9R A;  4XZQ C;  3AN2 D;  1A7W A;  3W98 C;  4X23 B;  5B0Y D;  5B0Z C;  4LD9 C;  3REH D;  5GT3 A;  1M18 A;  5B24 B;  5AY8 D;  3KUY C;  5GXQ C;  3MGS D;  1P3M D;  3LZ1 A;  5AV8 C;  5G49 B;  4LD9 B;  3B6G C;  1P3A A;  3AV2 B;  4WU9 D;  5CP6 C;  3AZH A;  1N1J A;  5B32 A;  3REK D;  5B33 C;  1U35 A;  5AVB A;  1P3B B;  5B1M D;  5AV8 B;  1P3I D;  3WTP A;  3B6G B;  5CP6 B;  4ZBJ B;  5DNM C;  4Z2M G;  1P3G A;  5JRG D;  3MGR C;  3B0B A;  3UT9 A;  4NE3 A;  3AZN C;  3MNN D;  3C1B C;  3W97 D;  2NQB A;  3AZL D;  3W99 B;  3UTA C;  1KX5 A;  3AZF A;  3LZ0 C;  5E5A C;  3MGR B;  3AZN B;  3H0M C;  4CSR B;  5AVC A;  2BYM A;  5KDM A;  4WZS B;  3A1I A;  2XD5 A;  5GSU D;  1ID3 A;  5B2J D;  1H3O B;  1P3F C;  3UTA B;  3X1V D;  4QLC C;  1P3O D;  3REJ A;  5E5A B;  3KFU G;  5CPI D;  2CV5 B;  2Y2G A;  2HIO A;  4ZUX C;  4YM6 A;  4KHA A;  3X1U B;  3A6N B;  3WKJ D;  4J8U D;  3LZ0 D;  1P3F B;  4YS3 C;  5DNN A;  3TU4 C;  3AZG B;  1TAF B;  3VH6 T;  1JFI A;  5B1L C;  2F8N B;  5BT1 D;  1WWS A;  4ZUX B;  4KUD C;  4H9S C;  5CPJ C;  1ZLA C;  3AYW A;  4YS3 B;  2JE5 A;  4E45 A;  3TU4 B;  1TZY C;  5AV6 C;  1M1A D;  3NQJ A;  5AV5 D;  5B1L B;  1KX3 A;  3AN2 A;  5B0Y A;  3MVD B;  3REH A;  2G5H C;  5B2I B;  3B6F B;  5AY8 A;  2ARO C;  3MGS A;  1P3K C;  4JJN D;  1P3M A;  1ZLA D;  5B31 C;  3EPH A;  3EPJ A;  3NQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...