4XUJA

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
molecule keywords Histone H3.2
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujA00
5B0ZD 1P3FB 4H9QA 4NE3A 3REIA 1KX5D 3O62B 3C1CB 3AV1B 4KGCC 1WWSA 5B33C 4Z66A 3VH5A 1F1EA 5CPJB 4NFTA 3AZHB 3AZLB 3AZHD 3V9RB 1TAFA 3KUYA 3AN2A 4ZUXA 5B24D 4E45A 3VH6T 5AV6B 1BH8B 1KU5A 4EO5B 2CV5B 5GT3D 3WA9A 4J8UB 3AZKC 1M1AA 3RELD 3AZNB 5B2IA 2CWEA 4J8XC 4Z2MH 5FUGB 1P3IA 3AZGD 3RELB 3X1SB 4CSRA 1KX4A 1AOIC 5AVBD 3WAAC 5B24B 3W98C 5CPJC 5AVBC 3UTAB 4H9NB 3REKB 3KSYA 1M18A 5CPJD 2BYKA 1HQ3D 4XUJA 3C1BA 3REJA 3MGRA 4J8XB 1P3KD 4G91B 3AZJD 1P3FD 3MGQD 3LZ0D 3WAAA 4WU9A 2RVQD 5GSUB 2NZDB 3NQJA 3KUYC 5DNMD 5BO0A 3REHA 3MNNB 5CP6D 1P3PA 5B32B 5DNND 1M19C 3LZ1A 4Z5TB 3A6NB 5GT0C 5BNVA 1ZLAB 2YFWA 5AVCD 3AYWD 5E5AC 5DNNB 5B33A 4G92C 3W99B 1P3LB 3WTPB 3X1UD 3MGSA 4KUDC 5GSUD 5B40A 3MNNC 3AZHC 3REKC 3WKJB 3X1SD 1HTAA 3LZ1C 1ID3C 3WKJD 2HUEC 3KWQD 4X23D 4ZBJC 1M1AD 5AV8D 3UTBC 5GXQA 3RELC 1KX3D 5B2ID 4H9RB 3MVDD 5AY8C 4J8XD 3X1VA 1P3MA 5AV6D 1HQ3B 3AZKA 4CAYA 5B1MA 3AZFD 3REKD 1WWIA 3UTAC 2NZDC 3WTPE 5B31B 2F8NB 3W98B 1S32A 5AV9B 5AVBB 5JA4B 1P34D 5DNMB 4JJNB 1M18C 3X1TA 5B0ZB 2NQBB 3B0BA 5AV5A 1P3KA 1Q9CA 3KXBC 3AZMA 3KXBD 4J8UD 4WU8A 4J8VC 5C3IB 4H9OB 2CV5D 3AZMB 3AZJB 1P3KB 2PYOD 5F99A 2RVQC 5DNMA 4UUZB 3REHD 5JA4A 5AV9A 1S32B 1P3OA 2PYOB 1TZYA 4R8PB 1KX5B 3W96C 5E5AB 5B0YB 3AZIC 3B6FA 3W96D 4CAYB 3AZKB 2FJ7A 2HIOC 1P3GC 5BNXB 3AZNC 5BS7C 3LELB 5GXQB 3LZ0C 3AFAA 1EQZB 1N1JA 3X1UC 1S32C 4DRAA 4QLCA 2AROD 1JFIA 5JRGD 5B40B 4QLCB 4X23A 3AZID 5GT0D 1P3PC 2HIOA 1P3GA 1KX3C 3C1CC 3AV1C 1U35C 5AY8D 3AZED 2HIOB 1P3GB 5AV8B 5B1MD 3UT9B 1P3MC 3AZEC 4X23B 5CPKC 3KWQB 5CPIA 3B0CW 5B31G 2F8NG 4J8WA 4KUDD 5B32A 3AZLC 3MGPD 3NQJB 4ZUXC 1M18D 3LELA 5AV5D 3AN2C 4YM6A 3MGRD 5BNXA 1ZLAD 1B67A 5B0YA 4YS3C 3AZJA 3B6FB 1ZLAC 1KX5A 4YS3D 1P3OB 2PYOA 1P3AD 3MGRB 3AZGC 3REJB 5B32C 3VH5W 3UTAA 4JJNA 3B6GD 5F99B 3AN2D 3W97C 4H9OA 1F66C 5B31A 4WU8B 2F8NA 3W97D 4XZQC 1F66D 5B1MB 4XZQD 5B0ZA 4YM6B 1KX4D 4M6BA 1BH8A 3MGSD 4QLCC 4NE5A 3W98A 4KGCD 4ZUXB 3KUYB 5CPJA 4J8WB 3WKJA 4Z66B 5CPIB 5CP6C 3KWQA 4XUJD 3O62C 5CHLB 1P3MB 3UT9A 5AV8A 5DNNC 5B2JD 4H9RA 1P3LA 3W99A 3AZND 3REIB 5B1MC 1P3MD 3LJAC 3AZKD 2YFWB 2FJ7C 1P3BB 5BNVB 4JJNC 3NQUA 1JFIB 4Z5TA 3A6NA 3LZ1B 3AZLD 4WU9C 2F8NH 3MGSB 5JRGC 3MNNA 4H9SA 3WTPA 3REHB 3X1SC 1N1JB 3AFAB 2YFVA 1EQZA 5B2JC 5DNNA 4WZSB 3LZ1D 3W99C 3C1CD 3AV1D 4WV4B 2BYMB 4X23C 5CPKB 2FJ7B 3REIC 1HQ3C 4WU8D 5E5AA 3REID 5B33D 1TZYB 4R8PA 4AWLC 3AV2A 5BO0B 3MGQA 2NZDA 2BYKB 5GSUA 3C1BB 3WAAD 4UUZA 4WU9B 1P3OD 5B24A 5C3IC 1B6WA 1F66A 1P3LC 4XZQA 3UT9C 4J8XA 3RELA 5KDMA 3X1VD 4J8VB 5FUGA 1P3BD 3X1VC 1P3AC 5AV5B 4J8UC 2NQBA 3MGQC 1M18B 3X1TB 5G49A 2PYOC 4Z66C 5AVBA 4Z66D 3X1SA 3V9RA 4LD9D 3AZHA 4H9SC 3WTPC 5B1LC 1P3IB 3KUYD 3UT9D 1P3KC 4LD9C 5B2JA 4KGCB 1HQ3A 4G92B 3AZNA 1P3BC 3X1VB 1M19D 4J8UA 4YS3B 3B6FC 5AVCB 1M1AC 4H9QB 1P3FA 3TU4C 5B2IC 4G91C 4Z5TD 3A6ND 3AZFA 1P3ID 1TAFB 5AV6C 3AZLA 2HUEB 3LJAA 1A7WA 4WU9D 5DNMC 3W97B 5F99C 3C1CA 5B33B 4H9PB 3AV1A 3B6GB 3UTBD 3REJC 5AVCC 1U35A 3KWQC 1ZLAA 2LY8A 3TU4B 3REJD 5E5AD 5AV8C 3KXBA 1H3OA 4WNNB 4HGAC 1P3AA 1M19B 1P3PB 3X1UA 1ID3B 1AOID 1BFMA 4J8WC 3LZ0A 3UTAD 2AROA 5B24C 3MGPC 3WAAB 5GXQC 1TZYD 5AY8A 5GXQD 5GT3A 1TZYC 1KX3A 3WA9D 3W96A 3WA9C 3AZFC 1P3FC 4XUJB 3W96B 4EO5C 3AZGA 4J8VD 4J8WD 4KUDA 3AYWA 2CV5C 4H9NA 3REKA 3AFAD 5B1LB 3W98D 5B40C 3AFAC 3MGSC 4QLCD 5JRGB 5B40D 5B1LD 4CSRB 2AROB 1KX4B 1ULYA 3LELC 5GT0A 3AZMC 1M19A 5B2IB 3C1BD 3AZJC 3AZMD 1M1AB 4HGAB 4YM6C 1H3OB 3WA9B 3KXBB 3AYWC 2CV5A 3MVDA 4Z5TC 3A6NC 5AV6A 5B0ZC 5CPID 3AN2B 5CPKD 4NE6A 5CPIC 4JJND 3B6GA 4H9PA 2AROC 1P34B 3WTPD 2F8NK 3MGPA 1S32D 2IO5B 1AOIB 1ID3D 3WKJC 3VH6W 3W97A 5B31D 5CP6A 1P34A 1P3PD 2F8ND 3O62A 3LJAB 5BT1D 4YM6D 3AZFB 3B6FD 5AV5C 3TU4D 4DRBA 3AV2C 3MVDB 5AVCA 5B0YC 4YS3A 5CP6B 3AV2D 3UTBB 1KX5C 1AOIA 3MGPB 2NZDD 4KGCA 3R45A 5B2JB 2IO5C 5F99D 1P34C 5AV9C 5BT1C 5JRGA 3AZIA 5AV9D 1EQZC 4ZUXD 5G49B 1BH9B 1P3OC 3W99D 3AZEB 4KHAA 3MVDC 5GT3C 3AYWB 5GT0B 4J8VA 4WU8C 5KDMB 3VH5T 4XZQB 4ZBJB 4R8PC 2L5AA 1KX3B 1F66B 4LD9B 5B32D 3VH6A 5B1LA 1EQZD 4LD9A 3B0DB 4KUDB 3MGRC 3LELD 3AZGB 3LZ0B 3X1TD 3C1BC 3MGQB 3X1UB 3X1TC 3AV2B 4E44A 1P3LD 2HIOD 1P3GD 5GT3B 5AY8B 1P3AB 5B32G 4KHAB 4WNNA 4R8PD 3AZEA 1BH9A 5BS7A 2NQBC 3AZIB 5CPKA 2BYMA 3LJAD 3B6GC 1KX4C 3B0CT 3REHC 1P3IC 3B0DC 2YFVB 1R4VA 1ID3A 5GSUC 3R45B 3MNND 5B31C 3O62D 4Z2MG 3UTBA 4AWLB 3NQUB 1U35D 4XUJC 3TU4A 1P3BA 2JSSA 1U35B 2FJ7D 2NQBD 5B0YD
chains in the Genus database with same CATH superfamily
5B0ZD 1P3FB 4H9QA 4NE3A 3REIA 1KX5D 3O62B 3C1CB 3AV1B 3EPJA 4KGCC 1WWSA 2Y2IA 5B33C 4Z66A 3VH5A 1F1EA 5CPJB 4NFTA 3AZHB 3AZLB 3AZHD 3V9RB 1TAFA 3KUYA 3AN2A 4ZUXA 5B24D 4E45A 3VH6T 5AV6B 1BH8B 1KU5A 4EO5B 2CV5B 5GT3D 3WA9A 4J8UB 2Y2QA 3AZKC 1M1AA 3RELD 3AZNB 5B2IA 2CWEA 4J8XC 4Z2MH 5FUGB 1P3IA 3AZGD 3RELB 3X1SB 4CSRA 1KX4A 1AOIC 5AVBD 2F2AC 3WAAC 5B24B 1PZRA 3W98C 1T3UA 5CPJC 5AVBC 3UTAB 4H9NB 3REKB 3KSYA 1M18A 5CPJD 2BYKA 1HQ3D 4XUJA 3C1BA 3REJA 3MGRA 4J8XB 1P3KD 4G91B 3AZJD 1P3FD 2RIQA 3MGQD 3LZ0D 3WAAA 4WU9A 2RVQD 5GSUB 2NZDB 3NQJA 3KUYC 5DNMD 5BO0A 3REHA 3MNNB 5CP6D 1P3PA 5B32B 5DNND 1M19C 3LZ1A 4Z5TB 3A6NB 5GT0C 3EPLA 5BNVA 1ZLAB 2YFWA 5AVCD 3AYWD 5E5AC 5DNNB 5B33A 4G92C 3W99B 1P3LB 3WTPB 3X1UD 3MGSA 4KUDC 5GSUD 5B40A 3MNNC 3AZHC 3REKC 3WKJB 3X1SD 1HTAA 2JE5A 3LZ1C 1ID3C 3WKJD 2HUEC 3KWQD 4X23D 4ZBJC 1M1AD 5AV8D 3UTBC 5GXQA 3RELC 1KX3D 5B2ID 4H9RB 2BG1A 3MVDD 5AY8C 4J8XD 3X1VA 1P3MA 5AV6D 1HQ3B 3AZKA 4CAYA 5B1MA 3AZFD 3REKD 1WWIA 3UTAC 2NZDC 3WTPE 5B31B 2F8NB 3W98B 1S32A 5AV9B 5AVBB 5JA4B 1P34D 5DNMB 2ZY5A 4JJNB 1M18C 3X1TA 5B0ZB 2NQBB 3B0BA 5AV5A 1P3KA 1Q9CA 3KXBC 3AZMA 3KXBD 4J8UD 4WU8A 4J8VC 5C3IB 4H9OB 3H0MC 3AZMB 2CV5D 3AZJB 1P3KB 2PYOD 5F99A 2RVQC 2W8SA 5DNMA 4UUZB 3REHD 5JA4A 5AV9A 1S32B 1P3OA 2PYOB 1TZYA 2XD1A 4R8PB 1KX5B 3W96C 5E5AB 5B0YB 3AZIC 3B6FA 3W96D 4CAYB 2ZM5A 3AZKB 2FJ7A 2HIOC 1P3GC 5BNXB 3AZNC 5BS7C 3LELB 5GXQB 3LZ0C 3AFAA 1EQZB 1N1JA 3X1UC 1S32C 4DRAA 4QLCA 2AROD 1JFIA 5JRGD 5B40B 4QLCB 4X23A 3AZID 5GT0D 1P3PC 2HIOA 1P3GA 1KX3C 3C1CC 3AV1C 1U35C 3P5JB 5AY8D 3AZED 2HIOB 1P3GB 5AV8B 5B1MD 3UT9B 1P3MC 3AZEC 4X23B 5CPKC 3KWQB 5CPIA 3B0CW 5B31G 2F8NG 4J8WA 4KUDD 3H0LC 5B32A 3AZLC 2JCHA 3NQJB 3MGPD 4ZUXC 1M18D 3LELA 5AV5D 3AN2C 4YM6A 3MGRD 5BNXA 1ZLAD 1B67A 5B0YA 4YS3C 3AZJA 3B6FB 1ZLAC 1KX5A 4YS3D 1P3OB 2PYOA 1P3AD 3MGRB 3AZGC 3REJB 5B32C 3VH5W 3UTAA 4JJNA 3B6GD 5F99B 3AN2D 2G5IC 2Y2MA 3W97C 4H9OA 1F66C 5B31A 4WU8B 2F8NA 3W97D 4XZQC 1F66D 5B1MB 4XZQD 3EG5B 5B0ZA 4YM6B 1KX4D 2Y2KA 4M6BA 1BH8A 3MGSD 4QLCC 4NE5A 3W98A 4KGCD 4ZUXB 3KUYB 5CPJA 4J8WB 3FDDA 3WKJA 3EPHA 4Z66B 5CPIB 5CP6C 3KWQA 4XUJD 3O62C 5CHLB 1P3MB 3UT9A 5AV8A 5DNNC 5B2JD 4H9RA 1P3LA 3W99A 3AZND 3REIB 1Z2CB 2Y2LA 5B1MC 1P3MD 3LJAC 3AZKD 2YFWB 2FJ7C 1P3BB 3F6TA 5BNVB 4JJNC 3NQUA 1JFIB 4Z5TA 3A6NA 3LZ1B 3AZLD 4WU9C 2F8NH 2ZY2A 3MGSB 5JRGC 3MNNA 4H9SA 3WTPA 3REHB 3X1SC 1N1JB 3AFAB 2YFVA 1EQZA 5B2JC 3H0RC 5DNNA 2Y2GA 4WZSB 3W99C 3LZ1D 3C1CD 3AV1D 4WV4B 2BYMB 4X23C 5CPKB 2FJ7B 3REIC 1HQ3C 4WU8D 5E5AA 3REID 5B33D 1TZYB 4R8PA 4AWLC 3AV2A 5BO0B 3MGQA 2NZDA 2BYKB 5GSUA 3C1BB 3WAAD 4UUZA 4WU9B 1W2EA 1P3OD 5B24A 5C3IC 1B6WA 1F66A 1P3LC 4XZQA 3UT9C 4J8XA 3RELA 5KDMA 3X1VD 4J8VB 5FUGA 1P3BD 3X1VC 1P3AC 5AV5B 4J8UC 4DQYB 3MGQC 2NQBA 1M18B 3X1TB 5G49A 2PYOC 4Z66C 5AVBA 4Z66D 3X1SA 3V9RA 4LD9D 3AZHA 4H9SC 3WTPC 5B1LC 1P3IB 3KUYD 3UT9D 1P3KC 4LD9C 5B2JA 4KGCB 1HQ3A 4G92B 3A1IA 3AZNA 1P3BC 3X1VB 1M19D 4J8UA 4YS3B 3B6FC 5AVCB 1M1AC 4H9QB 1P3FA 3TU4C 5B2IC 4G91C 4Z5TD 3A6ND 3AZFA 1P3ID 1TAFB 5AV6C 3AZLA 2HUEB 3LJAA 1A7WA 4WU9D 5DNMC 3W97B 5F99C 3C1CA 5B33B 4H9PB 3AV1A 3B6GB 3UTBD 3REJC 5AVCC 1U35A 3KWQC 1ZLAA 2LY8A 3TU4B 3REJD 5E5AD 5AV8C 3KXBA 1H3OA 4WNNB 4HGAC 1P3AA 1M19B 1P3PB 2Y2PA 3X1UA 1ID3B 1AOID 1BFMA 4J8WC 3LZ0A 3UTAD 2AROA 5B24C 3MGPC 3WAAB 5GXQC 1TZYD 5AY8A 5GXQD 5GT3A 1TZYC 2ZY4A 1KX3A 3WA9D 3W96A 3WA9C 3AZFC 3IP4C 1P3FC 4XUJB 3W96B 4EO5C 3AZGA 4J8VD 4J8WD 4KUDA 3AYWA 2CV5C 4H9NA 3REKA 3AFAD 5B1LB 3W98D 3A1KA 5B40C 3AFAC 2FFFB 2Y2OA 3MGSC 4QLCD 5JRGB 5B40D 2DQNC 5B1LD 4CSRB 2AROB 1KX4B 1ULYA 3LELC 5GT0A 3AZMC 1M19A 5B2IB 3C1BD 3AZJC 3AZMD 1M1AB 4HGAB 4YM6C 1H3OB 3WA9B 3KXBB 3AYWC 2CV5A 3MVDA 4Z5TC 3A6NC 5AV6A 5B0ZC 5CPID 3AN2B 5CPKD 4NE6A 5CPIC 4JJND 3B6GA 4H9PA 2AROC 1P34B 3WTPD 2F8NK 3MGPA 1S32D 2IO5B 1AOIB 1ID3D 3WKJC 3VH6W 2DF4C 3W97A 5B31D 5CP6A 1P34A 1P3PD 2F8ND 3O62A 3LJAB 5BT1D 4YM6D 3KFUG 3AZFB 3B6FD 5AV5C 4UPKA 3TU4D 4DRBA 3AV2C 3MVDB 5AVCA 5B0YC 4YS3A 5CP6B 3AV2D 3UTBB 1KX5C 1AOIA 3MGPB 2NZDD 4KGCA 3R45A 5B2JB 2G5HC 2IO5C 5F99D 1P34C 5AV9C 5BT1C 5JRGA 3AZIA 5AV9D 1EQZC 4ZUXD 5G49B 1BH9B 1P3OC 3W99D 3AZEB 4KHAA 2Y2JA 3MVDC 5GT3C 3AYWB 2XD5A 5GT0B 4J8VA 4WU8C 5KDMB 3AL0C 2UWXA 3VH5T 4XZQB 4ZBJB 4R8PC 2L5AA 1KX3B 1F66B 4LD9B 5B32D 2ZY3A 3VH6A 2Y2HA 5B1LA 1EQZD 4LD9A 3B0DB 4KUDB 3EPKA 3MGRC 3LELD 3AZGB 2J8PA 3LZ0B 3X1TD 3C1BC 3MGQB 3X1UB 3X1TC 3AV2B 4E44A 1P3LD 2HIOD 1P3GD 5GT3B 5AY8B 1P3AB 5B32G 4KHAB 4WNNA 4R8PD 3AZEA 2Y2NA 1BH9A 5BS7A 2NQBC 3AZIB 5CPKA 2BYMA 3LJAD 3B6GC 2VQRA 1KX4C 3B0CT 3REHC 1P3IC 3B0DC 2YFVB 1R4VA 1ID3A 4WJ3C 5GSUC 3R45B 3MNND 5B31C 3O62D 4Z2MG 3UTBA 4AWLB 3NQUB 1U35D 4XUJC 3TU4A 1P3BA 2JSSA 1U35B 2FJ7D 2NQBD 5B0YD
chains in the Genus database with same CATH topology
5B0ZD 1P3FB 4H9QA 4NE3A 3REIA 1KX5D 3O62B 3C1CB 3AV1B 3EPJA 4KGCC 1WWSA 2Y2IA 5B33C 4Z66A 3VH5A 1F1EA 5CPJB 4NFTA 3AZHB 3AZLB 3AZHD 3V9RB 1TAFA 3KUYA 3AN2A 4ZUXA 5B24D 4E45A 3VH6T 5AV6B 1BH8B 1KU5A 4EO5B 2CV5B 5GT3D 3WA9A 4J8UB 2Y2QA 3AZKC 1M1AA 3RELD 3AZNB 5B2IA 2CWEA 4J8XC 4Z2MH 5FUGB 1P3IA 3AZGD 3RELB 3X1SB 4CSRA 1KX4A 1AOIC 5AVBD 2F2AC 3WAAC 5B24B 1PZRA 3W98C 1T3UA 5CPJC 5AVBC 3UTAB 4H9NB 3REKB 3KSYA 1M18A 5CPJD 2BYKA 1HQ3D 4XUJA 3C1BA 3REJA 3MGRA 4J8XB 1P3KD 4G91B 3AZJD 1P3FD 2RIQA 3MGQD 3LZ0D 3WAAA 4WU9A 2RVQD 5GSUB 2NZDB 3NQJA 3KUYC 5DNMD 5BO0A 3REHA 3MNNB 5CP6D 1P3PA 5B32B 5DNND 1M19C 3LZ1A 4Z5TB 3A6NB 5GT0C 3EPLA 5BNVA 1ZLAB 2YFWA 5AVCD 3AYWD 5E5AC 5DNNB 5B33A 4G92C 3W99B 1P3LB 3WTPB 3X1UD 3MGSA 4KUDC 5GSUD 5B40A 3MNNC 3AZHC 3REKC 3WKJB 3X1SD 1HTAA 2JE5A 3LZ1C 1ID3C 3WKJD 2HUEC 3KWQD 4X23D 4ZBJC 1M1AD 5AV8D 3UTBC 5GXQA 3RELC 1KX3D 5B2ID 4H9RB 2BG1A 3MVDD 5AY8C 4J8XD 3X1VA 1P3MA 5AV6D 1HQ3B 3AZKA 4CAYA 5B1MA 3AZFD 3REKD 1WWIA 3UTAC 2NZDC 3WTPE 5B31B 2F8NB 3W98B 1S32A 5AV9B 5AVBB 5JA4B 1P34D 5DNMB 2ZY5A 4JJNB 1M18C 3X1TA 5B0ZB 2NQBB 3B0BA 5AV5A 1P3KA 1Q9CA 3KXBC 3AZMA 3KXBD 4J8UD 4WU8A 4J8VC 5C3IB 4H9OB 3H0MC 3AZMB 2CV5D 3AZJB 1P3KB 2PYOD 5F99A 2RVQC 2W8SA 5DNMA 4UUZB 3REHD 5JA4A 5AV9A 1S32B 1P3OA 2PYOB 1TZYA 2XD1A 4R8PB 1KX5B 3W96C 5E5AB 5B0YB 3AZIC 3B6FA 3W96D 4CAYB 2ZM5A 3AZKB 2FJ7A 2HIOC 1P3GC 5BNXB 3AZNC 5BS7C 3LELB 5GXQB 3LZ0C 3AFAA 1EQZB 1N1JA 3X1UC 1S32C 4DRAA 4QLCA 2AROD 1JFIA 5JRGD 5B40B 4QLCB 4X23A 3AZID 5GT0D 1P3PC 2HIOA 1P3GA 1KX3C 3C1CC 3AV1C 1U35C 3P5JB 5AY8D 3AZED 2HIOB 1P3GB 5AV8B 5B1MD 3UT9B 1P3MC 3AZEC 4X23B 5CPKC 3KWQB 5CPIA 3B0CW 5B31G 2F8NG 4J8WA 4KUDD 3H0LC 5B32A 3AZLC 2JCHA 3NQJB 3MGPD 4ZUXC 1M18D 3LELA 5AV5D 3AN2C 4YM6A 3MGRD 5BNXA 1ZLAD 1B67A 5B0YA 4YS3C 3AZJA 3B6FB 1ZLAC 1KX5A 4YS3D 1P3OB 2PYOA 1P3AD 3MGRB 3AZGC 3REJB 5B32C 3VH5W 3UTAA 4JJNA 3B6GD 5F99B 3AN2D 2G5IC 2Y2MA 3W97C 4H9OA 1F66C 5B31A 4WU8B 2F8NA 3W97D 4XZQC 1F66D 5B1MB 4XZQD 3EG5B 5B0ZA 4YM6B 1KX4D 2Y2KA 4M6BA 1BH8A 3MGSD 4QLCC 4NE5A 3W98A 4KGCD 4ZUXB 3KUYB 5CPJA 4J8WB 3FDDA 3WKJA 3EPHA 4Z66B 5CPIB 5CP6C 3KWQA 4XUJD 3O62C 5CHLB 1P3MB 3UT9A 5AV8A 5DNNC 5B2JD 4H9RA 1P3LA 3W99A 3AZND 3REIB 1Z2CB 2Y2LA 5B1MC 1P3MD 3LJAC 3AZKD 2YFWB 2FJ7C 1P3BB 3F6TA 5BNVB 4JJNC 3NQUA 1JFIB 4Z5TA 3A6NA 3LZ1B 3AZLD 4WU9C 2F8NH 2ZY2A 3MGSB 5JRGC 3MNNA 4H9SA 3WTPA 3REHB 3X1SC 1N1JB 3AFAB 2YFVA 1EQZA 5B2JC 3H0RC 5DNNA 2Y2GA 4WZSB 3W99C 3LZ1D 3C1CD 3AV1D 4WV4B 2BYMB 4X23C 5CPKB 2FJ7B 3REIC 1HQ3C 4WU8D 5E5AA 3REID 5B33D 1TZYB 4R8PA 4AWLC 3AV2A 5BO0B 3MGQA 2NZDA 2BYKB 5GSUA 3C1BB 3WAAD 4UUZA 4WU9B 1W2EA 1P3OD 5B24A 5C3IC 1B6WA 1F66A 1P3LC 4XZQA 3UT9C 4J8XA 3RELA 5KDMA 3X1VD 4J8VB 5FUGA 1P3BD 3X1VC 1P3AC 5AV5B 4J8UC 4DQYB 3MGQC 2NQBA 1M18B 3X1TB 5G49A 2PYOC 4Z66C 5AVBA 4Z66D 3X1SA 3V9RA 4LD9D 3AZHA 4H9SC 3WTPC 5B1LC 1P3IB 3KUYD 3UT9D 1P3KC 4LD9C 5B2JA 4KGCB 1HQ3A 4G92B 3A1IA 3AZNA 1P3BC 3X1VB 1M19D 4J8UA 4YS3B 3B6FC 5AVCB 1M1AC 4H9QB 1P3FA 3TU4C 5B2IC 4G91C 4Z5TD 3A6ND 3AZFA 1P3ID 1TAFB 5AV6C 3AZLA 2HUEB 3LJAA 1A7WA 4WU9D 5DNMC 3W97B 5F99C 3C1CA 5B33B 4H9PB 3AV1A 3B6GB 3UTBD 3REJC 5AVCC 1U35A 3KWQC 1ZLAA 2LY8A 3TU4B 3REJD 5E5AD 5AV8C 3KXBA 1H3OA 4WNNB 4HGAC 1P3AA 1M19B 1P3PB 2Y2PA 3X1UA 1ID3B 1AOID 1BFMA 4J8WC 3LZ0A 3UTAD 2AROA 5B24C 3MGPC 3WAAB 5GXQC 1TZYD 5AY8A 5GXQD 5GT3A 1TZYC 2ZY4A 1KX3A 3WA9D 3W96A 3WA9C 3AZFC 3IP4C 1P3FC 4XUJB 3W96B 4EO5C 3AZGA 4J8VD 4J8WD 4KUDA 3AYWA 2CV5C 4H9NA 3REKA 3AFAD 5B1LB 3W98D 3A1KA 5B40C 3AFAC 2FFFB 2Y2OA 3MGSC 4QLCD 5JRGB 5B40D 2DQNC 5B1LD 4CSRB 2AROB 1KX4B 1ULYA 3LELC 5GT0A 3AZMC 1M19A 5B2IB 3C1BD 3AZJC 3AZMD 1M1AB 4HGAB 4YM6C 1H3OB 3WA9B 3KXBB 3AYWC 2CV5A 3MVDA 4Z5TC 3A6NC 5AV6A 5B0ZC 5CPID 3AN2B 5CPKD 4NE6A 5CPIC 4JJND 3B6GA 4H9PA 2AROC 1P34B 3WTPD 2F8NK 3MGPA 1S32D 2IO5B 1AOIB 1ID3D 3WKJC 3VH6W 2DF4C 3W97A 5B31D 5CP6A 1P34A 1P3PD 2F8ND 3O62A 3LJAB 5BT1D 4YM6D 3KFUG 3AZFB 3B6FD 5AV5C 4UPKA 3TU4D 4DRBA 3AV2C 3MVDB 5AVCA 5B0YC 4YS3A 5CP6B 3AV2D 3UTBB 1KX5C 1AOIA 3MGPB 2NZDD 4KGCA 3R45A 5B2JB 2G5HC 2IO5C 5F99D 1P34C 5AV9C 5BT1C 5JRGA 3AZIA 5AV9D 1EQZC 4ZUXD 5G49B 1BH9B 1P3OC 3W99D 3AZEB 4KHAA 2Y2JA 3MVDC 5GT3C 3AYWB 2XD5A 5GT0B 4J8VA 4WU8C 5KDMB 3AL0C 2UWXA 3VH5T 4XZQB 4ZBJB 4R8PC 2L5AA 1KX3B 1F66B 4LD9B 5B32D 2ZY3A 3VH6A 2Y2HA 5B1LA 1EQZD 4LD9A 3B0DB 4KUDB 3EPKA 3MGRC 3LELD 3AZGB 2J8PA 3LZ0B 3X1TD 3C1BC 3MGQB 3X1UB 3X1TC 3AV2B 4E44A 1P3LD 2HIOD 1P3GD 5GT3B 5AY8B 1P3AB 5B32G 4KHAB 4WNNA 4R8PD 3AZEA 2Y2NA 1BH9A 5BS7A 2NQBC 3AZIB 5CPKA 2BYMA 3LJAD 3B6GC 2VQRA 1KX4C 3B0CT 3REHC 1P3IC 3B0DC 2YFVB 1R4VA 1ID3A 4WJ3C 5GSUC 3R45B 3MNND 5B31C 3O62D 4Z2MG 3UTBA 4AWLB 3NQUB 1U35D 4XUJC 3TU4A 1P3BA 2JSSA 1U35B 2FJ7D 2NQBD 5B0YD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z D;  1P3F B;  4H9Q A;  4NE3 A;  3REI A;  1KX5 D;  3O62 B;  3C1C B;  3AV1 B;  4KGC C;  1WWS A;  5B33 C;  4Z66 A;  3VH5 A;  1F1E A;  5CPJ B;  4NFT A;  3AZH B;  3AZL B;  3AZH D;  3V9R B;  1TAF A;  3KUY A;  3AN2 A;  4ZUX A;  5B24 D;  4E45 A;  3VH6 T;  5AV6 B;  1BH8 B;  1KU5 A;  4EO5 B;  2CV5 B;  5GT3 D;  3WA9 A;  4J8U B;  3AZK C;  1M1A A;  3REL D;  3AZN B;  5B2I A;  2CWE A;  4J8X C;  4Z2M H;  5FUG B;  1P3I A;  3AZG D;  3REL B;  3X1S B;  4CSR A;  1KX4 A;  1AOI C;  5AVB D;  3WAA C;  5B24 B;  3W98 C;  5CPJ C;  5AVB C;  3UTA B;  4H9N B;  3REK B;  3KSY A;  1M18 A;  5CPJ D;  2BYK A;  1HQ3 D;  4XUJ A;  3C1B A;  3REJ A;  3MGR A;  4J8X B;  1P3K D;  4G91 B;  3AZJ D;  1P3F D;  3MGQ D;  3LZ0 D;  3WAA A;  4WU9 A;  2RVQ D;  5GSU B;  2NZD B;  3NQJ A;  3KUY C;  5DNM D;  5BO0 A;  3REH A;  3MNN B;  5CP6 D;  1P3P A;  5B32 B;  5DNN D;  1M19 C;  3LZ1 A;  4Z5T B;  3A6N B;  5GT0 C;  5BNV A;  1ZLA B;  2YFW A;  5AVC D;  3AYW D;  5E5A C;  5DNN B;  5B33 A;  4G92 C;  3W99 B;  1P3L B;  3WTP B;  3X1U D;  3MGS A;  4KUD C;  5GSU D;  5B40 A;  3MNN C;  3AZH C;  3REK C;  3WKJ B;  3X1S D;  1HTA A;  3LZ1 C;  1ID3 C;  3WKJ D;  2HUE C;  3KWQ D;  4X23 D;  4ZBJ C;  1M1A D;  5AV8 D;  3UTB C;  5GXQ A;  3REL C;  1KX3 D;  5B2I D;  4H9R B;  3MVD D;  5AY8 C;  4J8X D;  3X1V A;  1P3M A;  5AV6 D;  1HQ3 B;  3AZK A;  4CAY A;  5B1M A;  3AZF D;  3REK D;  1WWI A;  3UTA C;  2NZD C;  3WTP E;  5B31 B;  2F8N B;  3W98 B;  1S32 A;  5AV9 B;  5AVB B;  5JA4 B;  1P34 D;  5DNM B;  4JJN B;  1M18 C;  3X1T A;  5B0Z B;  2NQB B;  3B0B A;  5AV5 A;  1P3K A;  1Q9C A;  3KXB C;  3AZM A;  3KXB D;  4J8U D;  4WU8 A;  4J8V C;  5C3I B;  4H9O B;  2CV5 D;  3AZM B;  3AZJ B;  1P3K B;  2PYO D;  5F99 A;  2RVQ C;  5DNM A;  4UUZ B;  3REH D;  5JA4 A;  5AV9 A;  1S32 B;  1P3O A;  2PYO B;  1TZY A;  4R8P B;  1KX5 B;  3W96 C;  5E5A B;  5B0Y B;  3AZI C;  3B6F A;  3W96 D;  4CAY B;  3AZK B;  2FJ7 A;  2HIO C;  1P3G C;  5BNX B;  3AZN C;  5BS7 C;  3LEL B;  5GXQ B;  3LZ0 C;  3AFA A;  1EQZ B;  1N1J A;  3X1U C;  1S32 C;  4DRA A;  4QLC A;  2ARO D;  1JFI A;  5JRG D;  5B40 B;  4QLC B;  4X23 A;  3AZI D;  5GT0 D;  1P3P C;  2HIO A;  1P3G A;  1KX3 C;  3C1C C;  3AV1 C;  1U35 C;  5AY8 D;  3AZE D;  2HIO B;  1P3G B;  5AV8 B;  5B1M D;  3UT9 B;  1P3M C;  3AZE C;  4X23 B;  5CPK C;  3KWQ B;  5CPI A;  3B0C W;  5B31 G;  2F8N G;  4J8W A;  4KUD D;  5B32 A;  3AZL C;  3MGP D;  3NQJ B;  4ZUX C;  1M18 D;  3LEL A;  5AV5 D;  3AN2 C;  4YM6 A;  3MGR D;  5BNX A;  1ZLA D;  1B67 A;  5B0Y A;  4YS3 C;  3AZJ A;  3B6F B;  1ZLA C;  1KX5 A;  4YS3 D;  1P3O B;  2PYO A;  1P3A D;  3MGR B;  3AZG C;  3REJ B;  5B32 C;  3VH5 W;  3UTA A;  4JJN A;  3B6G D;  5F99 B;  3AN2 D;  3W97 C;  4H9O A;  1F66 C;  5B31 A;  4WU8 B;  2F8N A;  3W97 D;  4XZQ C;  1F66 D;  5B1M B;  4XZQ D;  5B0Z A;  4YM6 B;  1KX4 D;  4M6B A;  1BH8 A;  3MGS D;  4QLC C;  4NE5 A;  3W98 A;  4KGC D;  4ZUX B;  3KUY B;  5CPJ A;  4J8W B;  3WKJ A;  4Z66 B;  5CPI B;  5CP6 C;  3KWQ A;  4XUJ D;  3O62 C;  5CHL B;  1P3M B;  3UT9 A;  5AV8 A;  5DNN C;  5B2J D;  4H9R A;  1P3L A;  3W99 A;  3AZN D;  3REI B;  5B1M C;  1P3M D;  3LJA C;  3AZK D;  2YFW B;  2FJ7 C;  1P3B B;  5BNV B;  4JJN C;  3NQU A;  1JFI B;  4Z5T A;  3A6N A;  3LZ1 B;  3AZL D;  4WU9 C;  2F8N H;  3MGS B;  5JRG C;  3MNN A;  4H9S A;  3WTP A;  3REH B;  3X1S C;  1N1J B;  3AFA B;  2YFV A;  1EQZ A;  5B2J C;  5DNN A;  4WZS B;  3LZ1 D;  3W99 C;  3C1C D;  3AV1 D;  4WV4 B;  2BYM B;  4X23 C;  5CPK B;  2FJ7 B;  3REI C;  1HQ3 C;  4WU8 D;  5E5A A;  3REI D;  5B33 D;  1TZY B;  4R8P A;  4AWL C;  3AV2 A;  5BO0 B;  3MGQ A;  2NZD A;  2BYK B;  5GSU A;  3C1B B;  3WAA D;  4UUZ A;  4WU9 B;  1P3O D;  5B24 A;  5C3I C;  1B6W A;  1F66 A;  1P3L C;  4XZQ A;  3UT9 C;  4J8X A;  3REL A;  5KDM A;  3X1V D;  4J8V B;  5FUG A;  1P3B D;  3X1V C;  1P3A C;  5AV5 B;  4J8U C;  2NQB A;  3MGQ C;  1M18 B;  3X1T B;  5G49 A;  2PYO C;  4Z66 C;  5AVB A;  4Z66 D;  3X1S A;  3V9R A;  4LD9 D;  3AZH A;  4H9S C;  3WTP C;  5B1L C;  1P3I B;  3KUY D;  3UT9 D;  1P3K C;  4LD9 C;  5B2J A;  4KGC B;  1HQ3 A;  4G92 B;  3AZN A;  1P3B C;  3X1V B;  1M19 D;  4J8U A;  4YS3 B;  3B6F C;  5AVC B;  1M1A C;  4H9Q B;  1P3F A;  3TU4 C;  5B2I C;  4G91 C;  4Z5T D;  3A6N D;  3AZF A;  1P3I D;  1TAF B;  5AV6 C;  3AZL A;  2HUE B;  3LJA A;  1A7W A;  4WU9 D;  5DNM C;  3W97 B;  5F99 C;  3C1C A;  5B33 B;  4H9P B;  3AV1 A;  3B6G B;  3UTB D;  3REJ C;  5AVC C;  1U35 A;  3KWQ C;  1ZLA A;  2LY8 A;  3TU4 B;  3REJ D;  5E5A D;  5AV8 C;  3KXB A;  1H3O A;  4WNN B;  4HGA C;  1P3A A;  1M19 B;  1P3P B;  3X1U A;  1ID3 B;  1AOI D;  1BFM A;  4J8W C;  3LZ0 A;  3UTA D;  2ARO A;  5B24 C;  3MGP C;  3WAA B;  5GXQ C;  1TZY D;  5AY8 A;  5GXQ D;  5GT3 A;  1TZY C;  1KX3 A;  3WA9 D;  3W96 A;  3WA9 C;  3AZF C;  1P3F C;  4XUJ B;  3W96 B;  4EO5 C;  3AZG A;  4J8V D;  4J8W D;  4KUD A;  3AYW A;  2CV5 C;  4H9N A;  3REK A;  3AFA D;  5B1L B;  3W98 D;  5B40 C;  3AFA C;  3MGS C;  4QLC D;  5JRG B;  5B40 D;  5B1L D;  4CSR B;  2ARO B;  1KX4 B;  1ULY A;  3LEL C;  5GT0 A;  3AZM C;  1M19 A;  5B2I B;  3C1B D;  3AZJ C;  3AZM D;  1M1A B;  4HGA B;  4YM6 C;  1H3O B;  3WA9 B;  3KXB B;  3AYW C;  2CV5 A;  3MVD A;  4Z5T C;  3A6N C;  5AV6 A;  5B0Z C;  5CPI D;  3AN2 B;  5CPK D;  4NE6 A;  5CPI C;  4JJN D;  3B6G A;  4H9P A;  2ARO C;  1P34 B;  3WTP D;  2F8N K;  3MGP A;  1S32 D;  2IO5 B;  1AOI B;  1ID3 D;  3WKJ C;  3VH6 W;  3W97 A;  5B31 D;  5CP6 A;  1P34 A;  1P3P D;  2F8N D;  3O62 A;  3LJA B;  5BT1 D;  4YM6 D;  3AZF B;  3B6F D;  5AV5 C;  3TU4 D;  4DRB A;  3AV2 C;  3MVD B;  5AVC A;  5B0Y C;  4YS3 A;  5CP6 B;  3AV2 D;  3UTB B;  1KX5 C;  1AOI A;  3MGP B;  2NZD D;  4KGC A;  3R45 A;  5B2J B;  2IO5 C;  5F99 D;  1P34 C;  5AV9 C;  5BT1 C;  5JRG A;  3AZI A;  5AV9 D;  1EQZ C;  4ZUX D;  5G49 B;  1BH9 B;  1P3O C;  3W99 D;  3AZE B;  4KHA A;  3MVD C;  5GT3 C;  3AYW B;  5GT0 B;  4J8V A;  4WU8 C;  5KDM B;  3VH5 T;  4XZQ B;  4ZBJ B;  4R8P C;  2L5A A;  1KX3 B;  1F66 B;  4LD9 B;  5B32 D;  3VH6 A;  5B1L A;  1EQZ D;  4LD9 A;  3B0D B;  4KUD B;  3MGR C;  3LEL D;  3AZG B;  3LZ0 B;  3X1T D;  3C1B C;  3MGQ B;  3X1U B;  3X1T C;  3AV2 B;  4E44 A;  1P3L D;  2HIO D;  1P3G D;  5GT3 B;  5AY8 B;  1P3A B;  5B32 G;  4KHA B;  4WNN A;  4R8P D;  3AZE A;  1BH9 A;  5BS7 A;  2NQB C;  3AZI B;  5CPK A;  2BYM A;  3LJA D;  3B6G C;  1KX4 C;  3B0C T;  3REH C;  1P3I C;  3B0D C;  2YFV B;  1R4V A;  1ID3 A;  5GSU C;  3R45 B;  3MNN D;  5B31 C;  3O62 D;  4Z2M G;  3UTB A;  4AWL B;  3NQU B;  1U35 D;  4XUJ C;  3TU4 A;  1P3B A;  2JSS A;  1U35 B;  2FJ7 D;  2NQB D;  5B0Y D; 
#chains in the Genus database with same CATH topology
 5B0Z D;  1P3F B;  4H9Q A;  4NE3 A;  3REI A;  1KX5 D;  3O62 B;  3C1C B;  3AV1 B;  3EPJ A;  4KGC C;  1WWS A;  2Y2I A;  5B33 C;  4Z66 A;  3VH5 A;  1F1E A;  5CPJ B;  4NFT A;  3AZH B;  3AZL B;  3AZH D;  3V9R B;  1TAF A;  3KUY A;  3AN2 A;  4ZUX A;  5B24 D;  4E45 A;  3VH6 T;  5AV6 B;  1BH8 B;  1KU5 A;  4EO5 B;  2CV5 B;  5GT3 D;  3WA9 A;  4J8U B;  2Y2Q A;  3AZK C;  1M1A A;  3REL D;  3AZN B;  5B2I A;  2CWE A;  4J8X C;  4Z2M H;  5FUG B;  1P3I A;  3AZG D;  3REL B;  3X1S B;  4CSR A;  1KX4 A;  1AOI C;  5AVB D;  2F2A C;  3WAA C;  5B24 B;  1PZR A;  3W98 C;  1T3U A;  5CPJ C;  5AVB C;  3UTA B;  4H9N B;  3REK B;  3KSY A;  1M18 A;  5CPJ D;  2BYK A;  1HQ3 D;  4XUJ A;  3C1B A;  3REJ A;  3MGR A;  4J8X B;  1P3K D;  4G91 B;  3AZJ D;  1P3F D;  2RIQ A;  3MGQ D;  3LZ0 D;  3WAA A;  4WU9 A;  2RVQ D;  5GSU B;  2NZD B;  3NQJ A;  3KUY C;  5DNM D;  5BO0 A;  3REH A;  3MNN B;  5CP6 D;  1P3P A;  5B32 B;  5DNN D;  1M19 C;  3LZ1 A;  4Z5T B;  3A6N B;  5GT0 C;  3EPL A;  5BNV A;  1ZLA B;  2YFW A;  5AVC D;  3AYW D;  5E5A C;  5DNN B;  5B33 A;  4G92 C;  3W99 B;  1P3L B;  3WTP B;  3X1U D;  3MGS A;  4KUD C;  5GSU D;  5B40 A;  3MNN C;  3AZH C;  3REK C;  3WKJ B;  3X1S D;  1HTA A;  2JE5 A;  3LZ1 C;  1ID3 C;  3WKJ D;  2HUE C;  3KWQ D;  4X23 D;  4ZBJ C;  1M1A D;  5AV8 D;  3UTB C;  5GXQ A;  3REL C;  1KX3 D;  5B2I D;  4H9R B;  2BG1 A;  3MVD D;  5AY8 C;  4J8X D;  3X1V A;  1P3M A;  5AV6 D;  1HQ3 B;  3AZK A;  4CAY A;  5B1M A;  3AZF D;  3REK D;  1WWI A;  3UTA C;  2NZD C;  3WTP E;  5B31 B;  2F8N B;  3W98 B;  1S32 A;  5AV9 B;  5AVB B;  5JA4 B;  1P34 D;  5DNM B;  2ZY5 A;  4JJN B;  1M18 C;  3X1T A;  5B0Z B;  2NQB B;  3B0B A;  5AV5 A;  1P3K A;  1Q9C A;  3KXB C;  3AZM A;  3KXB D;  4J8U D;  4WU8 A;  4J8V C;  5C3I B;  4H9O B;  3H0M C;  3AZM B;  2CV5 D;  3AZJ B;  1P3K B;  2PYO D;  5F99 A;  2RVQ C;  2W8S A;  5DNM A;  4UUZ B;  3REH D;  5JA4 A;  5AV9 A;  1S32 B;  1P3O A;  2PYO B;  1TZY A;  2XD1 A;  4R8P B;  1KX5 B;  3W96 C;  5E5A B;  5B0Y B;  3AZI C;  3B6F A;  3W96 D;  4CAY B;  2ZM5 A;  3AZK B;  2FJ7 A;  2HIO C;  1P3G C;  5BNX B;  3AZN C;  5BS7 C;  3LEL B;  5GXQ B;  3LZ0 C;  3AFA A;  1EQZ B;  1N1J A;  3X1U C;  1S32 C;  4DRA A;  4QLC A;  2ARO D;  1JFI A;  5JRG D;  5B40 B;  4QLC B;  4X23 A;  3AZI D;  5GT0 D;  1P3P C;  2HIO A;  1P3G A;  1KX3 C;  3C1C C;  3AV1 C;  1U35 C;  3P5J B;  5AY8 D;  3AZE D;  2HIO B;  1P3G B;  5AV8 B;  5B1M D;  3UT9 B;  1P3M C;  3AZE C;  4X23 B;  5CPK C;  3KWQ B;  5CPI A;  3B0C W;  5B31 G;  2F8N G;  4J8W A;  4KUD D;  3H0L C;  5B32 A;  3AZL C;  2JCH A;  3NQJ B;  3MGP D;  4ZUX C;  1M18 D;  3LEL A;  5AV5 D;  3AN2 C;  4YM6 A;  3MGR D;  5BNX A;  1ZLA D;  1B67 A;  5B0Y A;  4YS3 C;  3AZJ A;  3B6F B;  1ZLA C;  1KX5 A;  4YS3 D;  1P3O B;  2PYO A;  1P3A D;  3MGR B;  3AZG C;  3REJ B;  5B32 C;  3VH5 W;  3UTA A;  4JJN A;  3B6G D;  5F99 B;  3AN2 D;  2G5I C;  2Y2M A;  3W97 C;  4H9O A;  1F66 C;  5B31 A;  4WU8 B;  2F8N A;  3W97 D;  4XZQ C;  1F66 D;  5B1M B;  4XZQ D;  3EG5 B;  5B0Z A;  4YM6 B;  1KX4 D;  2Y2K A;  4M6B A;  1BH8 A;  3MGS D;  4QLC C;  4NE5 A;  3W98 A;  4KGC D;  4ZUX B;  3KUY B;  5CPJ A;  4J8W B;  3FDD A;  3WKJ A;  3EPH A;  4Z66 B;  5CPI B;  5CP6 C;  3KWQ A;  4XUJ D;  3O62 C;  5CHL B;  1P3M B;  3UT9 A;  5AV8 A;  5DNN C;  5B2J D;  4H9R A;  1P3L A;  3W99 A;  3AZN D;  3REI B;  1Z2C B;  2Y2L A;  5B1M C;  1P3M D;  3LJA C;  3AZK D;  2YFW B;  2FJ7 C;  1P3B B;  3F6T A;  5BNV B;  4JJN C;  3NQU A;  1JFI B;  4Z5T A;  3A6N A;  3LZ1 B;  3AZL D;  4WU9 C;  2F8N H;  2ZY2 A;  3MGS B;  5JRG C;  3MNN A;  4H9S A;  3WTP A;  3REH B;  3X1S C;  1N1J B;  3AFA B;  2YFV A;  1EQZ A;  5B2J C;  3H0R C;  5DNN A;  2Y2G A;  4WZS B;  3W99 C;  3LZ1 D;  3C1C D;  3AV1 D;  4WV4 B;  2BYM B;  4X23 C;  5CPK B;  2FJ7 B;  3REI C;  1HQ3 C;  4WU8 D;  5E5A A;  3REI D;  5B33 D;  1TZY B;  4R8P A;  4AWL C;  3AV2 A;  5BO0 B;  3MGQ A;  2NZD A;  2BYK B;  5GSU A;  3C1B B;  3WAA D;  4UUZ A;  4WU9 B;  1W2E A;  1P3O D;  5B24 A;  5C3I C;  1B6W A;  1F66 A;  1P3L C;  4XZQ A;  3UT9 C;  4J8X A;  3REL A;  5KDM A;  3X1V D;  4J8V B;  5FUG A;  1P3B D;  3X1V C;  1P3A C;  5AV5 B;  4J8U C;  4DQY B;  3MGQ C;  2NQB A;  1M18 B;  3X1T B;  5G49 A;  2PYO C;  4Z66 C;  5AVB A;  4Z66 D;  3X1S A;  3V9R A;  4LD9 D;  3AZH A;  4H9S C;  3WTP C;  5B1L C;  1P3I B;  3KUY D;  3UT9 D;  1P3K C;  4LD9 C;  5B2J A;  4KGC B;  1HQ3 A;  4G92 B;  3A1I A;  3AZN A;  1P3B C;  3X1V B;  1M19 D;  4J8U A;  4YS3 B;  3B6F C;  5AVC B;  1M1A C;  4H9Q B;  1P3F A;  3TU4 C;  5B2I C;  4G91 C;  4Z5T D;  3A6N D;  3AZF A;  1P3I D;  1TAF B;  5AV6 C;  3AZL A;  2HUE B;  3LJA A;  1A7W A;  4WU9 D;  5DNM C;  3W97 B;  5F99 C;  3C1C A;  5B33 B;  4H9P B;  3AV1 A;  3B6G B;  3UTB D;  3REJ C;  5AVC C;  1U35 A;  3KWQ C;  1ZLA A;  2LY8 A;  3TU4 B;  3REJ D;  5E5A D;  5AV8 C;  3KXB A;  1H3O A;  4WNN B;  4HGA C;  1P3A A;  1M19 B;  1P3P B;  2Y2P A;  3X1U A;  1ID3 B;  1AOI D;  1BFM A;  4J8W C;  3LZ0 A;  3UTA D;  2ARO A;  5B24 C;  3MGP C;  3WAA B;  5GXQ C;  1TZY D;  5AY8 A;  5GXQ D;  5GT3 A;  1TZY C;  2ZY4 A;  1KX3 A;  3WA9 D;  3W96 A;  3WA9 C;  3AZF C;  3IP4 C;  1P3F C;  4XUJ B;  3W96 B;  4EO5 C;  3AZG A;  4J8V D;  4J8W D;  4KUD A;  3AYW A;  2CV5 C;  4H9N A;  3REK A;  3AFA D;  5B1L B;  3W98 D;  3A1K A;  5B40 C;  3AFA C;  2FFF B;  2Y2O A;  3MGS C;  4QLC D;  5JRG B;  5B40 D;  2DQN C;  5B1L D;  4CSR B;  2ARO B;  1KX4 B;  1ULY A;  3LEL C;  5GT0 A;  3AZM C;  1M19 A;  5B2I B;  3C1B D;  3AZJ C;  3AZM D;  1M1A B;  4HGA B;  4YM6 C;  1H3O B;  3WA9 B;  3KXB B;  3AYW C;  2CV5 A;  3MVD A;  4Z5T C;  3A6N C;  5AV6 A;  5B0Z C;  5CPI D;  3AN2 B;  5CPK D;  4NE6 A;  5CPI C;  4JJN D;  3B6G A;  4H9P A;  2ARO C;  1P34 B;  3WTP D;  2F8N K;  3MGP A;  1S32 D;  2IO5 B;  1AOI B;  1ID3 D;  3WKJ C;  3VH6 W;  2DF4 C;  3W97 A;  5B31 D;  5CP6 A;  1P34 A;  1P3P D;  2F8N D;  3O62 A;  3LJA B;  5BT1 D;  4YM6 D;  3KFU G;  3AZF B;  3B6F D;  5AV5 C;  4UPK A;  3TU4 D;  4DRB A;  3AV2 C;  3MVD B;  5AVC A;  5B0Y C;  4YS3 A;  5CP6 B;  3AV2 D;  3UTB B;  1KX5 C;  1AOI A;  3MGP B;  2NZD D;  4KGC A;  3R45 A;  5B2J B;  2G5H C;  2IO5 C;  5F99 D;  1P34 C;  5AV9 C;  5BT1 C;  5JRG A;  3AZI A;  5AV9 D;  1EQZ C;  4ZUX D;  5G49 B;  1BH9 B;  1P3O C;  3W99 D;  3AZE B;  4KHA A;  2Y2J A;  3MVD C;  5GT3 C;  3AYW B;  2XD5 A;  5GT0 B;  4J8V A;  4WU8 C;  5KDM B;  3AL0 C;  2UWX A;  3VH5 T;  4XZQ B;  4ZBJ B;  4R8P C;  2L5A A;  1KX3 B;  1F66 B;  4LD9 B;  5B32 D;  2ZY3 A;  3VH6 A;  2Y2H A;  5B1L A;  1EQZ D;  4LD9 A;  3B0D B;  4KUD B;  3EPK A;  3MGR C;  3LEL D;  3AZG B;  2J8P A;  3LZ0 B;  3X1T D;  3C1B C;  3MGQ B;  3X1U B;  3X1T C;  3AV2 B;  4E44 A;  1P3L D;  2HIO D;  1P3G D;  5GT3 B;  5AY8 B;  1P3A B;  5B32 G;  4KHA B;  4WNN A;  4R8P D;  3AZE A;  2Y2N A;  1BH9 A;  5BS7 A;  2NQB C;  3AZI B;  5CPK A;  2BYM A;  3LJA D;  3B6G C;  2VQR A;  1KX4 C;  3B0C T;  3REH C;  1P3I C;  3B0D C;  2YFV B;  1R4V A;  1ID3 A;  4WJ3 C;  5GSU C;  3R45 B;  3MNN D;  5B31 C;  3O62 D;  4Z2M G;  3UTB A;  4AWL B;  3NQU B;  1U35 D;  4XUJ C;  3TU4 A;  1P3B A;  2JSS A;  1U35 B;  2FJ7 D;  2NQB D;  5B0Y D; 
#chains in the Genus database with same CATH homology
 5B0Z D;  1P3F B;  4H9Q A;  4NE3 A;  3REI A;  1KX5 D;  3O62 B;  3C1C B;  3AV1 B;  3EPJ A;  4KGC C;  1WWS A;  2Y2I A;  5B33 C;  4Z66 A;  3VH5 A;  1F1E A;  5CPJ B;  4NFT A;  3AZH B;  3AZL B;  3AZH D;  3V9R B;  1TAF A;  3KUY A;  3AN2 A;  4ZUX A;  5B24 D;  4E45 A;  3VH6 T;  5AV6 B;  1BH8 B;  1KU5 A;  4EO5 B;  2CV5 B;  5GT3 D;  3WA9 A;  4J8U B;  2Y2Q A;  3AZK C;  1M1A A;  3REL D;  3AZN B;  5B2I A;  2CWE A;  4J8X C;  4Z2M H;  5FUG B;  1P3I A;  3AZG D;  3REL B;  3X1S B;  4CSR A;  1KX4 A;  1AOI C;  5AVB D;  2F2A C;  3WAA C;  5B24 B;  1PZR A;  3W98 C;  1T3U A;  5CPJ C;  5AVB C;  3UTA B;  4H9N B;  3REK B;  3KSY A;  1M18 A;  5CPJ D;  2BYK A;  1HQ3 D;  4XUJ A;  3C1B A;  3REJ A;  3MGR A;  4J8X B;  1P3K D;  4G91 B;  3AZJ D;  1P3F D;  2RIQ A;  3MGQ D;  3LZ0 D;  3WAA A;  4WU9 A;  2RVQ D;  5GSU B;  2NZD B;  3NQJ A;  3KUY C;  5DNM D;  5BO0 A;  3REH A;  3MNN B;  5CP6 D;  1P3P A;  5B32 B;  5DNN D;  1M19 C;  3LZ1 A;  4Z5T B;  3A6N B;  5GT0 C;  3EPL A;  5BNV A;  1ZLA B;  2YFW A;  5AVC D;  3AYW D;  5E5A C;  5DNN B;  5B33 A;  4G92 C;  3W99 B;  1P3L B;  3WTP B;  3X1U D;  3MGS A;  4KUD C;  5GSU D;  5B40 A;  3MNN C;  3AZH C;  3REK C;  3WKJ B;  3X1S D;  1HTA A;  2JE5 A;  3LZ1 C;  1ID3 C;  3WKJ D;  2HUE C;  3KWQ D;  4X23 D;  4ZBJ C;  1M1A D;  5AV8 D;  3UTB C;  5GXQ A;  3REL C;  1KX3 D;  5B2I D;  4H9R B;  2BG1 A;  3MVD D;  5AY8 C;  4J8X D;  3X1V A;  1P3M A;  5AV6 D;  1HQ3 B;  3AZK A;  4CAY A;  5B1M A;  3AZF D;  3REK D;  1WWI A;  3UTA C;  2NZD C;  3WTP E;  5B31 B;  2F8N B;  3W98 B;  1S32 A;  5AV9 B;  5AVB B;  5JA4 B;  1P34 D;  5DNM B;  2ZY5 A;  4JJN B;  1M18 C;  3X1T A;  5B0Z B;  2NQB B;  3B0B A;  5AV5 A;  1P3K A;  1Q9C A;  3KXB C;  3AZM A;  3KXB D;  4J8U D;  4WU8 A;  4J8V C;  5C3I B;  4H9O B;  3H0M C;  3AZM B;  2CV5 D;  3AZJ B;  1P3K B;  2PYO D;  5F99 A;  2RVQ C;  2W8S A;  5DNM A;  4UUZ B;  3REH D;  5JA4 A;  5AV9 A;  1S32 B;  1P3O A;  2PYO B;  1TZY A;  2XD1 A;  4R8P B;  1KX5 B;  3W96 C;  5E5A B;  5B0Y B;  3AZI C;  3B6F A;  3W96 D;  4CAY B;  2ZM5 A;  3AZK B;  2FJ7 A;  2HIO C;  1P3G C;  5BNX B;  3AZN C;  5BS7 C;  3LEL B;  5GXQ B;  3LZ0 C;  3AFA A;  1EQZ B;  1N1J A;  3X1U C;  1S32 C;  4DRA A;  4QLC A;  2ARO D;  1JFI A;  5JRG D;  5B40 B;  4QLC B;  4X23 A;  3AZI D;  5GT0 D;  1P3P C;  2HIO A;  1P3G A;  1KX3 C;  3C1C C;  3AV1 C;  1U35 C;  3P5J B;  5AY8 D;  3AZE D;  2HIO B;  1P3G B;  5AV8 B;  5B1M D;  3UT9 B;  1P3M C;  3AZE C;  4X23 B;  5CPK C;  3KWQ B;  5CPI A;  3B0C W;  5B31 G;  2F8N G;  4J8W A;  4KUD D;  3H0L C;  5B32 A;  3AZL C;  2JCH A;  3NQJ B;  3MGP D;  4ZUX C;  1M18 D;  3LEL A;  5AV5 D;  3AN2 C;  4YM6 A;  3MGR D;  5BNX A;  1ZLA D;  1B67 A;  5B0Y A;  4YS3 C;  3AZJ A;  3B6F B;  1ZLA C;  1KX5 A;  4YS3 D;  1P3O B;  2PYO A;  1P3A D;  3MGR B;  3AZG C;  3REJ B;  5B32 C;  3VH5 W;  3UTA A;  4JJN A;  3B6G D;  5F99 B;  3AN2 D;  2G5I C;  2Y2M A;  3W97 C;  4H9O A;  1F66 C;  5B31 A;  4WU8 B;  2F8N A;  3W97 D;  4XZQ C;  1F66 D;  5B1M B;  4XZQ D;  3EG5 B;  5B0Z A;  4YM6 B;  1KX4 D;  2Y2K A;  4M6B A;  1BH8 A;  3MGS D;  4QLC C;  4NE5 A;  3W98 A;  4KGC D;  4ZUX B;  3KUY B;  5CPJ A;  4J8W B;  3FDD A;  3WKJ A;  3EPH A;  4Z66 B;  5CPI B;  5CP6 C;  3KWQ A;  4XUJ D;  3O62 C;  5CHL B;  1P3M B;  3UT9 A;  5AV8 A;  5DNN C;  5B2J D;  4H9R A;  1P3L A;  3W99 A;  3AZN D;  3REI B;  1Z2C B;  2Y2L A;  5B1M C;  1P3M D;  3LJA C;  3AZK D;  2YFW B;  2FJ7 C;  1P3B B;  3F6T A;  5BNV B;  4JJN C;  3NQU A;  1JFI B;  4Z5T A;  3A6N A;  3LZ1 B;  3AZL D;  4WU9 C;  2F8N H;  2ZY2 A;  3MGS B;  5JRG C;  3MNN A;  4H9S A;  3WTP A;  3REH B;  3X1S C;  1N1J B;  3AFA B;  2YFV A;  1EQZ A;  5B2J C;  3H0R C;  5DNN A;  2Y2G A;  4WZS B;  3W99 C;  3LZ1 D;  3C1C D;  3AV1 D;  4WV4 B;  2BYM B;  4X23 C;  5CPK B;  2FJ7 B;  3REI C;  1HQ3 C;  4WU8 D;  5E5A A;  3REI D;  5B33 D;  1TZY B;  4R8P A;  4AWL C;  3AV2 A;  5BO0 B;  3MGQ A;  2NZD A;  2BYK B;  5GSU A;  3C1B B;  3WAA D;  4UUZ A;  4WU9 B;  1W2E A;  1P3O D;  5B24 A;  5C3I C;  1B6W A;  1F66 A;  1P3L C;  4XZQ A;  3UT9 C;  4J8X A;  3REL A;  5KDM A;  3X1V D;  4J8V B;  5FUG A;  1P3B D;  3X1V C;  1P3A C;  5AV5 B;  4J8U C;  4DQY B;  3MGQ C;  2NQB A;  1M18 B;  3X1T B;  5G49 A;  2PYO C;  4Z66 C;  5AVB A;  4Z66 D;  3X1S A;  3V9R A;  4LD9 D;  3AZH A;  4H9S C;  3WTP C;  5B1L C;  1P3I B;  3KUY D;  3UT9 D;  1P3K C;  4LD9 C;  5B2J A;  4KGC B;  1HQ3 A;  4G92 B;  3A1I A;  3AZN A;  1P3B C;  3X1V B;  1M19 D;  4J8U A;  4YS3 B;  3B6F C;  5AVC B;  1M1A C;  4H9Q B;  1P3F A;  3TU4 C;  5B2I C;  4G91 C;  4Z5T D;  3A6N D;  3AZF A;  1P3I D;  1TAF B;  5AV6 C;  3AZL A;  2HUE B;  3LJA A;  1A7W A;  4WU9 D;  5DNM C;  3W97 B;  5F99 C;  3C1C A;  5B33 B;  4H9P B;  3AV1 A;  3B6G B;  3UTB D;  3REJ C;  5AVC C;  1U35 A;  3KWQ C;  1ZLA A;  2LY8 A;  3TU4 B;  3REJ D;  5E5A D;  5AV8 C;  3KXB A;  1H3O A;  4WNN B;  4HGA C;  1P3A A;  1M19 B;  1P3P B;  2Y2P A;  3X1U A;  1ID3 B;  1AOI D;  1BFM A;  4J8W C;  3LZ0 A;  3UTA D;  2ARO A;  5B24 C;  3MGP C;  3WAA B;  5GXQ C;  1TZY D;  5AY8 A;  5GXQ D;  5GT3 A;  1TZY C;  2ZY4 A;  1KX3 A;  3WA9 D;  3W96 A;  3WA9 C;  3AZF C;  3IP4 C;  1P3F C;  4XUJ B;  3W96 B;  4EO5 C;  3AZG A;  4J8V D;  4J8W D;  4KUD A;  3AYW A;  2CV5 C;  4H9N A;  3REK A;  3AFA D;  5B1L B;  3W98 D;  3A1K A;  5B40 C;  3AFA C;  2FFF B;  2Y2O A;  3MGS C;  4QLC D;  5JRG B;  5B40 D;  2DQN C;  5B1L D;  4CSR B;  2ARO B;  1KX4 B;  1ULY A;  3LEL C;  5GT0 A;  3AZM C;  1M19 A;  5B2I B;  3C1B D;  3AZJ C;  3AZM D;  1M1A B;  4HGA B;  4YM6 C;  1H3O B;  3WA9 B;  3KXB B;  3AYW C;  2CV5 A;  3MVD A;  4Z5T C;  3A6N C;  5AV6 A;  5B0Z C;  5CPI D;  3AN2 B;  5CPK D;  4NE6 A;  5CPI C;  4JJN D;  3B6G A;  4H9P A;  2ARO C;  1P34 B;  3WTP D;  2F8N K;  3MGP A;  1S32 D;  2IO5 B;  1AOI B;  1ID3 D;  3WKJ C;  3VH6 W;  2DF4 C;  3W97 A;  5B31 D;  5CP6 A;  1P34 A;  1P3P D;  2F8N D;  3O62 A;  3LJA B;  5BT1 D;  4YM6 D;  3KFU G;  3AZF B;  3B6F D;  5AV5 C;  4UPK A;  3TU4 D;  4DRB A;  3AV2 C;  3MVD B;  5AVC A;  5B0Y C;  4YS3 A;  5CP6 B;  3AV2 D;  3UTB B;  1KX5 C;  1AOI A;  3MGP B;  2NZD D;  4KGC A;  3R45 A;  5B2J B;  2G5H C;  2IO5 C;  5F99 D;  1P34 C;  5AV9 C;  5BT1 C;  5JRG A;  3AZI A;  5AV9 D;  1EQZ C;  4ZUX D;  5G49 B;  1BH9 B;  1P3O C;  3W99 D;  3AZE B;  4KHA A;  2Y2J A;  3MVD C;  5GT3 C;  3AYW B;  2XD5 A;  5GT0 B;  4J8V A;  4WU8 C;  5KDM B;  3AL0 C;  2UWX A;  3VH5 T;  4XZQ B;  4ZBJ B;  4R8P C;  2L5A A;  1KX3 B;  1F66 B;  4LD9 B;  5B32 D;  2ZY3 A;  3VH6 A;  2Y2H A;  5B1L A;  1EQZ D;  4LD9 A;  3B0D B;  4KUD B;  3EPK A;  3MGR C;  3LEL D;  3AZG B;  2J8P A;  3LZ0 B;  3X1T D;  3C1B C;  3MGQ B;  3X1U B;  3X1T C;  3AV2 B;  4E44 A;  1P3L D;  2HIO D;  1P3G D;  5GT3 B;  5AY8 B;  1P3A B;  5B32 G;  4KHA B;  4WNN A;  4R8P D;  3AZE A;  2Y2N A;  1BH9 A;  5BS7 A;  2NQB C;  3AZI B;  5CPK A;  2BYM A;  3LJA D;  3B6G C;  2VQR A;  1KX4 C;  3B0C T;  3REH C;  1P3I C;  3B0D C;  2YFV B;  1R4V A;  1ID3 A;  4WJ3 C;  5GSU C;  3R45 B;  3MNN D;  5B31 C;  3O62 D;  4Z2M G;  3UTB A;  4AWL B;  3NQU B;  1U35 D;  4XUJ C;  3TU4 A;  1P3B A;  2JSS A;  1U35 B;  2FJ7 D;  2NQB D;  5B0Y D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...