4XUJA

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujA00
3VH5A 3KUYB 3W98D 1N1JA 4Z2MH 5B1MD 1P3LA 4X23D 3MGQA 3AZIC 5CPJB 5B32G 3AYWC 3C1CD 5B33A 5AV6B 5AVBD 5CPKD 4LD9B 3AZNA 3AZHB 3NQUB 1P3FD 4UUZB 3AZMC 2F8NG 5B1LC 5B2JA 3W97C 1JFIA 4XZQC 4KGCB 4DRBA 3O62C 3LZ0D 3WAAB 4XUJC 3VH6A 4WV4B 5AV5B 3LZ1C 4ZUXB 3AZIA 1M1AA 3KUYD 1S32D 3AYWA 3LELD 1KX3C 3REHC 1P3BC 1U35A 1ZLAA 5CPJD 3V9RB 3X1UC 3C1BD 4NFTA 3W96C 1EQZD 3AZHD 5B2JD 3AZEB 5B0ZB 3WTPE 5B1LA 3MNNB 4XZQA 2CV5B 3MGSC 5BNXA 2YFVA 3LZ1A 4R8PC 3VH5W 4Z5TD 3REJD 3WAAD 3MGRD 3AZMB 5AV5D 3REHA 5B2IA 5B24B 4ZUXD 4J8WD 1P3AD 3WA9D 3KWQA 1ID3A 5CPIC 4E44A 5AVCB 3KSYA 4XUJB 3B6GD 5JA4B 4ZBJC 2BYMA 3WKJC 5DNMC 3AV2A 3AZED 3AV1B 1M19B 3MNND 3X1VA 2BYKA 4R8PA 3A6NB 1BFMA 5GXQC 5AV8C 1P3KC 5B32B 4J8XC 2HIOC 5GT3A 5B0YC 3AZLC 2AROC 1TZYC 5B31A 1KX4B 4KUDB 1AOIA 4KHAA 3REKA 5DNNC 1BH8B 3AZFC 3AFAB 5FUGB 3X1TB 4YM6D 3WTPC 4QLCB 2F8NB 5F99C 1P3PC 3B6FA 2JSSA 5DNMA 5KDMB 2YFWB 1TAFA 5JRGB 1P3OA 5G49B 5AY8B 1HQ3C 5GSUC 4J8UD 5B1MC 5CPIB 1P3GD 3AV1D 2PYOC 5B0YA 1KX5C 2AROA 1TZYA 3A6ND 3MVDA 2NQBD 2NZDA 3LJAB 3MGPA 1P3FC 3AZFA 1KX4D 4KUDD 3KXBA 4WU9A 4Z66B 3AFAD 5AV8B 3NQJA 4G91C 4QLCD 2F8ND 3W98A 3MGQC 4J8VB 3AZKD 4NE5A 4X23A 3R45B 5B33C 5AV9D 1P34D 4NE6A 3C1CA 3LELC 3AZNC 5AVBA 5CPKA 1P3PB 4WNNB 4HGAC 3C1BC 3AN2B 4H9RA 3VH6T 1P3FA 1F66D 5BO0A 1H3OA 5GT0B 1EQZC 5B2JC 1BH9B 4JJNB 2FJ7B 1ID3D 4WU8D 3UT9D 5BT1D 2PYOB 4Z66D 4H9PA 5CP6D 3LZ0A 1M18D 1M1AC 2IO5C 4Z5TC 3KUYA 1S32A 3UTAB 3X1SB 3LELA 1U35C 1ZLAC 3AZJB 3UTBD 4J8WC 4CAYB 1P3MD 5B40B 1P3AC 5CPJA 3C1BA 1N1JB 4G91B 2HUEB 3AZGB 1P3LB 3REIB 4H9OB 3MGQB 1EQZA 3AZHA 1P3IB 3B6GC 5E5AB 3RELD 3W99D 5B33B 1F1EA 3TU4D 4JJND 3AZNB 4YS3B 2RVQD 4Z5TA 3REJA 5B2IC 3WAAA 3MGRA 3KWQC 5AV5A 4J8WA 4ZUXA 1P3AA 5AV6D 3WA9A 3UTAD 3X1SD 4LD9D 5B40D 1KU5A 4YM6C 3AZIB 1M1AB 3B6GA 3AYWB 3AV2C 3AZGD 3REID 4H9QB 1ULYA 3AZEA 1U35B 1P3ID 5E5AD 3X1VC 4AWLC 4KGCD 3MNNA 5C3IC 4J8UC 4YS3D 1P3GC 5GT3C 5B31C 5B1LB 1AOIC 3W97B 4NE3A 3REKC 4XZQB 4CSRB 3O62B 4EO5C 5BNXB 5B24A 2YFVB 3LZ1B 3B6FC 4YM6A 2F8NH 5B0ZD 1KX3B 3REHB 3B0CT 1P3OC 3KWQB 1P3BB 4WZSB 3X1UB 2CV5D 3W96B 4J8UA 3VH6W 3AZKC 1P3GA 3AV1A 3MVDC 5AV9C 2LY8A 1P34C 2BYMB 3A6NA 3AZMD 3AV2B 2NZDC 4M6BA 3MGPC 5B24D 2NQBA 3MGSB 3W97D 1KX4A 3KXBC 1F66C 4KUDA 4R8PB 4WU9C 5AVCD 3O62D 4XUJD 1BH8A 3AFAA 4WU8C 5B31B 3UT9C 3W98C 1AOIB 4QLCA 2F8NA 1KX3D 4X23C 1M19D 1M18C 4H9NA 3AZKA 1P3BD 3X1UD 5JRGA 3C1CC 3W96D 3B6FB 5AV9A 4ZBJB 5AVBC 5CPKC 1P34A 5B32D 3WKJB 5DNMB 1F66A 5GXQB 4Z2MG 3X1TD 1P3KB 3MGSD 4J8XB 2HIOB 5B0YB 4WU8A 3RELC 2AROB 1TZYB 3W99C 4H9SA 2CWEA 3MVDB 3UT9A 3LZ0C 3TU4C 4Z66A 5DNNB 5CP6A 3MGPB 5JRGD 3AZFB 1M18A 5AY8D 3KUYC 1S32C 3WTPB 3AZLB 5CPID 5F99B 5BNVB 5CPJC 3UTBA 1P3MA 3R45A 5AV6C 1HQ3B 3WKJD 4LD9C 3LJAD 5GSUB 3AZHC 5B1MB 4WNNA 3AN2A 1KX5B 3RELA 3W99A 5GXQD 5AV8D 1P3KD 4J8XD 3TU4A 4JJNA 1WWIA 4H9RB 3AZLD 1P3FB 4KGCC 5BO0B 1H3OB 3WAAC 4J8VD 3REJC 3MGRC 5AV5C 5DNND 4ZUXC 3WA9C 1A7WA 3WTPD 5AV6A 3B0CW 1P3PD 4H9PB 3UTAA 3X1SA 4LD9A 3AN2D 3NQUA 4CAYA 5B40A 4UUZA 5GT0D 1HQ3D 1S32B 5B31G 3AZGA 5GSUD 3AZEC 3LELB 5B0ZC 3REIA 2FJ7D 4H9OA 4E45A 3MNNC 1P3IA 1Q9CA 1B6WA 5E5AA 4HGAB 3C1BB 2PYOD 2CV5C 1KX5D 4KGCA 1EQZB 4YS3A 5B2JB 1JFIB 4G92C 3AZJD 5B24C 3V9RA 3B0BA 2IO5B 5CHLB 1P3LD 4Z5TB 5AVCC 3REJB 3MGQD 3MGRB 1ZLAB 5B0ZA 4J8WB 1P3AB 5B33D 3WA9B 2CV5A 3AZND 3AV1C 1M19C 4H9QA 3B6GB 3A6NC 2NQBC 5B32C 3AZMA 1KX4C 4KUDC 3W97A 3AFAC 5AVCA 4CSRA 5B2IB 3O62A 4XUJA 3X1TC 3AZID 1M1AD 5JA4A 3AYWD 4QLCC 3B0DC 1ZLAD 1U35D 4G92B 1KX3A 5JRGC 1M19A 5AY8C 5BS7C 1P3BA 4YM6B 3X1UA 3AZJA 3W96A 1B67A 5B32A 5B1LD 4XZQD 4AWLB 2BYKB 3X1VB 5C3IB 3LJAC 4J8UB 1P3GB 5GT3B 3LZ1D 5FUGA 3X1TA 1ID3C 3MGSA 4H9SC 5BT1C 4KHAB 3REKB 4Z66C 4DRAA 5CP6C 5B2ID 3REHD 2NQBB 5KDMA 3KWQD 2YFWA 4EO5B 5G49A 5AY8A 5BS7A 4J8VC 5CPIA 3UTBC 1P3MC 1TAFB 1P3OB 3AV2D 3B0DB 3WKJA 3LJAA 3AN2C 4H9NB 3AZKB 3X1VD 4R8PD 5GT0C 5AV9B 1P34B 4JJNC 2NZDB 5GXQA 2FJ7C 5GT3D 5AV8A 5B31D 4J8XA 1P3KA 2HIOA 1AOID 3AZLA 2F8NK 2RVQC 3KXBB 3REKD 1F66B 3VH5T 4J8VA 4WU9B 2L5AA 5DNNA 1HTAA 3NQJB 1ID3B 4WU8B 3B6FD 3UT9B 3WTPA 3UTAC 3X1SC 5DNMD 3W98B 3AZJC 5F99A 5BNVA 1P3PA 5B40C 5CP6B 4X23B 1P3OD 1M18B 3AZGC 2HUEC 3C1CB 1P3LC 5GT0A 3REIC 1HQ3A 1R4VA 5AVBB 5CPKB 5GSUA 2HIOD 1BH9A 5B1MA 5E5AC 1P3IC 3UTBB 1WWSA 1P3MB 5B0YD 2FJ7A 2AROD 1TZYD 3MVDD 2PYOA 1KX5A 4YS3C 2NZDD 3MGPD 3AZFD 3KXBD 5F99D 3RELB 4WU9D 3W99B 3LZ0B 3TU4B
chains in the Genus database with same CATH superfamily
2Y2JA 3VH5A 3KUYB 3W98D 1N1JA 4Z2MH 5B1MD 1P3LA 4X23D 3MGQA 3AZIC 5CPJB 5B32G 3AYWC 3C1CD 5B33A 5AV6B 5AVBD 5CPKD 4LD9B 3AZNA 3AZHB 3NQUB 1P3FD 4UUZB 3AZMC 2Y2GA 2F8NG 5B1LC 5B2JA 3W97C 1JFIA 4XZQC 4KGCB 4DRBA 3O62C 3LZ0D 3WAAB 4XUJC 3VH6A 4WV4B 5AV5B 3LZ1C 4ZUXB 3AZIA 1M1AA 3KUYD 1S32D 3AYWA 3LELD 1KX3C 3REHC 1P3BC 1U35A 1ZLAA 2ZY2A 3V9RB 5CPJD 3X1UC 3C1BD 4NFTA 3W96C 1EQZD 3AZHD 5B2JD 3AZEB 5B0ZB 3WTPE 5B1LA 3MNNB 4XZQA 2CV5B 3MGSC 5BNXA 2YFVA 3LZ1A 4R8PC 3VH5W 4Z5TD 3REJD 3WAAD 3MGRD 3AZMB 5AV5D 3REHA 5B2IA 5B24B 4ZUXD 4J8WD 1P3AD 3WA9D 3KWQA 1ID3A 5CPIC 3KFUG 2Y2PA 4E44A 5AVCB 2VQRA 3KSYA 4XUJB 3B6GD 5JA4B 4ZBJC 2BYMA 3WKJC 5DNMC 3AV2A 3AZED 3EPLA 3AV1B 1M19B 3EPJA 3MNND 1T3UA 2BYKA 4R8PA 3X1VA 3A6NB 1BFMA 5GXQC 5AV8C 1P3KC 5B32B 4J8XC 2HIOC 5GT3A 5B0YC 3AZLC 2AROC 1TZYC 5B31A 1KX4B 4KUDB 1AOIA 4KHAA 3REKA 5DNNC 1BH8B 3AZFC 3AFAB 5FUGB 3X1TB 4YM6D 3WTPC 4QLCB 2F8NB 5F99C 1P3PC 3B6FA 2JSSA 5DNMA 5KDMB 2YFWB 1TAFA 5JRGB 1P3OA 5G49B 5AY8B 1HQ3C 5GSUC 4J8UD 5B1MC 5CPIB 1P3GD 3AV1D 2PYOC 5B0YA 2J8PA 1KX5C 2AROA 1TZYA 3A6ND 3MVDA 2NQBD 2UWXA 2NZDA 3LJAB 3MGPA 1P3FC 3AZFA 1KX4D 4KUDD 2JE5A 3KXBA 2FFFB 4WU9A 4Z66B 3AFAD 5AV8B 3NQJA 4G91C 4QLCD 2F8ND 3W98A 3MGQC 4J8VB 3AZKD 4NE5A 4X23A 3R45B 5B33C 5AV9D 1P34D 4NE6A 3C1CA 3LELC 3AZNC 5AVBA 5CPKA 1P3PB 2Y2MA 4WNNB 2Y2OA 3FDDA 4HGAC 3C1BC 3AN2B 4H9RA 3VH6T 1P3FA 1F66D 5BO0A 1H3OA 5GT0B 1EQZC 5B2JC 1BH9B 4JJNB 2FJ7B 1ID3D 4WU8D 3UT9D 5BT1D 2PYOB 4Z66D 4H9PA 5CP6D 3LZ0A 1M18D 1M1AC 2IO5C 2W8SA 2JCHA 4Z5TC 3KUYA 1S32A 3F6TA 3UTAB 3X1SB 3LELA 1U35C 1ZLAC 3AZJB 3UTBD 4J8WC 4CAYB 1P3MD 5B40B 1P3AC 5CPJA 3C1BA 1N1JB 3H0LC 2HUEB 4G91B 3AZGB 1P3LB 3REIB 4H9OB 3MGQB 1EQZA 3AZHA 1P3IB 3B6GC 5E5AB 3RELD 3W99D 5B33B 1F1EA 3TU4D 4JJND 3AZNB 4YS3B 2RVQD 4Z5TA 3REJA 5B2IC 3WAAA 3MGRA 3KWQC 2Y2LA 5AV5A 4J8WA 4ZUXA 1P3AA 5AV6D 3WA9A 3UTAD 3X1SD 4LD9D 5B40D 1KU5A 4YM6C 3AZIB 1M1AB 3B6GA 3AYWB 3AV2C 3AZGD 3REID 4H9QB 1ULYA 3AZEA 1U35B 1P3ID 5E5AD 3EG5B 3X1VC 4AWLC 4KGCD 3MNNA 5C3IC 4J8UC 4YS3D 1P3GC 5GT3C 5B31C 2XD5A 5B1LB 1AOIC 3W97B 4NE3A 3REKC 4XZQB 4CSRB 3O62B 4EO5C 5BNXB 5B24A 2YFVB 3LZ1B 3B6FC 4YM6A 2F8NH 3IP4C 5B0ZD 1KX3B 4WJ3C 3REHB 3B0CT 1P3OC 3KWQB 1P3BB 4WZSB 3X1UB 2CV5D 3W96B 4J8UA 3VH6W 3AZKC 1P3GA 3AV1A 3A1IA 3MVDC 5AV9C 2LY8A 1P34C 2BYMB 3A6NA 3AZMD 3AV2B 2NZDC 4M6BA 3MGPC 5B24D 2NQBA 2XD1A 3MGSB 3W97D 1KX4A 3KXBC 1F66C 4KUDA 4R8PB 1W2EA 4UPKA 4WU9C 5AVCD 3O62D 4XUJD 1BH8A 3AFAA 4WU8C 5B31B 3UT9C 3EPHA 3W98C 1AOIB 4QLCA 2F8NA 1KX3D 4X23C 1M19D 1M18C 4H9NA 3AZKA 2DQNC 1P3BD 3X1UD 5JRGA 3C1CC 3W96D 3B6FB 5AV9A 4ZBJB 5AVBC 5CPKC 1P34A 5B32D 3WKJB 5DNMB 3H0RC 2RIQA 1F66A 5GXQB 4Z2MG 3X1TD 1P3KB 3MGSD 4J8XB 2HIOB 5B0YB 4WU8A 3RELC 2AROB 1TZYB 3W99C 4H9SA 2CWEA 3MVDB 3UT9A 3LZ0C 3TU4C 4Z66A 5DNNB 5CP6A 3MGPB 5JRGD 3AZFB 1M18A 5AY8D 3KUYC 1S32C 3WTPB 3AZLB 5CPID 5F99B 5BNVB 5CPJC 3UTBA 1P3MA 3R45A 5AV6C 1HQ3B 3WKJD 4LD9C 3LJAD 5GSUB 3AZHC 5B1MB 4WNNA 2ZY3A 2F2AC 3AN2A 1KX5B 3RELA 3W99A 5GXQD 5AV8D 1P3KD 4J8XD 3TU4A 4JJNA 1WWIA 4H9RB 3AZLD 1P3FB 4KGCC 5BO0B 1H3OB 3WAAC 4J8VD 3REJC 3MGRC 5AV5C 5DNND 4ZUXC 3WA9C 1A7WA 3WTPD 2ZY5A 5AV6A 3B0CW 1P3PD 4H9PB 3UTAA 3X1SA 4LD9A 3AN2D 3NQUA 4CAYA 5B40A 4UUZA 5GT0D 1HQ3D 1S32B 5B31G 3AZGA 5GSUD 3AZEC 3LELB 5B0ZC 3REIA 2FJ7D 4H9OA 4E45A 3MNNC 1P3IA 1B6WA 1Q9CA 5E5AA 4HGAB 3C1BB 2PYOD 2G5IC 2CV5C 1KX5D 4KGCA 1EQZB 4YS3A 5B2JB 2BG1A 1JFIB 4G92C 3AZJD 5B24C 2ZM5A 2G5HC 3V9RA 2ZY4A 3B0BA 2IO5B 5CHLB 1P3LD 4Z5TB 5AVCC 3REJB 2Y2IA 3MGQD 3MGRB 1ZLAB 5B0ZA 4J8WB 1P3AB 5B33D 3WA9B 2CV5A 3AZND 3AV1C 1M19C 4H9QA 3B6GB 3A6NC 2NQBC 5B32C 3AZMA 1KX4C 4KUDC 3W97A 3AFAC 5AVCA 4CSRA 5B2IB 3O62A 4XUJA 3EPKA 3X1TC 3AZID 1M1AD 5JA4A 3AYWD 4QLCC 3B0DC 1ZLAD 1U35D 4G92B 1KX3A 5JRGC 1M19A 5AY8C 5BS7C 1P3BA 4YM6B 3X1UA 3AZJA 3W96A 1B67A 5B32A 5B1LD 4XZQD 4AWLB 2BYKB 3X1VB 5C3IB 3LJAC 4J8UB 1P3GB 5GT3B 3LZ1D 5FUGA 3X1TA 1ID3C 3MGSA 3AL0C 4H9SC 5BT1C 4KHAB 3REKB 4Z66C 4DRAA 5CP6C 5B2ID 3REHD 2NQBB 5KDMA 4DQYB 3KWQD 2YFWA 4EO5B 5G49A 5AY8A 5BS7A 4J8VC 5CPIA 3UTBC 1P3MC 1TAFB 1P3OB 2Y2QA 3AV2D 3B0DB 3WKJA 3LJAA 3AN2C 4H9NB 1PZRA 3AZKB 3X1VD 4R8PD 5GT0C 5AV9B 1P34B 4JJNC 2Y2KA 2NZDB 5GXQA 2FJ7C 5GT3D 5AV8A 5B31D 4J8XA 1P3KA 2HIOA 1AOID 3AZLA 2F8NK 2RVQC 3H0MC 3KXBB 3REKD 1F66B 3VH5T 4J8VA 4WU9B 2L5AA 5DNNA 1HTAA 3NQJB 1ID3B 4WU8B 3B6FD 3UT9B 2Y2NA 3WTPA 3UTAC 3X1SC 5DNMD 3W98B 3AZJC 5F99A 5BNVA 1P3PA 5B40C 5CP6B 4X23B 1P3OD 1M18B 3AZGC 2HUEC 3C1CB 1P3LC 5GT0A 3REIC 1HQ3A 1R4VA 5AVBB 5CPKB 5GSUA 2HIOD 1BH9A 3P5JB 5B1MA 5E5AC 3UTBB 1WWSA 1P3IC 5B0YD 2DF4C 1P3MB 2AROD 1TZYD 3MVDD 2FJ7A 2Y2HA 2PYOA 1KX5A 4YS3C 2NZDD 3MGPD 3AZFD 1Z2CB 3A1KA 3KXBD 5F99D 3RELB 4WU9D 3W99B 3LZ0B 3TU4B
chains in the Genus database with same CATH topology
2Y2JA 3VH5A 3KUYB 3W98D 1N1JA 4Z2MH 5B1MD 1P3LA 4X23D 3MGQA 3AZIC 5CPJB 5B32G 3AYWC 3C1CD 5B33A 5AV6B 5AVBD 5CPKD 4LD9B 3AZNA 3AZHB 3NQUB 1P3FD 4UUZB 3AZMC 2Y2GA 2F8NG 5B1LC 5B2JA 3W97C 1JFIA 4XZQC 4KGCB 4DRBA 3O62C 3LZ0D 3WAAB 4XUJC 3VH6A 4WV4B 5AV5B 3LZ1C 4ZUXB 3AZIA 1M1AA 3KUYD 1S32D 3AYWA 3LELD 1KX3C 3REHC 1P3BC 1U35A 1ZLAA 2ZY2A 3V9RB 5CPJD 3X1UC 3C1BD 4NFTA 3W96C 1EQZD 3AZHD 5B2JD 3AZEB 5B0ZB 3WTPE 5B1LA 3MNNB 4XZQA 2CV5B 3MGSC 5BNXA 2YFVA 3LZ1A 4R8PC 3VH5W 4Z5TD 3REJD 3WAAD 3MGRD 3AZMB 5AV5D 3REHA 5B2IA 5B24B 4ZUXD 4J8WD 1P3AD 3WA9D 3KWQA 1ID3A 5CPIC 3KFUG 2Y2PA 4E44A 5AVCB 2VQRA 3KSYA 4XUJB 3B6GD 5JA4B 4ZBJC 2BYMA 3WKJC 5DNMC 3AV2A 3AZED 3EPLA 3AV1B 1M19B 3EPJA 3MNND 1T3UA 2BYKA 4R8PA 3X1VA 3A6NB 1BFMA 5GXQC 5AV8C 1P3KC 5B32B 4J8XC 2HIOC 5GT3A 5B0YC 3AZLC 2AROC 1TZYC 5B31A 1KX4B 4KUDB 1AOIA 4KHAA 3REKA 5DNNC 1BH8B 3AZFC 3AFAB 5FUGB 3X1TB 4YM6D 3WTPC 4QLCB 2F8NB 5F99C 1P3PC 3B6FA 2JSSA 5DNMA 5KDMB 2YFWB 1TAFA 5JRGB 1P3OA 5G49B 5AY8B 1HQ3C 5GSUC 4J8UD 5B1MC 5CPIB 1P3GD 3AV1D 2PYOC 5B0YA 2J8PA 1KX5C 2AROA 1TZYA 3A6ND 3MVDA 2NQBD 2UWXA 2NZDA 3LJAB 3MGPA 1P3FC 3AZFA 1KX4D 4KUDD 2JE5A 3KXBA 2FFFB 4WU9A 4Z66B 3AFAD 5AV8B 3NQJA 4G91C 4QLCD 2F8ND 3W98A 3MGQC 4J8VB 3AZKD 4NE5A 4X23A 3R45B 5B33C 5AV9D 1P34D 4NE6A 3C1CA 3LELC 3AZNC 5AVBA 5CPKA 1P3PB 2Y2MA 4WNNB 2Y2OA 3FDDA 4HGAC 3C1BC 3AN2B 4H9RA 3VH6T 1P3FA 1F66D 5BO0A 1H3OA 5GT0B 1EQZC 5B2JC 1BH9B 4JJNB 2FJ7B 1ID3D 4WU8D 3UT9D 5BT1D 2PYOB 4Z66D 4H9PA 5CP6D 3LZ0A 1M18D 1M1AC 2IO5C 2W8SA 2JCHA 4Z5TC 3KUYA 1S32A 3F6TA 3UTAB 3X1SB 3LELA 1U35C 1ZLAC 3AZJB 3UTBD 4J8WC 4CAYB 1P3MD 5B40B 1P3AC 5CPJA 3C1BA 1N1JB 3H0LC 2HUEB 4G91B 3AZGB 1P3LB 3REIB 4H9OB 3MGQB 1EQZA 3AZHA 1P3IB 3B6GC 5E5AB 3RELD 3W99D 5B33B 1F1EA 3TU4D 4JJND 3AZNB 4YS3B 2RVQD 4Z5TA 3REJA 5B2IC 3WAAA 3MGRA 3KWQC 2Y2LA 5AV5A 4J8WA 4ZUXA 1P3AA 5AV6D 3WA9A 3UTAD 3X1SD 4LD9D 5B40D 1KU5A 4YM6C 3AZIB 1M1AB 3B6GA 3AYWB 3AV2C 3AZGD 3REID 4H9QB 1ULYA 3AZEA 1U35B 1P3ID 5E5AD 3EG5B 3X1VC 4AWLC 4KGCD 3MNNA 5C3IC 4J8UC 4YS3D 1P3GC 5GT3C 5B31C 2XD5A 5B1LB 1AOIC 3W97B 4NE3A 3REKC 4XZQB 4CSRB 3O62B 4EO5C 5BNXB 5B24A 2YFVB 3LZ1B 3B6FC 4YM6A 2F8NH 3IP4C 5B0ZD 1KX3B 4WJ3C 3REHB 3B0CT 1P3OC 3KWQB 1P3BB 4WZSB 3X1UB 2CV5D 3W96B 4J8UA 3VH6W 3AZKC 1P3GA 3AV1A 3A1IA 3MVDC 5AV9C 2LY8A 1P34C 2BYMB 3A6NA 3AZMD 3AV2B 2NZDC 4M6BA 3MGPC 5B24D 2NQBA 2XD1A 3MGSB 3W97D 1KX4A 3KXBC 1F66C 4KUDA 4R8PB 1W2EA 4UPKA 4WU9C 5AVCD 3O62D 4XUJD 1BH8A 3AFAA 4WU8C 5B31B 3UT9C 3EPHA 3W98C 1AOIB 4QLCA 2F8NA 1KX3D 4X23C 1M19D 1M18C 4H9NA 3AZKA 2DQNC 1P3BD 3X1UD 5JRGA 3C1CC 3W96D 3B6FB 5AV9A 4ZBJB 5AVBC 5CPKC 1P34A 5B32D 3WKJB 5DNMB 3H0RC 2RIQA 1F66A 5GXQB 4Z2MG 3X1TD 1P3KB 3MGSD 4J8XB 2HIOB 5B0YB 4WU8A 3RELC 2AROB 1TZYB 3W99C 4H9SA 2CWEA 3MVDB 3UT9A 3LZ0C 3TU4C 4Z66A 5DNNB 5CP6A 3MGPB 5JRGD 3AZFB 1M18A 5AY8D 3KUYC 1S32C 3WTPB 3AZLB 5CPID 5F99B 5BNVB 5CPJC 3UTBA 1P3MA 3R45A 5AV6C 1HQ3B 3WKJD 4LD9C 3LJAD 5GSUB 3AZHC 5B1MB 4WNNA 2ZY3A 2F2AC 3AN2A 1KX5B 3RELA 3W99A 5GXQD 5AV8D 1P3KD 4J8XD 3TU4A 4JJNA 1WWIA 4H9RB 3AZLD 1P3FB 4KGCC 5BO0B 1H3OB 3WAAC 4J8VD 3REJC 3MGRC 5AV5C 5DNND 4ZUXC 3WA9C 1A7WA 3WTPD 2ZY5A 5AV6A 3B0CW 1P3PD 4H9PB 3UTAA 3X1SA 4LD9A 3AN2D 3NQUA 4CAYA 5B40A 4UUZA 5GT0D 1HQ3D 1S32B 5B31G 3AZGA 5GSUD 3AZEC 3LELB 5B0ZC 3REIA 2FJ7D 4H9OA 4E45A 3MNNC 1P3IA 1B6WA 1Q9CA 5E5AA 4HGAB 3C1BB 2PYOD 2G5IC 2CV5C 1KX5D 4KGCA 1EQZB 4YS3A 5B2JB 2BG1A 1JFIB 4G92C 3AZJD 5B24C 2ZM5A 2G5HC 3V9RA 2ZY4A 3B0BA 2IO5B 5CHLB 1P3LD 4Z5TB 5AVCC 3REJB 2Y2IA 3MGQD 3MGRB 1ZLAB 5B0ZA 4J8WB 1P3AB 5B33D 3WA9B 2CV5A 3AZND 3AV1C 1M19C 4H9QA 3B6GB 3A6NC 2NQBC 5B32C 3AZMA 1KX4C 4KUDC 3W97A 3AFAC 5AVCA 4CSRA 5B2IB 3O62A 4XUJA 3EPKA 3X1TC 3AZID 1M1AD 5JA4A 3AYWD 4QLCC 3B0DC 1ZLAD 1U35D 4G92B 1KX3A 5JRGC 1M19A 5AY8C 5BS7C 1P3BA 4YM6B 3X1UA 3AZJA 3W96A 1B67A 5B32A 5B1LD 4XZQD 4AWLB 2BYKB 3X1VB 5C3IB 3LJAC 4J8UB 1P3GB 5GT3B 3LZ1D 5FUGA 3X1TA 1ID3C 3MGSA 3AL0C 4H9SC 5BT1C 4KHAB 3REKB 4Z66C 4DRAA 5CP6C 5B2ID 3REHD 2NQBB 5KDMA 4DQYB 3KWQD 2YFWA 4EO5B 5G49A 5AY8A 5BS7A 4J8VC 5CPIA 3UTBC 1P3MC 1TAFB 1P3OB 2Y2QA 3AV2D 3B0DB 3WKJA 3LJAA 3AN2C 4H9NB 1PZRA 3AZKB 3X1VD 4R8PD 5GT0C 5AV9B 1P34B 4JJNC 2Y2KA 2NZDB 5GXQA 2FJ7C 5GT3D 5AV8A 5B31D 4J8XA 1P3KA 2HIOA 1AOID 3AZLA 2F8NK 2RVQC 3H0MC 3KXBB 3REKD 1F66B 3VH5T 4J8VA 4WU9B 2L5AA 5DNNA 1HTAA 3NQJB 1ID3B 4WU8B 3B6FD 3UT9B 2Y2NA 3WTPA 3UTAC 3X1SC 5DNMD 3W98B 3AZJC 5F99A 5BNVA 1P3PA 5B40C 5CP6B 4X23B 1P3OD 1M18B 3AZGC 2HUEC 3C1CB 1P3LC 5GT0A 3REIC 1HQ3A 1R4VA 5AVBB 5CPKB 5GSUA 2HIOD 1BH9A 3P5JB 5B1MA 5E5AC 3UTBB 1WWSA 1P3IC 5B0YD 2DF4C 1P3MB 2AROD 1TZYD 3MVDD 2FJ7A 2Y2HA 2PYOA 1KX5A 4YS3C 2NZDD 3MGPD 3AZFD 1Z2CB 3A1KA 3KXBD 5F99D 3RELB 4WU9D 3W99B 3LZ0B 3TU4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 A;  3KUY B;  3W98 D;  1N1J A;  4Z2M H;  5B1M D;  1P3L A;  4X23 D;  3MGQ A;  3AZI C;  5CPJ B;  5B32 G;  3AYW C;  3C1C D;  5B33 A;  5AV6 B;  5AVB D;  5CPK D;  4LD9 B;  3AZN A;  3AZH B;  3NQU B;  1P3F D;  4UUZ B;  3AZM C;  2F8N G;  5B1L C;  5B2J A;  3W97 C;  1JFI A;  4XZQ C;  4KGC B;  4DRB A;  3O62 C;  3LZ0 D;  3WAA B;  4XUJ C;  3VH6 A;  4WV4 B;  5AV5 B;  3LZ1 C;  4ZUX B;  3AZI A;  1M1A A;  3KUY D;  1S32 D;  3AYW A;  3LEL D;  1KX3 C;  3REH C;  1P3B C;  1U35 A;  1ZLA A;  5CPJ D;  3V9R B;  3X1U C;  3C1B D;  4NFT A;  3W96 C;  1EQZ D;  3AZH D;  5B2J D;  3AZE B;  5B0Z B;  3WTP E;  5B1L A;  3MNN B;  4XZQ A;  2CV5 B;  3MGS C;  5BNX A;  2YFV A;  3LZ1 A;  4R8P C;  3VH5 W;  4Z5T D;  3REJ D;  3WAA D;  3MGR D;  3AZM B;  5AV5 D;  3REH A;  5B2I A;  5B24 B;  4ZUX D;  4J8W D;  1P3A D;  3WA9 D;  3KWQ A;  1ID3 A;  5CPI C;  4E44 A;  5AVC B;  3KSY A;  4XUJ B;  3B6G D;  5JA4 B;  4ZBJ C;  2BYM A;  3WKJ C;  5DNM C;  3AV2 A;  3AZE D;  3AV1 B;  1M19 B;  3MNN D;  3X1V A;  2BYK A;  4R8P A;  3A6N B;  1BFM A;  5GXQ C;  5AV8 C;  1P3K C;  5B32 B;  4J8X C;  2HIO C;  5GT3 A;  5B0Y C;  3AZL C;  2ARO C;  1TZY C;  5B31 A;  1KX4 B;  4KUD B;  1AOI A;  4KHA A;  3REK A;  5DNN C;  1BH8 B;  3AZF C;  3AFA B;  5FUG B;  3X1T B;  4YM6 D;  3WTP C;  4QLC B;  2F8N B;  5F99 C;  1P3P C;  3B6F A;  2JSS A;  5DNM A;  5KDM B;  2YFW B;  1TAF A;  5JRG B;  1P3O A;  5G49 B;  5AY8 B;  1HQ3 C;  5GSU C;  4J8U D;  5B1M C;  5CPI B;  1P3G D;  3AV1 D;  2PYO C;  5B0Y A;  1KX5 C;  2ARO A;  1TZY A;  3A6N D;  3MVD A;  2NQB D;  2NZD A;  3LJA B;  3MGP A;  1P3F C;  3AZF A;  1KX4 D;  4KUD D;  3KXB A;  4WU9 A;  4Z66 B;  3AFA D;  5AV8 B;  3NQJ A;  4G91 C;  4QLC D;  2F8N D;  3W98 A;  3MGQ C;  4J8V B;  3AZK D;  4NE5 A;  4X23 A;  3R45 B;  5B33 C;  5AV9 D;  1P34 D;  4NE6 A;  3C1C A;  3LEL C;  3AZN C;  5AVB A;  5CPK A;  1P3P B;  4WNN B;  4HGA C;  3C1B C;  3AN2 B;  4H9R A;  3VH6 T;  1P3F A;  1F66 D;  5BO0 A;  1H3O A;  5GT0 B;  1EQZ C;  5B2J C;  1BH9 B;  4JJN B;  2FJ7 B;  1ID3 D;  4WU8 D;  3UT9 D;  5BT1 D;  2PYO B;  4Z66 D;  4H9P A;  5CP6 D;  3LZ0 A;  1M18 D;  1M1A C;  2IO5 C;  4Z5T C;  3KUY A;  1S32 A;  3UTA B;  3X1S B;  3LEL A;  1U35 C;  1ZLA C;  3AZJ B;  3UTB D;  4J8W C;  4CAY B;  1P3M D;  5B40 B;  1P3A C;  5CPJ A;  3C1B A;  1N1J B;  4G91 B;  2HUE B;  3AZG B;  1P3L B;  3REI B;  4H9O B;  3MGQ B;  1EQZ A;  3AZH A;  1P3I B;  3B6G C;  5E5A B;  3REL D;  3W99 D;  5B33 B;  1F1E A;  3TU4 D;  4JJN D;  3AZN B;  4YS3 B;  2RVQ D;  4Z5T A;  3REJ A;  5B2I C;  3WAA A;  3MGR A;  3KWQ C;  5AV5 A;  4J8W A;  4ZUX A;  1P3A A;  5AV6 D;  3WA9 A;  3UTA D;  3X1S D;  4LD9 D;  5B40 D;  1KU5 A;  4YM6 C;  3AZI B;  1M1A B;  3B6G A;  3AYW B;  3AV2 C;  3AZG D;  3REI D;  4H9Q B;  1ULY A;  3AZE A;  1U35 B;  1P3I D;  5E5A D;  3X1V C;  4AWL C;  4KGC D;  3MNN A;  5C3I C;  4J8U C;  4YS3 D;  1P3G C;  5GT3 C;  5B31 C;  5B1L B;  1AOI C;  3W97 B;  4NE3 A;  3REK C;  4XZQ B;  4CSR B;  3O62 B;  4EO5 C;  5BNX B;  5B24 A;  2YFV B;  3LZ1 B;  3B6F C;  4YM6 A;  2F8N H;  5B0Z D;  1KX3 B;  3REH B;  3B0C T;  1P3O C;  3KWQ B;  1P3B B;  4WZS B;  3X1U B;  2CV5 D;  3W96 B;  4J8U A;  3VH6 W;  3AZK C;  1P3G A;  3AV1 A;  3MVD C;  5AV9 C;  2LY8 A;  1P34 C;  2BYM B;  3A6N A;  3AZM D;  3AV2 B;  2NZD C;  4M6B A;  3MGP C;  5B24 D;  2NQB A;  3MGS B;  3W97 D;  1KX4 A;  3KXB C;  1F66 C;  4KUD A;  4R8P B;  4WU9 C;  5AVC D;  3O62 D;  4XUJ D;  1BH8 A;  3AFA A;  4WU8 C;  5B31 B;  3UT9 C;  3W98 C;  1AOI B;  4QLC A;  2F8N A;  1KX3 D;  4X23 C;  1M19 D;  1M18 C;  4H9N A;  3AZK A;  1P3B D;  3X1U D;  5JRG A;  3C1C C;  3W96 D;  3B6F B;  5AV9 A;  4ZBJ B;  5AVB C;  5CPK C;  1P34 A;  5B32 D;  3WKJ B;  5DNM B;  1F66 A;  5GXQ B;  4Z2M G;  3X1T D;  1P3K B;  3MGS D;  4J8X B;  2HIO B;  5B0Y B;  4WU8 A;  3REL C;  2ARO B;  1TZY B;  3W99 C;  4H9S A;  2CWE A;  3MVD B;  3UT9 A;  3LZ0 C;  3TU4 C;  4Z66 A;  5DNN B;  5CP6 A;  3MGP B;  5JRG D;  3AZF B;  1M18 A;  5AY8 D;  3KUY C;  1S32 C;  3WTP B;  3AZL B;  5CPI D;  5F99 B;  5BNV B;  5CPJ C;  3UTB A;  1P3M A;  3R45 A;  5AV6 C;  1HQ3 B;  3WKJ D;  4LD9 C;  3LJA D;  5GSU B;  3AZH C;  5B1M B;  4WNN A;  3AN2 A;  1KX5 B;  3REL A;  3W99 A;  5GXQ D;  5AV8 D;  1P3K D;  4J8X D;  3TU4 A;  4JJN A;  1WWI A;  4H9R B;  3AZL D;  1P3F B;  4KGC C;  5BO0 B;  1H3O B;  3WAA C;  4J8V D;  3REJ C;  3MGR C;  5AV5 C;  5DNN D;  4ZUX C;  3WA9 C;  1A7W A;  3WTP D;  5AV6 A;  3B0C W;  1P3P D;  4H9P B;  3UTA A;  3X1S A;  4LD9 A;  3AN2 D;  3NQU A;  4CAY A;  5B40 A;  4UUZ A;  5GT0 D;  1HQ3 D;  1S32 B;  5B31 G;  3AZG A;  5GSU D;  3AZE C;  3LEL B;  5B0Z C;  3REI A;  2FJ7 D;  4H9O A;  4E45 A;  3MNN C;  1P3I A;  1Q9C A;  1B6W A;  5E5A A;  4HGA B;  3C1B B;  2PYO D;  2CV5 C;  1KX5 D;  4KGC A;  1EQZ B;  4YS3 A;  5B2J B;  1JFI B;  4G92 C;  3AZJ D;  5B24 C;  3V9R A;  3B0B A;  2IO5 B;  5CHL B;  1P3L D;  4Z5T B;  5AVC C;  3REJ B;  3MGQ D;  3MGR B;  1ZLA B;  5B0Z A;  4J8W B;  1P3A B;  5B33 D;  3WA9 B;  2CV5 A;  3AZN D;  3AV1 C;  1M19 C;  4H9Q A;  3B6G B;  3A6N C;  2NQB C;  5B32 C;  3AZM A;  1KX4 C;  4KUD C;  3W97 A;  3AFA C;  5AVC A;  4CSR A;  5B2I B;  3O62 A;  4XUJ A;  3X1T C;  3AZI D;  1M1A D;  5JA4 A;  3AYW D;  4QLC C;  3B0D C;  1ZLA D;  1U35 D;  4G92 B;  1KX3 A;  5JRG C;  1M19 A;  5AY8 C;  5BS7 C;  1P3B A;  4YM6 B;  3X1U A;  3AZJ A;  3W96 A;  1B67 A;  5B32 A;  5B1L D;  4XZQ D;  4AWL B;  2BYK B;  3X1V B;  5C3I B;  3LJA C;  4J8U B;  1P3G B;  5GT3 B;  3LZ1 D;  5FUG A;  3X1T A;  1ID3 C;  3MGS A;  4H9S C;  5BT1 C;  4KHA B;  3REK B;  4Z66 C;  4DRA A;  5CP6 C;  5B2I D;  3REH D;  2NQB B;  5KDM A;  3KWQ D;  2YFW A;  4EO5 B;  5G49 A;  5AY8 A;  5BS7 A;  4J8V C;  5CPI A;  3UTB C;  1P3M C;  1TAF B;  1P3O B;  3AV2 D;  3B0D B;  3WKJ A;  3LJA A;  3AN2 C;  4H9N B;  3AZK B;  3X1V D;  4R8P D;  5GT0 C;  5AV9 B;  1P34 B;  4JJN C;  2NZD B;  5GXQ A;  2FJ7 C;  5GT3 D;  5AV8 A;  5B31 D;  4J8X A;  1P3K A;  2HIO A;  1AOI D;  3AZL A;  2F8N K;  2RVQ C;  3KXB B;  3REK D;  1F66 B;  3VH5 T;  4J8V A;  4WU9 B;  2L5A A;  5DNN A;  1HTA A;  3NQJ B;  1ID3 B;  4WU8 B;  3B6F D;  3UT9 B;  3WTP A;  3UTA C;  3X1S C;  5DNM D;  3W98 B;  3AZJ C;  5F99 A;  5BNV A;  1P3P A;  5B40 C;  5CP6 B;  4X23 B;  1P3O D;  1M18 B;  3AZG C;  2HUE C;  3C1C B;  1P3L C;  5GT0 A;  3REI C;  1HQ3 A;  1R4V A;  5AVB B;  5CPK B;  5GSU A;  2HIO D;  1BH9 A;  5B1M A;  5E5A C;  1P3I C;  3UTB B;  1WWS A;  1P3M B;  5B0Y D;  2FJ7 A;  2ARO D;  1TZY D;  3MVD D;  2PYO A;  1KX5 A;  4YS3 C;  2NZD D;  3MGP D;  3AZF D;  3KXB D;  5F99 D;  3REL B;  4WU9 D;  3W99 B;  3LZ0 B;  3TU4 B; 
#chains in the Genus database with same CATH topology
 2Y2J A;  3VH5 A;  3KUY B;  3W98 D;  1N1J A;  4Z2M H;  5B1M D;  1P3L A;  4X23 D;  3MGQ A;  3AZI C;  5CPJ B;  5B32 G;  3AYW C;  3C1C D;  5B33 A;  5AV6 B;  5AVB D;  5CPK D;  4LD9 B;  3AZN A;  3AZH B;  3NQU B;  1P3F D;  4UUZ B;  3AZM C;  2Y2G A;  2F8N G;  5B1L C;  5B2J A;  3W97 C;  1JFI A;  4XZQ C;  4KGC B;  4DRB A;  3O62 C;  3LZ0 D;  3WAA B;  4XUJ C;  3VH6 A;  4WV4 B;  5AV5 B;  3LZ1 C;  4ZUX B;  3AZI A;  1M1A A;  3KUY D;  1S32 D;  3AYW A;  3LEL D;  1KX3 C;  3REH C;  1P3B C;  1U35 A;  1ZLA A;  2ZY2 A;  3V9R B;  5CPJ D;  3X1U C;  3C1B D;  4NFT A;  3W96 C;  1EQZ D;  3AZH D;  5B2J D;  3AZE B;  5B0Z B;  3WTP E;  5B1L A;  3MNN B;  4XZQ A;  2CV5 B;  3MGS C;  5BNX A;  2YFV A;  3LZ1 A;  4R8P C;  3VH5 W;  4Z5T D;  3REJ D;  3WAA D;  3MGR D;  3AZM B;  5AV5 D;  3REH A;  5B2I A;  5B24 B;  4ZUX D;  4J8W D;  1P3A D;  3WA9 D;  3KWQ A;  1ID3 A;  5CPI C;  3KFU G;  2Y2P A;  4E44 A;  5AVC B;  2VQR A;  3KSY A;  4XUJ B;  3B6G D;  5JA4 B;  4ZBJ C;  2BYM A;  3WKJ C;  5DNM C;  3AV2 A;  3AZE D;  3EPL A;  3AV1 B;  1M19 B;  3EPJ A;  3MNN D;  1T3U A;  2BYK A;  4R8P A;  3X1V A;  3A6N B;  1BFM A;  5GXQ C;  5AV8 C;  1P3K C;  5B32 B;  4J8X C;  2HIO C;  5GT3 A;  5B0Y C;  3AZL C;  2ARO C;  1TZY C;  5B31 A;  1KX4 B;  4KUD B;  1AOI A;  4KHA A;  3REK A;  5DNN C;  1BH8 B;  3AZF C;  3AFA B;  5FUG B;  3X1T B;  4YM6 D;  3WTP C;  4QLC B;  2F8N B;  5F99 C;  1P3P C;  3B6F A;  2JSS A;  5DNM A;  5KDM B;  2YFW B;  1TAF A;  5JRG B;  1P3O A;  5G49 B;  5AY8 B;  1HQ3 C;  5GSU C;  4J8U D;  5B1M C;  5CPI B;  1P3G D;  3AV1 D;  2PYO C;  5B0Y A;  2J8P A;  1KX5 C;  2ARO A;  1TZY A;  3A6N D;  3MVD A;  2NQB D;  2UWX A;  2NZD A;  3LJA B;  3MGP A;  1P3F C;  3AZF A;  1KX4 D;  4KUD D;  2JE5 A;  3KXB A;  2FFF B;  4WU9 A;  4Z66 B;  3AFA D;  5AV8 B;  3NQJ A;  4G91 C;  4QLC D;  2F8N D;  3W98 A;  3MGQ C;  4J8V B;  3AZK D;  4NE5 A;  4X23 A;  3R45 B;  5B33 C;  5AV9 D;  1P34 D;  4NE6 A;  3C1C A;  3LEL C;  3AZN C;  5AVB A;  5CPK A;  1P3P B;  2Y2M A;  4WNN B;  2Y2O A;  3FDD A;  4HGA C;  3C1B C;  3AN2 B;  4H9R A;  3VH6 T;  1P3F A;  1F66 D;  5BO0 A;  1H3O A;  5GT0 B;  1EQZ C;  5B2J C;  1BH9 B;  4JJN B;  2FJ7 B;  1ID3 D;  4WU8 D;  3UT9 D;  5BT1 D;  2PYO B;  4Z66 D;  4H9P A;  5CP6 D;  3LZ0 A;  1M18 D;  1M1A C;  2IO5 C;  2W8S A;  2JCH A;  4Z5T C;  3KUY A;  1S32 A;  3F6T A;  3UTA B;  3X1S B;  3LEL A;  1U35 C;  1ZLA C;  3AZJ B;  3UTB D;  4J8W C;  4CAY B;  1P3M D;  5B40 B;  1P3A C;  5CPJ A;  3C1B A;  1N1J B;  3H0L C;  2HUE B;  4G91 B;  3AZG B;  1P3L B;  3REI B;  4H9O B;  3MGQ B;  1EQZ A;  3AZH A;  1P3I B;  3B6G C;  5E5A B;  3REL D;  3W99 D;  5B33 B;  1F1E A;  3TU4 D;  4JJN D;  3AZN B;  4YS3 B;  2RVQ D;  4Z5T A;  3REJ A;  5B2I C;  3WAA A;  3MGR A;  3KWQ C;  2Y2L A;  5AV5 A;  4J8W A;  4ZUX A;  1P3A A;  5AV6 D;  3WA9 A;  3UTA D;  3X1S D;  4LD9 D;  5B40 D;  1KU5 A;  4YM6 C;  3AZI B;  1M1A B;  3B6G A;  3AYW B;  3AV2 C;  3AZG D;  3REI D;  4H9Q B;  1ULY A;  3AZE A;  1U35 B;  1P3I D;  5E5A D;  3EG5 B;  3X1V C;  4AWL C;  4KGC D;  3MNN A;  5C3I C;  4J8U C;  4YS3 D;  1P3G C;  5GT3 C;  5B31 C;  2XD5 A;  5B1L B;  1AOI C;  3W97 B;  4NE3 A;  3REK C;  4XZQ B;  4CSR B;  3O62 B;  4EO5 C;  5BNX B;  5B24 A;  2YFV B;  3LZ1 B;  3B6F C;  4YM6 A;  2F8N H;  3IP4 C;  5B0Z D;  1KX3 B;  4WJ3 C;  3REH B;  3B0C T;  1P3O C;  3KWQ B;  1P3B B;  4WZS B;  3X1U B;  2CV5 D;  3W96 B;  4J8U A;  3VH6 W;  3AZK C;  1P3G A;  3AV1 A;  3A1I A;  3MVD C;  5AV9 C;  2LY8 A;  1P34 C;  2BYM B;  3A6N A;  3AZM D;  3AV2 B;  2NZD C;  4M6B A;  3MGP C;  5B24 D;  2NQB A;  2XD1 A;  3MGS B;  3W97 D;  1KX4 A;  3KXB C;  1F66 C;  4KUD A;  4R8P B;  1W2E A;  4UPK A;  4WU9 C;  5AVC D;  3O62 D;  4XUJ D;  1BH8 A;  3AFA A;  4WU8 C;  5B31 B;  3UT9 C;  3EPH A;  3W98 C;  1AOI B;  4QLC A;  2F8N A;  1KX3 D;  4X23 C;  1M19 D;  1M18 C;  4H9N A;  3AZK A;  2DQN C;  1P3B D;  3X1U D;  5JRG A;  3C1C C;  3W96 D;  3B6F B;  5AV9 A;  4ZBJ B;  5AVB C;  5CPK C;  1P34 A;  5B32 D;  3WKJ B;  5DNM B;  3H0R C;  2RIQ A;  1F66 A;  5GXQ B;  4Z2M G;  3X1T D;  1P3K B;  3MGS D;  4J8X B;  2HIO B;  5B0Y B;  4WU8 A;  3REL C;  2ARO B;  1TZY B;  3W99 C;  4H9S A;  2CWE A;  3MVD B;  3UT9 A;  3LZ0 C;  3TU4 C;  4Z66 A;  5DNN B;  5CP6 A;  3MGP B;  5JRG D;  3AZF B;  1M18 A;  5AY8 D;  3KUY C;  1S32 C;  3WTP B;  3AZL B;  5CPI D;  5F99 B;  5BNV B;  5CPJ C;  3UTB A;  1P3M A;  3R45 A;  5AV6 C;  1HQ3 B;  3WKJ D;  4LD9 C;  3LJA D;  5GSU B;  3AZH C;  5B1M B;  4WNN A;  2ZY3 A;  2F2A C;  3AN2 A;  1KX5 B;  3REL A;  3W99 A;  5GXQ D;  5AV8 D;  1P3K D;  4J8X D;  3TU4 A;  4JJN A;  1WWI A;  4H9R B;  3AZL D;  1P3F B;  4KGC C;  5BO0 B;  1H3O B;  3WAA C;  4J8V D;  3REJ C;  3MGR C;  5AV5 C;  5DNN D;  4ZUX C;  3WA9 C;  1A7W A;  3WTP D;  2ZY5 A;  5AV6 A;  3B0C W;  1P3P D;  4H9P B;  3UTA A;  3X1S A;  4LD9 A;  3AN2 D;  3NQU A;  4CAY A;  5B40 A;  4UUZ A;  5GT0 D;  1HQ3 D;  1S32 B;  5B31 G;  3AZG A;  5GSU D;  3AZE C;  3LEL B;  5B0Z C;  3REI A;  2FJ7 D;  4H9O A;  4E45 A;  3MNN C;  1P3I A;  1B6W A;  1Q9C A;  5E5A A;  4HGA B;  3C1B B;  2PYO D;  2G5I C;  2CV5 C;  1KX5 D;  4KGC A;  1EQZ B;  4YS3 A;  5B2J B;  2BG1 A;  1JFI B;  4G92 C;  3AZJ D;  5B24 C;  2ZM5 A;  2G5H C;  3V9R A;  2ZY4 A;  3B0B A;  2IO5 B;  5CHL B;  1P3L D;  4Z5T B;  5AVC C;  3REJ B;  2Y2I A;  3MGQ D;  3MGR B;  1ZLA B;  5B0Z A;  4J8W B;  1P3A B;  5B33 D;  3WA9 B;  2CV5 A;  3AZN D;  3AV1 C;  1M19 C;  4H9Q A;  3B6G B;  3A6N C;  2NQB C;  5B32 C;  3AZM A;  1KX4 C;  4KUD C;  3W97 A;  3AFA C;  5AVC A;  4CSR A;  5B2I B;  3O62 A;  4XUJ A;  3EPK A;  3X1T C;  3AZI D;  1M1A D;  5JA4 A;  3AYW D;  4QLC C;  3B0D C;  1ZLA D;  1U35 D;  4G92 B;  1KX3 A;  5JRG C;  1M19 A;  5AY8 C;  5BS7 C;  1P3B A;  4YM6 B;  3X1U A;  3AZJ A;  3W96 A;  1B67 A;  5B32 A;  5B1L D;  4XZQ D;  4AWL B;  2BYK B;  3X1V B;  5C3I B;  3LJA C;  4J8U B;  1P3G B;  5GT3 B;  3LZ1 D;  5FUG A;  3X1T A;  1ID3 C;  3MGS A;  3AL0 C;  4H9S C;  5BT1 C;  4KHA B;  3REK B;  4Z66 C;  4DRA A;  5CP6 C;  5B2I D;  3REH D;  2NQB B;  5KDM A;  4DQY B;  3KWQ D;  2YFW A;  4EO5 B;  5G49 A;  5AY8 A;  5BS7 A;  4J8V C;  5CPI A;  3UTB C;  1P3M C;  1TAF B;  1P3O B;  2Y2Q A;  3AV2 D;  3B0D B;  3WKJ A;  3LJA A;  3AN2 C;  4H9N B;  1PZR A;  3AZK B;  3X1V D;  4R8P D;  5GT0 C;  5AV9 B;  1P34 B;  4JJN C;  2Y2K A;  2NZD B;  5GXQ A;  2FJ7 C;  5GT3 D;  5AV8 A;  5B31 D;  4J8X A;  1P3K A;  2HIO A;  1AOI D;  3AZL A;  2F8N K;  2RVQ C;  3H0M C;  3KXB B;  3REK D;  1F66 B;  3VH5 T;  4J8V A;  4WU9 B;  2L5A A;  5DNN A;  1HTA A;  3NQJ B;  1ID3 B;  4WU8 B;  3B6F D;  3UT9 B;  2Y2N A;  3WTP A;  3UTA C;  3X1S C;  5DNM D;  3W98 B;  3AZJ C;  5F99 A;  5BNV A;  1P3P A;  5B40 C;  5CP6 B;  4X23 B;  1P3O D;  1M18 B;  3AZG C;  2HUE C;  3C1C B;  1P3L C;  5GT0 A;  3REI C;  1HQ3 A;  1R4V A;  5AVB B;  5CPK B;  5GSU A;  2HIO D;  1BH9 A;  3P5J B;  5B1M A;  5E5A C;  3UTB B;  1WWS A;  1P3I C;  5B0Y D;  2DF4 C;  1P3M B;  2ARO D;  1TZY D;  3MVD D;  2FJ7 A;  2Y2H A;  2PYO A;  1KX5 A;  4YS3 C;  2NZD D;  3MGP D;  3AZF D;  1Z2C B;  3A1K A;  3KXB D;  5F99 D;  3REL B;  4WU9 D;  3W99 B;  3LZ0 B;  3TU4 B; 
#chains in the Genus database with same CATH homology
 2Y2J A;  3VH5 A;  3KUY B;  3W98 D;  1N1J A;  4Z2M H;  5B1M D;  1P3L A;  4X23 D;  3MGQ A;  3AZI C;  5CPJ B;  5B32 G;  3AYW C;  3C1C D;  5B33 A;  5AV6 B;  5AVB D;  5CPK D;  4LD9 B;  3AZN A;  3AZH B;  3NQU B;  1P3F D;  4UUZ B;  3AZM C;  2Y2G A;  2F8N G;  5B1L C;  5B2J A;  3W97 C;  1JFI A;  4XZQ C;  4KGC B;  4DRB A;  3O62 C;  3LZ0 D;  3WAA B;  4XUJ C;  3VH6 A;  4WV4 B;  5AV5 B;  3LZ1 C;  4ZUX B;  3AZI A;  1M1A A;  3KUY D;  1S32 D;  3AYW A;  3LEL D;  1KX3 C;  3REH C;  1P3B C;  1U35 A;  1ZLA A;  2ZY2 A;  3V9R B;  5CPJ D;  3X1U C;  3C1B D;  4NFT A;  3W96 C;  1EQZ D;  3AZH D;  5B2J D;  3AZE B;  5B0Z B;  3WTP E;  5B1L A;  3MNN B;  4XZQ A;  2CV5 B;  3MGS C;  5BNX A;  2YFV A;  3LZ1 A;  4R8P C;  3VH5 W;  4Z5T D;  3REJ D;  3WAA D;  3MGR D;  3AZM B;  5AV5 D;  3REH A;  5B2I A;  5B24 B;  4ZUX D;  4J8W D;  1P3A D;  3WA9 D;  3KWQ A;  1ID3 A;  5CPI C;  3KFU G;  2Y2P A;  4E44 A;  5AVC B;  2VQR A;  3KSY A;  4XUJ B;  3B6G D;  5JA4 B;  4ZBJ C;  2BYM A;  3WKJ C;  5DNM C;  3AV2 A;  3AZE D;  3EPL A;  3AV1 B;  1M19 B;  3EPJ A;  3MNN D;  1T3U A;  2BYK A;  4R8P A;  3X1V A;  3A6N B;  1BFM A;  5GXQ C;  5AV8 C;  1P3K C;  5B32 B;  4J8X C;  2HIO C;  5GT3 A;  5B0Y C;  3AZL C;  2ARO C;  1TZY C;  5B31 A;  1KX4 B;  4KUD B;  1AOI A;  4KHA A;  3REK A;  5DNN C;  1BH8 B;  3AZF C;  3AFA B;  5FUG B;  3X1T B;  4YM6 D;  3WTP C;  4QLC B;  2F8N B;  5F99 C;  1P3P C;  3B6F A;  2JSS A;  5DNM A;  5KDM B;  2YFW B;  1TAF A;  5JRG B;  1P3O A;  5G49 B;  5AY8 B;  1HQ3 C;  5GSU C;  4J8U D;  5B1M C;  5CPI B;  1P3G D;  3AV1 D;  2PYO C;  5B0Y A;  2J8P A;  1KX5 C;  2ARO A;  1TZY A;  3A6N D;  3MVD A;  2NQB D;  2UWX A;  2NZD A;  3LJA B;  3MGP A;  1P3F C;  3AZF A;  1KX4 D;  4KUD D;  2JE5 A;  3KXB A;  2FFF B;  4WU9 A;  4Z66 B;  3AFA D;  5AV8 B;  3NQJ A;  4G91 C;  4QLC D;  2F8N D;  3W98 A;  3MGQ C;  4J8V B;  3AZK D;  4NE5 A;  4X23 A;  3R45 B;  5B33 C;  5AV9 D;  1P34 D;  4NE6 A;  3C1C A;  3LEL C;  3AZN C;  5AVB A;  5CPK A;  1P3P B;  2Y2M A;  4WNN B;  2Y2O A;  3FDD A;  4HGA C;  3C1B C;  3AN2 B;  4H9R A;  3VH6 T;  1P3F A;  1F66 D;  5BO0 A;  1H3O A;  5GT0 B;  1EQZ C;  5B2J C;  1BH9 B;  4JJN B;  2FJ7 B;  1ID3 D;  4WU8 D;  3UT9 D;  5BT1 D;  2PYO B;  4Z66 D;  4H9P A;  5CP6 D;  3LZ0 A;  1M18 D;  1M1A C;  2IO5 C;  2W8S A;  2JCH A;  4Z5T C;  3KUY A;  1S32 A;  3F6T A;  3UTA B;  3X1S B;  3LEL A;  1U35 C;  1ZLA C;  3AZJ B;  3UTB D;  4J8W C;  4CAY B;  1P3M D;  5B40 B;  1P3A C;  5CPJ A;  3C1B A;  1N1J B;  3H0L C;  2HUE B;  4G91 B;  3AZG B;  1P3L B;  3REI B;  4H9O B;  3MGQ B;  1EQZ A;  3AZH A;  1P3I B;  3B6G C;  5E5A B;  3REL D;  3W99 D;  5B33 B;  1F1E A;  3TU4 D;  4JJN D;  3AZN B;  4YS3 B;  2RVQ D;  4Z5T A;  3REJ A;  5B2I C;  3WAA A;  3MGR A;  3KWQ C;  2Y2L A;  5AV5 A;  4J8W A;  4ZUX A;  1P3A A;  5AV6 D;  3WA9 A;  3UTA D;  3X1S D;  4LD9 D;  5B40 D;  1KU5 A;  4YM6 C;  3AZI B;  1M1A B;  3B6G A;  3AYW B;  3AV2 C;  3AZG D;  3REI D;  4H9Q B;  1ULY A;  3AZE A;  1U35 B;  1P3I D;  5E5A D;  3EG5 B;  3X1V C;  4AWL C;  4KGC D;  3MNN A;  5C3I C;  4J8U C;  4YS3 D;  1P3G C;  5GT3 C;  5B31 C;  2XD5 A;  5B1L B;  1AOI C;  3W97 B;  4NE3 A;  3REK C;  4XZQ B;  4CSR B;  3O62 B;  4EO5 C;  5BNX B;  5B24 A;  2YFV B;  3LZ1 B;  3B6F C;  4YM6 A;  2F8N H;  3IP4 C;  5B0Z D;  1KX3 B;  4WJ3 C;  3REH B;  3B0C T;  1P3O C;  3KWQ B;  1P3B B;  4WZS B;  3X1U B;  2CV5 D;  3W96 B;  4J8U A;  3VH6 W;  3AZK C;  1P3G A;  3AV1 A;  3A1I A;  3MVD C;  5AV9 C;  2LY8 A;  1P34 C;  2BYM B;  3A6N A;  3AZM D;  3AV2 B;  2NZD C;  4M6B A;  3MGP C;  5B24 D;  2NQB A;  2XD1 A;  3MGS B;  3W97 D;  1KX4 A;  3KXB C;  1F66 C;  4KUD A;  4R8P B;  1W2E A;  4UPK A;  4WU9 C;  5AVC D;  3O62 D;  4XUJ D;  1BH8 A;  3AFA A;  4WU8 C;  5B31 B;  3UT9 C;  3EPH A;  3W98 C;  1AOI B;  4QLC A;  2F8N A;  1KX3 D;  4X23 C;  1M19 D;  1M18 C;  4H9N A;  3AZK A;  2DQN C;  1P3B D;  3X1U D;  5JRG A;  3C1C C;  3W96 D;  3B6F B;  5AV9 A;  4ZBJ B;  5AVB C;  5CPK C;  1P34 A;  5B32 D;  3WKJ B;  5DNM B;  3H0R C;  2RIQ A;  1F66 A;  5GXQ B;  4Z2M G;  3X1T D;  1P3K B;  3MGS D;  4J8X B;  2HIO B;  5B0Y B;  4WU8 A;  3REL C;  2ARO B;  1TZY B;  3W99 C;  4H9S A;  2CWE A;  3MVD B;  3UT9 A;  3LZ0 C;  3TU4 C;  4Z66 A;  5DNN B;  5CP6 A;  3MGP B;  5JRG D;  3AZF B;  1M18 A;  5AY8 D;  3KUY C;  1S32 C;  3WTP B;  3AZL B;  5CPI D;  5F99 B;  5BNV B;  5CPJ C;  3UTB A;  1P3M A;  3R45 A;  5AV6 C;  1HQ3 B;  3WKJ D;  4LD9 C;  3LJA D;  5GSU B;  3AZH C;  5B1M B;  4WNN A;  2ZY3 A;  2F2A C;  3AN2 A;  1KX5 B;  3REL A;  3W99 A;  5GXQ D;  5AV8 D;  1P3K D;  4J8X D;  3TU4 A;  4JJN A;  1WWI A;  4H9R B;  3AZL D;  1P3F B;  4KGC C;  5BO0 B;  1H3O B;  3WAA C;  4J8V D;  3REJ C;  3MGR C;  5AV5 C;  5DNN D;  4ZUX C;  3WA9 C;  1A7W A;  3WTP D;  2ZY5 A;  5AV6 A;  3B0C W;  1P3P D;  4H9P B;  3UTA A;  3X1S A;  4LD9 A;  3AN2 D;  3NQU A;  4CAY A;  5B40 A;  4UUZ A;  5GT0 D;  1HQ3 D;  1S32 B;  5B31 G;  3AZG A;  5GSU D;  3AZE C;  3LEL B;  5B0Z C;  3REI A;  2FJ7 D;  4H9O A;  4E45 A;  3MNN C;  1P3I A;  1B6W A;  1Q9C A;  5E5A A;  4HGA B;  3C1B B;  2PYO D;  2G5I C;  2CV5 C;  1KX5 D;  4KGC A;  1EQZ B;  4YS3 A;  5B2J B;  2BG1 A;  1JFI B;  4G92 C;  3AZJ D;  5B24 C;  2ZM5 A;  2G5H C;  3V9R A;  2ZY4 A;  3B0B A;  2IO5 B;  5CHL B;  1P3L D;  4Z5T B;  5AVC C;  3REJ B;  2Y2I A;  3MGQ D;  3MGR B;  1ZLA B;  5B0Z A;  4J8W B;  1P3A B;  5B33 D;  3WA9 B;  2CV5 A;  3AZN D;  3AV1 C;  1M19 C;  4H9Q A;  3B6G B;  3A6N C;  2NQB C;  5B32 C;  3AZM A;  1KX4 C;  4KUD C;  3W97 A;  3AFA C;  5AVC A;  4CSR A;  5B2I B;  3O62 A;  4XUJ A;  3EPK A;  3X1T C;  3AZI D;  1M1A D;  5JA4 A;  3AYW D;  4QLC C;  3B0D C;  1ZLA D;  1U35 D;  4G92 B;  1KX3 A;  5JRG C;  1M19 A;  5AY8 C;  5BS7 C;  1P3B A;  4YM6 B;  3X1U A;  3AZJ A;  3W96 A;  1B67 A;  5B32 A;  5B1L D;  4XZQ D;  4AWL B;  2BYK B;  3X1V B;  5C3I B;  3LJA C;  4J8U B;  1P3G B;  5GT3 B;  3LZ1 D;  5FUG A;  3X1T A;  1ID3 C;  3MGS A;  3AL0 C;  4H9S C;  5BT1 C;  4KHA B;  3REK B;  4Z66 C;  4DRA A;  5CP6 C;  5B2I D;  3REH D;  2NQB B;  5KDM A;  4DQY B;  3KWQ D;  2YFW A;  4EO5 B;  5G49 A;  5AY8 A;  5BS7 A;  4J8V C;  5CPI A;  3UTB C;  1P3M C;  1TAF B;  1P3O B;  2Y2Q A;  3AV2 D;  3B0D B;  3WKJ A;  3LJA A;  3AN2 C;  4H9N B;  1PZR A;  3AZK B;  3X1V D;  4R8P D;  5GT0 C;  5AV9 B;  1P34 B;  4JJN C;  2Y2K A;  2NZD B;  5GXQ A;  2FJ7 C;  5GT3 D;  5AV8 A;  5B31 D;  4J8X A;  1P3K A;  2HIO A;  1AOI D;  3AZL A;  2F8N K;  2RVQ C;  3H0M C;  3KXB B;  3REK D;  1F66 B;  3VH5 T;  4J8V A;  4WU9 B;  2L5A A;  5DNN A;  1HTA A;  3NQJ B;  1ID3 B;  4WU8 B;  3B6F D;  3UT9 B;  2Y2N A;  3WTP A;  3UTA C;  3X1S C;  5DNM D;  3W98 B;  3AZJ C;  5F99 A;  5BNV A;  1P3P A;  5B40 C;  5CP6 B;  4X23 B;  1P3O D;  1M18 B;  3AZG C;  2HUE C;  3C1C B;  1P3L C;  5GT0 A;  3REI C;  1HQ3 A;  1R4V A;  5AVB B;  5CPK B;  5GSU A;  2HIO D;  1BH9 A;  3P5J B;  5B1M A;  5E5A C;  3UTB B;  1WWS A;  1P3I C;  5B0Y D;  2DF4 C;  1P3M B;  2ARO D;  1TZY D;  3MVD D;  2FJ7 A;  2Y2H A;  2PYO A;  1KX5 A;  4YS3 C;  2NZD D;  3MGP D;  3AZF D;  1Z2C B;  3A1K A;  3KXB D;  5F99 D;  3REL B;  4WU9 D;  3W99 B;  3LZ0 B;  3TU4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...