4XUJA

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujA00
3AZLA 2F8NA 3AV1C 5AV8A 3AZJC 5FUGA 3KUYD 5B0YA 5B32D 5AVBD 4ZUXD 5B1MC 2LY8A 4Z5TC 3VH6T 4G92C 1U35D 5JRGD 5CHLB 2RVQD 4XUJA 5BNVA 3A6NA 3WKJC 5B24C 1KX4B 3AZNA 2BYKA 1P3LB 1P3AA 3AZHD 4Z2MG 1AOIC 1N1JB 5GT0C 2NZDA 1R4VA 5AV6D 3TU4B 3AZJB 3MGQA 3V9RB 4NE6A 3O62A 3W98C 5CPIC 5AV5D 5AVCD 5B1MB 1Q9CA 1P34A 3AV2D 4XZQA 3LZ0C 3MGPD 5B31G 5B31B 5B2IC 3WTPA 3LZ1C 1EQZA 1BH8A 2FJ7B 5F99A 3WKJB 5B24B 1KX5D 1M18A 3B0BA 3X1VC 2NQBA 1HQ3C 2YFVA 3REKB 4H9SC 3X1SD 3B6FA 5BT1D 4QLCB 2F8NH 1P3OC 3REIA 4YM6C 3WA9D 4H9QA 5CPIB 4YS3C 5B31D 3AZLC 3REJA 1P3IB 4AWLC 2FJ7D 5B2IB 5B0YC 4WU9A 3LZ1B 4Z66D 3AZGC 4JJNB 5B0ZD 3X1VB 3NQUB 1HQ3B 5B32A 4J8VB 1P3MB 4XUJC 3A6NC 3X1UA 5DNNB 3AYWA 3AZNC 1P3OB 4KUDB 1P3AC 4E45A 1P3ID 5CPJD 2NZDC 4CSRA 4J8UD 4AWLB 3MGQC 1S32C 3O62C 3AZGB 4JJND 5JA4A 5CP6D 1P34C 4J8VD 4HGAC 3UT9B 5AV6A 4XZQC 5DNND 3WTPC 2HIOD 4KUDD 4XUJB 5BNVB 5F99C 3A6NB 5AV5A 5AVCA 3UTBA 3UTAD 1M18C 1P3AB 3WAAB 2NQBC 3MGPA 3AZKD 1WWIA 2NZDB 3KWQD 5E5AD 3B6FC 3MGQB 5GSUA 1S32B 3REIC 3W96A 1KX5A 5GT3A 3UT9D 1P3KD 1TZYD 3B6GB 1WWSA 3AZFD 4H9OA 3VH5A 5KDMB 3REJC 1P34B 4HGAB 5B33D 3C1CA 4WU9C 3X1SA 3MVDA 2BYMB 3B0CW 3C1BD 3WAAD 4J8WC 3AN2B 3AZMA 1M18B 4G91C 5BNXA 4CAYA 5AV9D 5B2JD 1ULYA 3AFAD 4WU8C 3X1UC 4R8PB 1P3GB 3AYWC 3REIB 4J8XA 3R45A 5B0ZA 5CPKD 4NE3A 4LD9A 2CV5D 1M19A 1KX3C 1P3FB 5G49A 1P3BD 4X23A 4J8WB 3MGSA 1F66D 4G91B 4KGCD 5B40B 1P3GD 1H3OA 3MNNA 1P3PA 4WU8B 3UTBC 1M1AB 5CP6A 1B67A 3RELA 3LJAD 1BH9A 1P3FD 1ZLAA 5GSUC 4E44A 1KX3B 3UTAA 3W96C 5GT3C 3AV1B 5B40D 4H9RA 3AZKA 3KWQA 3REHA 3C1CC 3MVDC 3X1SC 2F8NG 1M1AD 5DNMA 3KXBA 4Z5TB 2PYOA 5AY8A 3W99A 5B1LA 5BO0B 3MGRA 1P3KA 1A7WA 1TZYA 3B0DC 5GXQA 4G92B 3UTBB 3AZMC 3AZFA 1KX4D 1P3LD 2YFWA 3C1BA 3TU4D 2L5AA 4H9PA 3AV1D 1AOIB 3AZJD 3AZIC 3W96B 4J8XC 5GT0B 3X1TA 1ID3A 5AV9A 3LELA 5B1MD 4LD9C 3AZEA 3W98B 5B2JA 3AFAA 1M19C 3W97C 5AV8C 4X23C 3B0DB 3LZ0B 3AZMB 5CPKA 3MGSC 3WKJD 5B24D 4KHAB 3MNNC 2AROA 3REKD 1P3PC 5GT0D 4EO5C 4UUZA 3AZIB 3KSYA 4QLCD 3KUYA 4J8XB 4WNNB 3RELC 3R45B 1F66A 5AVBA 4KGCA 5CPID 4ZUXA 3VH5T 1ZLAC 4YM6B 3W97B 3LZ0D 4YS3B 5B2ID 3UTAC 3AZLB 3NQJA 4H9NA 4M6BA 5JRGA 3LZ1D 1U35A 1JFIA 2F8NB 5AV8B 5FUGB 5B0YB 3MGSB 2IO5C 3KWQC 3REHC 3AZHA 3X1VD 5DNMC 3KXBC 2PYOC 1HQ3D 5AY8C 3W99C 3MNNB 2HUEC 5B1LC 3MGRC 1P3MD 4DRBA 5GXQC 1P3OD 1EQZC 4YM6D 4YS3D 2F8ND 3AZNB 2BYKB 3VH6W 3AV2A 5B0YD 3X1TC 3AZGD 1ID3C 1P3LA 1HTAA 3LELC 1N1JA 3O62B 2IO5B 3AZEC 3TU4A 5DNMB 3AZJA 2HUEB 3V9RA 4DRAA 5GXQB 4XUJD 4XZQB 3A6ND 3WTPB 3AZND 5B1MA 1EQZB 1BH8B 1P3AD 5F99B 3WA9A 2AROC 5B31A 2NZDD 4H9PB 2NQBB 2FJ7A 3MGQD 2YFVB 3KUYC 1S32D 5B32C 3O62D 1B6WA 3X1TB 4Z66A 5AVBC 3B6FB 4KGCC 4ZUXC 3B6GD 3LELB 3AZEB 3REKA 1P34D 4H9QB 4XZQD 1U35C 5JRGC 4QLCA 3REJB 2RVQC 1TAFA 4NFTA 4WU9B 3AN2D 1M18D 3AZHC 1P3IA 2NQBD 5CPJA 2AROB 4ZBJC 5AV6C 4J8UA 4R8PD 3KUYB 5B32G 5B32B 3REID 3WTPE 4JJNA 3X1UB 5AV5C 5AVCC 3AYWB 1HQ3A 4H9SA 4J8VA 3AV2C 1P3MA 4Z2MH 4WU9D 1U35B 3MGPC 5JRGB 5DNNA 1JFIB 2HIOA 1F1EA 4CSRB 4KUDA 2F8NK 4J8WD 1KX5C 3TU4C 5JA4B 3AZHB 4ZBJB 5AV6B 3AZGA 5E5AA 4WU8D 3X1UD 5BT1C 3AYWD 3UT9A 3WA9C 5AV5B 5AVCB 5B31C 3AV2B 4WV4B 2FJ7C 5B33A 3MGPB 1KX3D 4Z66C 3WAAA 5GSUB 3REKC 5GT3B 1KX5B 5B0ZC 4H9OB 4QLCC 4Z5TD 1S32A 3C1CB 3X1SB 3MVDB 3B0CT 3B6GA 3UTBD 5KDMA 1P3IC 3WA9B 4NE5A 5CPJC 2BYMA 4J8UC 4CAYB 5BNXB 2CV5A 5GSUD 1AOID 3AN2A 3W96D 4Z66B 5GT3D 4JJNC 1P3BA 5BS7A 5CP6C 4J8VC 3W98D 1P3MC 5B0ZB 3C1CD 3VH6A 3MVDD 4R8PA 5DNNC 2HIOC 1P3GA 4KUDC 1TAFB 4LD9B 1M19B 2JSSA 3AZMD 5G49B 4X23B 3LJAA 5CPJB 3AZKC 4J8UB 1P3FA 5E5AC 4J8WA 1H3OB 3AZID 4J8XD 1P3PB 4EO5B 3UT9C 1P3KC 1TZYC 3AZFC 5B40A 5CP6B 3RELB 4LD9D 5C3IC 1BH9B 1M19D 5B33C 3W97D 4WU8A 2HIOB 1M1AA 3AZLD 1ZLAB 3C1BC 3WAAC 5AV8D 4X23D 1KU5A 3UTAB 3MGSD 1KX4A 2CWEA 4H9RB 5AV9C 3AZKB 1KX3A 3MNND 3KWQB 3REHB 5B2JC 3AFAC 5E5AB 1P3PD 3B6GC 3AV1A 3KXBB 2PYOB 5AY8B 3W99B 3RELD 5B1LB 3MGRB 1P3KB 1TZYB 3AZFB 5CPKC 4Z5TA 5C3IB 1ZLAD 2CV5C 5B33B 5BO0A 2YFWB 3AN2C 3C1BB 1P3BC 5BS7C 3WKJA 5B24A 3REHD 1ID3B 1F66C 4R8PC 5AV9B 1P3GC 5DNMD 3KXBD 1AOIA 2PYOD 5AY8D 3W99D 5B2JB 3AFAB 5B1LD 5GT0A 3MGRD 5GXQD 1BFMA 3WTPD 1EQZD 3LJAC 3W98A 5F99D 5CPKB 5CPIA 1P3FC 2CV5B 3LZ0A 5B2IA 4UUZB 3X1TD 3LZ1A 1ID3D 1P3BB 4KHAA 3B6FD 5B40C 3LELD 3AZED 1F66B 5AVBB 4KGCB 4ZUXB 3X1VA 1M1AC 3NQUA 3AZIA 3REJD 4WNNA 3NQJB 4H9NB 1KX4C 1P3OA 3LJAB 1P3LC 4YM6A 3W97A 3VH5W 4YS3A 2AROD 4WZSB
chains in the Genus database with same CATH superfamily
3AZLA 2F8NA 2Y2QA 3AV1C 5AV8A 2JCHA 3AZJC 5FUGA 3KUYD 5B0YA 5B32D 5AVBD 4ZUXD 5B1MC 2LY8A 4Z5TC 3VH6T 4G92C 1U35D 5JRGD 5CHLB 2VQRA 2RVQD 4XUJA 5BNVA 3A6NA 3WKJC 5B24C 1KX4B 3AZNA 2BYKA 1P3LB 1P3AA 3AZHD 4Z2MG 1AOIC 1N1JB 5GT0C 2NZDA 1R4VA 5AV6D 3TU4B 3AZJB 3MGQA 3V9RB 4NE6A 3F6TA 3O62A 3W98C 5CPIC 3H0RC 5AV5D 5AVCD 5B1MB 1Q9CA 1P34A 3AV2D 4XZQA 3LZ0C 3MGPD 5B31G 5B31B 5B2IC 3WTPA 3LZ1C 1EQZA 1BH8A 2FJ7B 5F99A 3WKJB 5B24B 2G5HC 1KX5D 1M18A 3P5JB 3B0BA 3X1VC 2NQBA 1HQ3C 2YFVA 3REKB 4H9SC 3X1SD 3B6FA 5BT1D 4QLCB 2F8NH 1P3OC 3REIA 4YM6C 3WA9D 4H9QA 5CPIB 4YS3C 5B31D 3AZLC 3REJA 1P3IB 4AWLC 2FJ7D 5B2IB 5B0YC 3FDDA 4WU9A 3LZ1B 4Z66D 3AZGC 2ZY4A 2RIQA 3A1KA 4JJNB 5B0ZD 3X1VB 3NQUB 1HQ3B 5B32A 4J8VB 1P3MB 4XUJC 3A6NC 3X1UA 5DNNB 3AYWA 3AZNC 1P3OB 4KUDB 1P3AC 4E45A 1P3ID 5CPJD 2NZDC 4CSRA 4J8UD 4AWLB 3MGQC 1S32C 3O62C 3AZGB 4JJND 5JA4A 3EPHA 5CP6D 1P34C 4J8VD 4HGAC 3UT9B 5AV6A 4XZQC 5DNND 3WTPC 2HIOD 4KUDD 4XUJB 5BNVB 5F99C 3A6NB 5AV5A 5AVCA 3UTBA 3UTAD 1M18C 1P3AB 3WAAB 2NQBC 3MGPA 3AZKD 1WWIA 2NZDB 3KWQD 5E5AD 3B6FC 3MGQB 5GSUA 1S32B 3REIC 3W96A 1KX5A 5GT3A 3UT9D 1P3KD 1TZYD 2Y2MA 1T3UA 3B6GB 1WWSA 3AZFD 4H9OA 2ZY3A 3VH5A 5KDMB 3REJC 1P34B 4HGAB 5B33D 3C1CA 4WU9C 3X1SA 3MVDA 2BYMB 3B0CW 3C1BD 3WAAD 4J8WC 2Y2NA 3AN2B 3AZMA 1M18B 4G91C 3EPKA 5BNXA 4CAYA 5AV9D 5B2JD 1ULYA 2JE5A 2Y2OA 3AFAD 4WU8C 2Y2GA 3X1UC 4R8PB 1P3GB 3AYWC 3REIB 4J8XA 3R45A 5B0ZA 5CPKD 4NE3A 4LD9A 2XD5A 2CV5D 1M19A 1KX3C 1W2EA 1P3FB 5G49A 1P3BD 4X23A 4J8WB 3MGSA 1F66D 4G91B 4KGCD 5B40B 1P3GD 1H3OA 3MNNA 1P3PA 4WU8B 3UTBC 1M1AB 5CP6A 1B67A 3RELA 3LJAD 1BH9A 1P3FD 1ZLAA 5GSUC 4E44A 1KX3B 3UTAA 3W96C 5GT3C 3AV1B 5B40D 4H9RA 3AZKA 3KWQA 3REHA 3C1CC 3MVDC 3X1SC 2F8NG 1M1AD 5DNMA 3KXBA 4Z5TB 2PYOA 5AY8A 3W99A 5B1LA 5BO0B 3MGRA 1P3KA 1A7WA 1TZYA 3B0DC 5GXQA 4G92B 3UTBB 2XD1A 2Y2HA 3AZMC 3AZFA 1KX4D 1P3LD 1PZRA 2YFWA 3C1BA 3TU4D 2G5IC 2L5AA 4H9PA 3AV1D 1AOIB 3AZJD 3AZIC 3W96B 4J8XC 5GT0B 2J8PA 3X1TA 1ID3A 5AV9A 3LELA 5B1MD 4LD9C 3AZEA 3W98B 5B2JA 3AFAA 1M19C 3W97C 5AV8C 4X23C 3B0DB 3LZ0B 3AZMB 5CPKA 3MGSC 3WKJD 5B24D 4KHAB 3MNNC 2AROA 3REKD 1P3PC 5GT0D 4EO5C 4UUZA 3AL0C 3AZIB 3KSYA 4QLCD 3KUYA 4J8XB 4DQYB 4WNNB 3RELC 2ZY2A 3R45B 1F66A 5AVBA 4KGCA 5CPID 4ZUXA 3VH5T 1ZLAC 4YM6B 3W97B 3LZ0D 4YS3B 5B2ID 3EPLA 3UTAC 3NQJA 4H9NA 4M6BA 5JRGA 3LZ1D 3AZLB 1U35A 1JFIA 2F8NB 5AV8B 2Y2LA 5FUGB 5B0YB 3MGSB 2FFFB 2IO5C 3KWQC 3REHC 4WJ3C 3AZHA 3X1VD 5DNMC 3KXBC 2PYOC 1HQ3D 5AY8C 3W99C 3MNNB 2HUEC 5B1LC 3MGRC 1P3MD 4DRBA 5GXQC 1P3OD 1EQZC 4YM6D 4YS3D 2F8ND 3AZNB 2BYKB 3VH6W 3AV2A 5B0YD 3X1TC 3AZGD 2Y2KA 1P3LA 1ID3C 1HTAA 3LELC 1N1JA 3O62B 2IO5B 3AZEC 3TU4A 5DNMB 3AZJA 2HUEB 3V9RA 4DRAA 5GXQB 4XUJD 4XZQB 3A6ND 3WTPB 3AZND 5B1MA 1EQZB 1BH8B 1P3AD 5F99B 3WA9A 2AROC 5B31A 2NZDD 4H9PB 2NQBB 2FJ7A 3MGQD 2YFVB 3KUYC 1S32D 5B32C 3O62D 1B6WA 3X1TB 4Z66A 5AVBC 3B6FB 4KGCC 4ZUXC 3B6GD 3LELB 3AZEB 3REKA 1P34D 4H9QB 4XZQD 1U35C 5JRGC 4QLCA 3REJB 2ZY5A 2RVQC 1TAFA 2DQNC 4NFTA 4WU9B 2Y2IA 3AN2D 1M18D 4UPKA 3AZHC 1P3IA 2NQBD 5CPJA 2AROB 4ZBJC 3EPJA 5AV6C 4J8UA 1Z2CB 4R8PD 3KUYB 5B32G 5B32B 3REID 3WTPE 4JJNA 3X1UB 5AV5C 5AVCC 3AYWB 1HQ3A 4H9SA 4J8VA 3AV2C 1P3MA 4Z2MH 4WU9D 1U35B 3MGPC 5JRGB 5DNNA 1JFIB 2HIOA 1F1EA 4CSRB 4KUDA 2F8NK 2F2AC 4J8WD 1KX5C 3TU4C 5JA4B 3AZHB 4ZBJB 5AV6B 3AZGA 5E5AA 4WU8D 3X1UD 5BT1C 3AYWD 3UT9A 3WA9C 5AV5B 5AVCB 5B31C 3IP4C 3AV2B 4WV4B 2FJ7C 5B33A 3MGPB 1KX3D 4Z66C 3WAAA 5GSUB 2Y2JA 3REKC 5GT3B 1KX5B 3KFUG 5B0ZC 4H9OB 4QLCC 4Z5TD 1S32A 3C1CB 3X1SB 3MVDB 3B0CT 3B6GA 3UTBD 5KDMA 1P3IC 3WA9B 4NE5A 5CPJC 2BYMA 4J8UC 4CAYB 5BNXB 2CV5A 5GSUD 1AOID 3AN2A 3W96D 4Z66B 5GT3D 4JJNC 1P3BA 5BS7A 5CP6C 4J8VC 3W98D 1P3MC 5B0ZB 3C1CD 3VH6A 3MVDD 4R8PA 5DNNC 2HIOC 1P3GA 4KUDC 1TAFB 4LD9B 3EG5B 1M19B 2JSSA 3AZMD 5G49B 4X23B 3LJAA 5CPJB 3AZKC 4J8UB 1P3FA 5E5AC 3H0MC 4J8WA 1H3OB 3AZID 4J8XD 1P3PB 4EO5B 3UT9C 1P3KC 1TZYC 2Y2PA 3AZFC 5B40A 5CP6B 3RELB 4LD9D 5C3IC 1BH9B 1M19D 2W8SA 5B33C 4WU8A 3W97D 2HIOB 1M1AA 3AZLD 1ZLAB 3C1BC 3WAAC 5AV8D 4X23D 1KU5A 3UTAB 3MGSD 1KX4A 2CWEA 4H9RB 5AV9C 3AZKB 1KX3A 3MNND 3KWQB 3REHB 5B2JC 3AFAC 5E5AB 1P3PD 3B6GC 3AV1A 3KXBB 2PYOB 5AY8B 3W99B 3RELD 5B1LB 3MGRB 1P3KB 1TZYB 3AZFB 5CPKC 2UWXA 4Z5TA 5C3IB 1ZLAD 2CV5C 5B33B 3H0LC 5BO0A 2YFWB 3AN2C 3C1BB 1P3BC 5BS7C 2ZM5A 3WKJA 5B24A 3REHD 1ID3B 1F66C 4R8PC 5AV9B 1P3GC 5DNMD 3KXBD 1AOIA 2PYOD 5AY8D 3W99D 5B2JB 3AFAB 5B1LD 5GT0A 3MGRD 5GXQD 1BFMA 3WTPD 1EQZD 3LJAC 3W98A 5F99D 5CPKB 5CPIA 1P3FC 2CV5B 2DF4C 3LZ0A 5B2IA 4UUZB 3X1TD 3LZ1A 1ID3D 1P3BB 4KHAA 3B6FD 5B40C 3LELD 3AZED 1F66B 5AVBB 4KGCB 4ZUXB 3X1VA 1M1AC 3NQUA 3AZIA 3REJD 3A1IA 4WNNA 3NQJB 4H9NB 1KX4C 1P3OA 3LJAB 1P3LC 4YM6A 3W97A 3VH5W 4YS3A 2AROD 2BG1A 4WZSB
chains in the Genus database with same CATH topology
3AZLA 2F8NA 2Y2QA 3AV1C 5AV8A 2JCHA 3AZJC 5FUGA 3KUYD 5B0YA 5B32D 5AVBD 4ZUXD 5B1MC 2LY8A 4Z5TC 3VH6T 4G92C 1U35D 5JRGD 5CHLB 2VQRA 2RVQD 4XUJA 5BNVA 3A6NA 3WKJC 5B24C 1KX4B 3AZNA 2BYKA 1P3LB 1P3AA 3AZHD 4Z2MG 1AOIC 1N1JB 5GT0C 2NZDA 1R4VA 5AV6D 3TU4B 3AZJB 3MGQA 3V9RB 4NE6A 3F6TA 3O62A 3W98C 5CPIC 3H0RC 5AV5D 5AVCD 5B1MB 1Q9CA 1P34A 3AV2D 4XZQA 3LZ0C 3MGPD 5B31G 5B31B 5B2IC 3WTPA 3LZ1C 1EQZA 1BH8A 2FJ7B 5F99A 3WKJB 5B24B 2G5HC 1KX5D 1M18A 3P5JB 3B0BA 3X1VC 2NQBA 1HQ3C 2YFVA 3REKB 4H9SC 3X1SD 3B6FA 5BT1D 4QLCB 2F8NH 1P3OC 3REIA 4YM6C 3WA9D 4H9QA 5CPIB 4YS3C 5B31D 3AZLC 3REJA 1P3IB 4AWLC 2FJ7D 5B2IB 5B0YC 3FDDA 4WU9A 3LZ1B 4Z66D 3AZGC 2ZY4A 2RIQA 3A1KA 4JJNB 5B0ZD 3X1VB 3NQUB 1HQ3B 5B32A 4J8VB 1P3MB 4XUJC 3A6NC 3X1UA 5DNNB 3AYWA 3AZNC 1P3OB 4KUDB 1P3AC 4E45A 1P3ID 5CPJD 2NZDC 4CSRA 4J8UD 4AWLB 3MGQC 1S32C 3O62C 3AZGB 4JJND 5JA4A 3EPHA 5CP6D 1P34C 4J8VD 4HGAC 3UT9B 5AV6A 4XZQC 5DNND 3WTPC 2HIOD 4KUDD 4XUJB 5BNVB 5F99C 3A6NB 5AV5A 5AVCA 3UTBA 3UTAD 1M18C 1P3AB 3WAAB 2NQBC 3MGPA 3AZKD 1WWIA 2NZDB 3KWQD 5E5AD 3B6FC 3MGQB 5GSUA 1S32B 3REIC 3W96A 1KX5A 5GT3A 3UT9D 1P3KD 1TZYD 2Y2MA 1T3UA 3B6GB 1WWSA 3AZFD 4H9OA 2ZY3A 3VH5A 5KDMB 3REJC 1P34B 4HGAB 5B33D 3C1CA 4WU9C 3X1SA 3MVDA 2BYMB 3B0CW 3C1BD 3WAAD 4J8WC 2Y2NA 3AN2B 3AZMA 1M18B 4G91C 3EPKA 5BNXA 4CAYA 5AV9D 5B2JD 1ULYA 2JE5A 2Y2OA 3AFAD 4WU8C 2Y2GA 3X1UC 4R8PB 1P3GB 3AYWC 3REIB 4J8XA 3R45A 5B0ZA 5CPKD 4NE3A 4LD9A 2XD5A 2CV5D 1M19A 1KX3C 1W2EA 1P3FB 5G49A 1P3BD 4X23A 4J8WB 3MGSA 1F66D 4G91B 4KGCD 5B40B 1P3GD 1H3OA 3MNNA 1P3PA 4WU8B 3UTBC 1M1AB 5CP6A 1B67A 3RELA 3LJAD 1BH9A 1P3FD 1ZLAA 5GSUC 4E44A 1KX3B 3UTAA 3W96C 5GT3C 3AV1B 5B40D 4H9RA 3AZKA 3KWQA 3REHA 3C1CC 3MVDC 3X1SC 2F8NG 1M1AD 5DNMA 3KXBA 4Z5TB 2PYOA 5AY8A 3W99A 5B1LA 5BO0B 3MGRA 1P3KA 1A7WA 1TZYA 3B0DC 5GXQA 4G92B 3UTBB 2XD1A 2Y2HA 3AZMC 3AZFA 1KX4D 1P3LD 1PZRA 2YFWA 3C1BA 3TU4D 2G5IC 2L5AA 4H9PA 3AV1D 1AOIB 3AZJD 3AZIC 3W96B 4J8XC 5GT0B 2J8PA 3X1TA 1ID3A 5AV9A 3LELA 5B1MD 4LD9C 3AZEA 3W98B 5B2JA 3AFAA 1M19C 3W97C 5AV8C 4X23C 3B0DB 3LZ0B 3AZMB 5CPKA 3MGSC 3WKJD 5B24D 4KHAB 3MNNC 2AROA 3REKD 1P3PC 5GT0D 4EO5C 4UUZA 3AL0C 3AZIB 3KSYA 4QLCD 3KUYA 4J8XB 4DQYB 4WNNB 3RELC 2ZY2A 3R45B 1F66A 5AVBA 4KGCA 5CPID 4ZUXA 3VH5T 1ZLAC 4YM6B 3W97B 3LZ0D 4YS3B 5B2ID 3EPLA 3UTAC 3NQJA 4H9NA 4M6BA 5JRGA 3LZ1D 3AZLB 1U35A 1JFIA 2F8NB 5AV8B 2Y2LA 5FUGB 5B0YB 3MGSB 2FFFB 2IO5C 3KWQC 3REHC 4WJ3C 3AZHA 3X1VD 5DNMC 3KXBC 2PYOC 1HQ3D 5AY8C 3W99C 3MNNB 2HUEC 5B1LC 3MGRC 1P3MD 4DRBA 5GXQC 1P3OD 1EQZC 4YM6D 4YS3D 2F8ND 3AZNB 2BYKB 3VH6W 3AV2A 5B0YD 3X1TC 3AZGD 2Y2KA 1P3LA 1ID3C 1HTAA 3LELC 1N1JA 3O62B 2IO5B 3AZEC 3TU4A 5DNMB 3AZJA 2HUEB 3V9RA 4DRAA 5GXQB 4XUJD 4XZQB 3A6ND 3WTPB 3AZND 5B1MA 1EQZB 1BH8B 1P3AD 5F99B 3WA9A 2AROC 5B31A 2NZDD 4H9PB 2NQBB 2FJ7A 3MGQD 2YFVB 3KUYC 1S32D 5B32C 3O62D 1B6WA 3X1TB 4Z66A 5AVBC 3B6FB 4KGCC 4ZUXC 3B6GD 3LELB 3AZEB 3REKA 1P34D 4H9QB 4XZQD 1U35C 5JRGC 4QLCA 3REJB 2ZY5A 2RVQC 1TAFA 2DQNC 4NFTA 4WU9B 2Y2IA 3AN2D 1M18D 4UPKA 3AZHC 1P3IA 2NQBD 5CPJA 2AROB 4ZBJC 3EPJA 5AV6C 4J8UA 1Z2CB 4R8PD 3KUYB 5B32G 5B32B 3REID 3WTPE 4JJNA 3X1UB 5AV5C 5AVCC 3AYWB 1HQ3A 4H9SA 4J8VA 3AV2C 1P3MA 4Z2MH 4WU9D 1U35B 3MGPC 5JRGB 5DNNA 1JFIB 2HIOA 1F1EA 4CSRB 4KUDA 2F8NK 2F2AC 4J8WD 1KX5C 3TU4C 5JA4B 3AZHB 4ZBJB 5AV6B 3AZGA 5E5AA 4WU8D 3X1UD 5BT1C 3AYWD 3UT9A 3WA9C 5AV5B 5AVCB 5B31C 3IP4C 3AV2B 4WV4B 2FJ7C 5B33A 3MGPB 1KX3D 4Z66C 3WAAA 5GSUB 2Y2JA 3REKC 5GT3B 1KX5B 3KFUG 5B0ZC 4H9OB 4QLCC 4Z5TD 1S32A 3C1CB 3X1SB 3MVDB 3B0CT 3B6GA 3UTBD 5KDMA 1P3IC 3WA9B 4NE5A 5CPJC 2BYMA 4J8UC 4CAYB 5BNXB 2CV5A 5GSUD 1AOID 3AN2A 3W96D 4Z66B 5GT3D 4JJNC 1P3BA 5BS7A 5CP6C 4J8VC 3W98D 1P3MC 5B0ZB 3C1CD 3VH6A 3MVDD 4R8PA 5DNNC 2HIOC 1P3GA 4KUDC 1TAFB 4LD9B 3EG5B 1M19B 2JSSA 3AZMD 5G49B 4X23B 3LJAA 5CPJB 3AZKC 4J8UB 1P3FA 5E5AC 3H0MC 4J8WA 1H3OB 3AZID 4J8XD 1P3PB 4EO5B 3UT9C 1P3KC 1TZYC 2Y2PA 3AZFC 5B40A 5CP6B 3RELB 4LD9D 5C3IC 1BH9B 1M19D 2W8SA 5B33C 4WU8A 3W97D 2HIOB 1M1AA 3AZLD 1ZLAB 3C1BC 3WAAC 5AV8D 4X23D 1KU5A 3UTAB 3MGSD 1KX4A 2CWEA 4H9RB 5AV9C 3AZKB 1KX3A 3MNND 3KWQB 3REHB 5B2JC 3AFAC 5E5AB 1P3PD 3B6GC 3AV1A 3KXBB 2PYOB 5AY8B 3W99B 3RELD 5B1LB 3MGRB 1P3KB 1TZYB 3AZFB 5CPKC 2UWXA 4Z5TA 5C3IB 1ZLAD 2CV5C 5B33B 3H0LC 5BO0A 2YFWB 3AN2C 3C1BB 1P3BC 5BS7C 2ZM5A 3WKJA 5B24A 3REHD 1ID3B 1F66C 4R8PC 5AV9B 1P3GC 5DNMD 3KXBD 1AOIA 2PYOD 5AY8D 3W99D 5B2JB 3AFAB 5B1LD 5GT0A 3MGRD 5GXQD 1BFMA 3WTPD 1EQZD 3LJAC 3W98A 5F99D 5CPKB 5CPIA 1P3FC 2CV5B 2DF4C 3LZ0A 5B2IA 4UUZB 3X1TD 3LZ1A 1ID3D 1P3BB 4KHAA 3B6FD 5B40C 3LELD 3AZED 1F66B 5AVBB 4KGCB 4ZUXB 3X1VA 1M1AC 3NQUA 3AZIA 3REJD 3A1IA 4WNNA 3NQJB 4H9NB 1KX4C 1P3OA 3LJAB 1P3LC 4YM6A 3W97A 3VH5W 4YS3A 2AROD 2BG1A 4WZSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  2F8N A;  3AV1 C;  5AV8 A;  3AZJ C;  5FUG A;  3KUY D;  5B0Y A;  5B32 D;  5AVB D;  4ZUX D;  5B1M C;  2LY8 A;  4Z5T C;  3VH6 T;  4G92 C;  1U35 D;  5JRG D;  5CHL B;  2RVQ D;  4XUJ A;  5BNV A;  3A6N A;  3WKJ C;  5B24 C;  1KX4 B;  3AZN A;  2BYK A;  1P3L B;  1P3A A;  3AZH D;  4Z2M G;  1AOI C;  1N1J B;  5GT0 C;  2NZD A;  1R4V A;  5AV6 D;  3TU4 B;  3AZJ B;  3MGQ A;  3V9R B;  4NE6 A;  3O62 A;  3W98 C;  5CPI C;  5AV5 D;  5AVC D;  5B1M B;  1Q9C A;  1P34 A;  3AV2 D;  4XZQ A;  3LZ0 C;  3MGP D;  5B31 G;  5B31 B;  5B2I C;  3WTP A;  3LZ1 C;  1EQZ A;  1BH8 A;  2FJ7 B;  5F99 A;  3WKJ B;  5B24 B;  1KX5 D;  1M18 A;  3B0B A;  3X1V C;  2NQB A;  1HQ3 C;  2YFV A;  3REK B;  4H9S C;  3X1S D;  3B6F A;  5BT1 D;  4QLC B;  2F8N H;  1P3O C;  3REI A;  4YM6 C;  3WA9 D;  4H9Q A;  5CPI B;  4YS3 C;  5B31 D;  3AZL C;  3REJ A;  1P3I B;  4AWL C;  2FJ7 D;  5B2I B;  5B0Y C;  4WU9 A;  3LZ1 B;  4Z66 D;  3AZG C;  4JJN B;  5B0Z D;  3X1V B;  3NQU B;  1HQ3 B;  5B32 A;  4J8V B;  1P3M B;  4XUJ C;  3A6N C;  3X1U A;  5DNN B;  3AYW A;  3AZN C;  1P3O B;  4KUD B;  1P3A C;  4E45 A;  1P3I D;  5CPJ D;  2NZD C;  4CSR A;  4J8U D;  4AWL B;  3MGQ C;  1S32 C;  3O62 C;  3AZG B;  4JJN D;  5JA4 A;  5CP6 D;  1P34 C;  4J8V D;  4HGA C;  3UT9 B;  5AV6 A;  4XZQ C;  5DNN D;  3WTP C;  2HIO D;  4KUD D;  4XUJ B;  5BNV B;  5F99 C;  3A6N B;  5AV5 A;  5AVC A;  3UTB A;  3UTA D;  1M18 C;  1P3A B;  3WAA B;  2NQB C;  3MGP A;  3AZK D;  1WWI A;  2NZD B;  3KWQ D;  5E5A D;  3B6F C;  3MGQ B;  5GSU A;  1S32 B;  3REI C;  3W96 A;  1KX5 A;  5GT3 A;  3UT9 D;  1P3K D;  1TZY D;  3B6G B;  1WWS A;  3AZF D;  4H9O A;  3VH5 A;  5KDM B;  3REJ C;  1P34 B;  4HGA B;  5B33 D;  3C1C A;  4WU9 C;  3X1S A;  3MVD A;  2BYM B;  3B0C W;  3C1B D;  3WAA D;  4J8W C;  3AN2 B;  3AZM A;  1M18 B;  4G91 C;  5BNX A;  4CAY A;  5AV9 D;  5B2J D;  1ULY A;  3AFA D;  4WU8 C;  3X1U C;  4R8P B;  1P3G B;  3AYW C;  3REI B;  4J8X A;  3R45 A;  5B0Z A;  5CPK D;  4NE3 A;  4LD9 A;  2CV5 D;  1M19 A;  1KX3 C;  1P3F B;  5G49 A;  1P3B D;  4X23 A;  4J8W B;  3MGS A;  1F66 D;  4G91 B;  4KGC D;  5B40 B;  1P3G D;  1H3O A;  3MNN A;  1P3P A;  4WU8 B;  3UTB C;  1M1A B;  5CP6 A;  1B67 A;  3REL A;  3LJA D;  1BH9 A;  1P3F D;  1ZLA A;  5GSU C;  4E44 A;  1KX3 B;  3UTA A;  3W96 C;  5GT3 C;  3AV1 B;  5B40 D;  4H9R A;  3AZK A;  3KWQ A;  3REH A;  3C1C C;  3MVD C;  3X1S C;  2F8N G;  1M1A D;  5DNM A;  3KXB A;  4Z5T B;  2PYO A;  5AY8 A;  3W99 A;  5B1L A;  5BO0 B;  3MGR A;  1P3K A;  1A7W A;  1TZY A;  3B0D C;  5GXQ A;  4G92 B;  3UTB B;  3AZM C;  3AZF A;  1KX4 D;  1P3L D;  2YFW A;  3C1B A;  3TU4 D;  2L5A A;  4H9P A;  3AV1 D;  1AOI B;  3AZJ D;  3AZI C;  3W96 B;  4J8X C;  5GT0 B;  3X1T A;  1ID3 A;  5AV9 A;  3LEL A;  5B1M D;  4LD9 C;  3AZE A;  3W98 B;  5B2J A;  3AFA A;  1M19 C;  3W97 C;  5AV8 C;  4X23 C;  3B0D B;  3LZ0 B;  3AZM B;  5CPK A;  3MGS C;  3WKJ D;  5B24 D;  4KHA B;  3MNN C;  2ARO A;  3REK D;  1P3P C;  5GT0 D;  4EO5 C;  4UUZ A;  3AZI B;  3KSY A;  4QLC D;  3KUY A;  4J8X B;  4WNN B;  3REL C;  3R45 B;  1F66 A;  5AVB A;  4KGC A;  5CPI D;  4ZUX A;  3VH5 T;  1ZLA C;  4YM6 B;  3W97 B;  3LZ0 D;  4YS3 B;  5B2I D;  3UTA C;  3AZL B;  3NQJ A;  4H9N A;  4M6B A;  5JRG A;  3LZ1 D;  1U35 A;  1JFI A;  2F8N B;  5AV8 B;  5FUG B;  5B0Y B;  3MGS B;  2IO5 C;  3KWQ C;  3REH C;  3AZH A;  3X1V D;  5DNM C;  3KXB C;  2PYO C;  1HQ3 D;  5AY8 C;  3W99 C;  3MNN B;  2HUE C;  5B1L C;  3MGR C;  1P3M D;  4DRB A;  5GXQ C;  1P3O D;  1EQZ C;  4YM6 D;  4YS3 D;  2F8N D;  3AZN B;  2BYK B;  3VH6 W;  3AV2 A;  5B0Y D;  3X1T C;  3AZG D;  1ID3 C;  1P3L A;  1HTA A;  3LEL C;  1N1J A;  3O62 B;  2IO5 B;  3AZE C;  3TU4 A;  5DNM B;  3AZJ A;  2HUE B;  3V9R A;  4DRA A;  5GXQ B;  4XUJ D;  4XZQ B;  3A6N D;  3WTP B;  3AZN D;  5B1M A;  1EQZ B;  1BH8 B;  1P3A D;  5F99 B;  3WA9 A;  2ARO C;  5B31 A;  2NZD D;  4H9P B;  2NQB B;  2FJ7 A;  3MGQ D;  2YFV B;  3KUY C;  1S32 D;  5B32 C;  3O62 D;  1B6W A;  3X1T B;  4Z66 A;  5AVB C;  3B6F B;  4KGC C;  4ZUX C;  3B6G D;  3LEL B;  3AZE B;  3REK A;  1P34 D;  4H9Q B;  4XZQ D;  1U35 C;  5JRG C;  4QLC A;  3REJ B;  2RVQ C;  1TAF A;  4NFT A;  4WU9 B;  3AN2 D;  1M18 D;  3AZH C;  1P3I A;  2NQB D;  5CPJ A;  2ARO B;  4ZBJ C;  5AV6 C;  4J8U A;  4R8P D;  3KUY B;  5B32 G;  5B32 B;  3REI D;  3WTP E;  4JJN A;  3X1U B;  5AV5 C;  5AVC C;  3AYW B;  1HQ3 A;  4H9S A;  4J8V A;  3AV2 C;  1P3M A;  4Z2M H;  4WU9 D;  1U35 B;  3MGP C;  5JRG B;  5DNN A;  1JFI B;  2HIO A;  1F1E A;  4CSR B;  4KUD A;  2F8N K;  4J8W D;  1KX5 C;  3TU4 C;  5JA4 B;  3AZH B;  4ZBJ B;  5AV6 B;  3AZG A;  5E5A A;  4WU8 D;  3X1U D;  5BT1 C;  3AYW D;  3UT9 A;  3WA9 C;  5AV5 B;  5AVC B;  5B31 C;  3AV2 B;  4WV4 B;  2FJ7 C;  5B33 A;  3MGP B;  1KX3 D;  4Z66 C;  3WAA A;  5GSU B;  3REK C;  5GT3 B;  1KX5 B;  5B0Z C;  4H9O B;  4QLC C;  4Z5T D;  1S32 A;  3C1C B;  3X1S B;  3MVD B;  3B0C T;  3B6G A;  3UTB D;  5KDM A;  1P3I C;  3WA9 B;  4NE5 A;  5CPJ C;  2BYM A;  4J8U C;  4CAY B;  5BNX B;  2CV5 A;  5GSU D;  1AOI D;  3AN2 A;  3W96 D;  4Z66 B;  5GT3 D;  4JJN C;  1P3B A;  5BS7 A;  5CP6 C;  4J8V C;  3W98 D;  1P3M C;  5B0Z B;  3C1C D;  3VH6 A;  3MVD D;  4R8P A;  5DNN C;  2HIO C;  1P3G A;  4KUD C;  1TAF B;  4LD9 B;  1M19 B;  2JSS A;  3AZM D;  5G49 B;  4X23 B;  3LJA A;  5CPJ B;  3AZK C;  4J8U B;  1P3F A;  5E5A C;  4J8W A;  1H3O B;  3AZI D;  4J8X D;  1P3P B;  4EO5 B;  3UT9 C;  1P3K C;  1TZY C;  3AZF C;  5B40 A;  5CP6 B;  3REL B;  4LD9 D;  5C3I C;  1BH9 B;  1M19 D;  5B33 C;  3W97 D;  4WU8 A;  2HIO B;  1M1A A;  3AZL D;  1ZLA B;  3C1B C;  3WAA C;  5AV8 D;  4X23 D;  1KU5 A;  3UTA B;  3MGS D;  1KX4 A;  2CWE A;  4H9R B;  5AV9 C;  3AZK B;  1KX3 A;  3MNN D;  3KWQ B;  3REH B;  5B2J C;  3AFA C;  5E5A B;  1P3P D;  3B6G C;  3AV1 A;  3KXB B;  2PYO B;  5AY8 B;  3W99 B;  3REL D;  5B1L B;  3MGR B;  1P3K B;  1TZY B;  3AZF B;  5CPK C;  4Z5T A;  5C3I B;  1ZLA D;  2CV5 C;  5B33 B;  5BO0 A;  2YFW B;  3AN2 C;  3C1B B;  1P3B C;  5BS7 C;  3WKJ A;  5B24 A;  3REH D;  1ID3 B;  1F66 C;  4R8P C;  5AV9 B;  1P3G C;  5DNM D;  3KXB D;  1AOI A;  2PYO D;  5AY8 D;  3W99 D;  5B2J B;  3AFA B;  5B1L D;  5GT0 A;  3MGR D;  5GXQ D;  1BFM A;  3WTP D;  1EQZ D;  3LJA C;  3W98 A;  5F99 D;  5CPK B;  5CPI A;  1P3F C;  2CV5 B;  3LZ0 A;  5B2I A;  4UUZ B;  3X1T D;  3LZ1 A;  1ID3 D;  1P3B B;  4KHA A;  3B6F D;  5B40 C;  3LEL D;  3AZE D;  1F66 B;  5AVB B;  4KGC B;  4ZUX B;  3X1V A;  1M1A C;  3NQU A;  3AZI A;  3REJ D;  4WNN A;  3NQJ B;  4H9N B;  1KX4 C;  1P3O A;  3LJA B;  1P3L C;  4YM6 A;  3W97 A;  3VH5 W;  4YS3 A;  2ARO D;  4WZS B; 
#chains in the Genus database with same CATH topology
 3AZL A;  2F8N A;  2Y2Q A;  3AV1 C;  5AV8 A;  2JCH A;  3AZJ C;  5FUG A;  3KUY D;  5B0Y A;  5B32 D;  5AVB D;  4ZUX D;  5B1M C;  2LY8 A;  4Z5T C;  3VH6 T;  4G92 C;  1U35 D;  5JRG D;  5CHL B;  2VQR A;  2RVQ D;  4XUJ A;  5BNV A;  3A6N A;  3WKJ C;  5B24 C;  1KX4 B;  3AZN A;  2BYK A;  1P3L B;  1P3A A;  3AZH D;  4Z2M G;  1AOI C;  1N1J B;  5GT0 C;  2NZD A;  1R4V A;  5AV6 D;  3TU4 B;  3AZJ B;  3MGQ A;  3V9R B;  4NE6 A;  3F6T A;  3O62 A;  3W98 C;  5CPI C;  3H0R C;  5AV5 D;  5AVC D;  5B1M B;  1Q9C A;  1P34 A;  3AV2 D;  4XZQ A;  3LZ0 C;  3MGP D;  5B31 G;  5B31 B;  5B2I C;  3WTP A;  3LZ1 C;  1EQZ A;  1BH8 A;  2FJ7 B;  5F99 A;  3WKJ B;  5B24 B;  2G5H C;  1KX5 D;  1M18 A;  3P5J B;  3B0B A;  3X1V C;  2NQB A;  1HQ3 C;  2YFV A;  3REK B;  4H9S C;  3X1S D;  3B6F A;  5BT1 D;  4QLC B;  2F8N H;  1P3O C;  3REI A;  4YM6 C;  3WA9 D;  4H9Q A;  5CPI B;  4YS3 C;  5B31 D;  3AZL C;  3REJ A;  1P3I B;  4AWL C;  2FJ7 D;  5B2I B;  5B0Y C;  3FDD A;  4WU9 A;  3LZ1 B;  4Z66 D;  3AZG C;  2ZY4 A;  2RIQ A;  3A1K A;  4JJN B;  5B0Z D;  3X1V B;  3NQU B;  1HQ3 B;  5B32 A;  4J8V B;  1P3M B;  4XUJ C;  3A6N C;  3X1U A;  5DNN B;  3AYW A;  3AZN C;  1P3O B;  4KUD B;  1P3A C;  4E45 A;  1P3I D;  5CPJ D;  2NZD C;  4CSR A;  4J8U D;  4AWL B;  3MGQ C;  1S32 C;  3O62 C;  3AZG B;  4JJN D;  5JA4 A;  3EPH A;  5CP6 D;  1P34 C;  4J8V D;  4HGA C;  3UT9 B;  5AV6 A;  4XZQ C;  5DNN D;  3WTP C;  2HIO D;  4KUD D;  4XUJ B;  5BNV B;  5F99 C;  3A6N B;  5AV5 A;  5AVC A;  3UTB A;  3UTA D;  1M18 C;  1P3A B;  3WAA B;  2NQB C;  3MGP A;  3AZK D;  1WWI A;  2NZD B;  3KWQ D;  5E5A D;  3B6F C;  3MGQ B;  5GSU A;  1S32 B;  3REI C;  3W96 A;  1KX5 A;  5GT3 A;  3UT9 D;  1P3K D;  1TZY D;  2Y2M A;  1T3U A;  3B6G B;  1WWS A;  3AZF D;  4H9O A;  2ZY3 A;  3VH5 A;  5KDM B;  3REJ C;  1P34 B;  4HGA B;  5B33 D;  3C1C A;  4WU9 C;  3X1S A;  3MVD A;  2BYM B;  3B0C W;  3C1B D;  3WAA D;  4J8W C;  2Y2N A;  3AN2 B;  3AZM A;  1M18 B;  4G91 C;  3EPK A;  5BNX A;  4CAY A;  5AV9 D;  5B2J D;  1ULY A;  2JE5 A;  2Y2O A;  3AFA D;  4WU8 C;  2Y2G A;  3X1U C;  4R8P B;  1P3G B;  3AYW C;  3REI B;  4J8X A;  3R45 A;  5B0Z A;  5CPK D;  4NE3 A;  4LD9 A;  2XD5 A;  2CV5 D;  1M19 A;  1KX3 C;  1W2E A;  1P3F B;  5G49 A;  1P3B D;  4X23 A;  4J8W B;  3MGS A;  1F66 D;  4G91 B;  4KGC D;  5B40 B;  1P3G D;  1H3O A;  3MNN A;  1P3P A;  4WU8 B;  3UTB C;  1M1A B;  5CP6 A;  1B67 A;  3REL A;  3LJA D;  1BH9 A;  1P3F D;  1ZLA A;  5GSU C;  4E44 A;  1KX3 B;  3UTA A;  3W96 C;  5GT3 C;  3AV1 B;  5B40 D;  4H9R A;  3AZK A;  3KWQ A;  3REH A;  3C1C C;  3MVD C;  3X1S C;  2F8N G;  1M1A D;  5DNM A;  3KXB A;  4Z5T B;  2PYO A;  5AY8 A;  3W99 A;  5B1L A;  5BO0 B;  3MGR A;  1P3K A;  1A7W A;  1TZY A;  3B0D C;  5GXQ A;  4G92 B;  3UTB B;  2XD1 A;  2Y2H A;  3AZM C;  3AZF A;  1KX4 D;  1P3L D;  1PZR A;  2YFW A;  3C1B A;  3TU4 D;  2G5I C;  2L5A A;  4H9P A;  3AV1 D;  1AOI B;  3AZJ D;  3AZI C;  3W96 B;  4J8X C;  5GT0 B;  2J8P A;  3X1T A;  1ID3 A;  5AV9 A;  3LEL A;  5B1M D;  4LD9 C;  3AZE A;  3W98 B;  5B2J A;  3AFA A;  1M19 C;  3W97 C;  5AV8 C;  4X23 C;  3B0D B;  3LZ0 B;  3AZM B;  5CPK A;  3MGS C;  3WKJ D;  5B24 D;  4KHA B;  3MNN C;  2ARO A;  3REK D;  1P3P C;  5GT0 D;  4EO5 C;  4UUZ A;  3AL0 C;  3AZI B;  3KSY A;  4QLC D;  3KUY A;  4J8X B;  4DQY B;  4WNN B;  3REL C;  2ZY2 A;  3R45 B;  1F66 A;  5AVB A;  4KGC A;  5CPI D;  4ZUX A;  3VH5 T;  1ZLA C;  4YM6 B;  3W97 B;  3LZ0 D;  4YS3 B;  5B2I D;  3EPL A;  3UTA C;  3NQJ A;  4H9N A;  4M6B A;  5JRG A;  3LZ1 D;  3AZL B;  1U35 A;  1JFI A;  2F8N B;  5AV8 B;  2Y2L A;  5FUG B;  5B0Y B;  3MGS B;  2FFF B;  2IO5 C;  3KWQ C;  3REH C;  4WJ3 C;  3AZH A;  3X1V D;  5DNM C;  3KXB C;  2PYO C;  1HQ3 D;  5AY8 C;  3W99 C;  3MNN B;  2HUE C;  5B1L C;  3MGR C;  1P3M D;  4DRB A;  5GXQ C;  1P3O D;  1EQZ C;  4YM6 D;  4YS3 D;  2F8N D;  3AZN B;  2BYK B;  3VH6 W;  3AV2 A;  5B0Y D;  3X1T C;  3AZG D;  2Y2K A;  1P3L A;  1ID3 C;  1HTA A;  3LEL C;  1N1J A;  3O62 B;  2IO5 B;  3AZE C;  3TU4 A;  5DNM B;  3AZJ A;  2HUE B;  3V9R A;  4DRA A;  5GXQ B;  4XUJ D;  4XZQ B;  3A6N D;  3WTP B;  3AZN D;  5B1M A;  1EQZ B;  1BH8 B;  1P3A D;  5F99 B;  3WA9 A;  2ARO C;  5B31 A;  2NZD D;  4H9P B;  2NQB B;  2FJ7 A;  3MGQ D;  2YFV B;  3KUY C;  1S32 D;  5B32 C;  3O62 D;  1B6W A;  3X1T B;  4Z66 A;  5AVB C;  3B6F B;  4KGC C;  4ZUX C;  3B6G D;  3LEL B;  3AZE B;  3REK A;  1P34 D;  4H9Q B;  4XZQ D;  1U35 C;  5JRG C;  4QLC A;  3REJ B;  2ZY5 A;  2RVQ C;  1TAF A;  2DQN C;  4NFT A;  4WU9 B;  2Y2I A;  3AN2 D;  1M18 D;  4UPK A;  3AZH C;  1P3I A;  2NQB D;  5CPJ A;  2ARO B;  4ZBJ C;  3EPJ A;  5AV6 C;  4J8U A;  1Z2C B;  4R8P D;  3KUY B;  5B32 G;  5B32 B;  3REI D;  3WTP E;  4JJN A;  3X1U B;  5AV5 C;  5AVC C;  3AYW B;  1HQ3 A;  4H9S A;  4J8V A;  3AV2 C;  1P3M A;  4Z2M H;  4WU9 D;  1U35 B;  3MGP C;  5JRG B;  5DNN A;  1JFI B;  2HIO A;  1F1E A;  4CSR B;  4KUD A;  2F8N K;  2F2A C;  4J8W D;  1KX5 C;  3TU4 C;  5JA4 B;  3AZH B;  4ZBJ B;  5AV6 B;  3AZG A;  5E5A A;  4WU8 D;  3X1U D;  5BT1 C;  3AYW D;  3UT9 A;  3WA9 C;  5AV5 B;  5AVC B;  5B31 C;  3IP4 C;  3AV2 B;  4WV4 B;  2FJ7 C;  5B33 A;  3MGP B;  1KX3 D;  4Z66 C;  3WAA A;  5GSU B;  2Y2J A;  3REK C;  5GT3 B;  1KX5 B;  3KFU G;  5B0Z C;  4H9O B;  4QLC C;  4Z5T D;  1S32 A;  3C1C B;  3X1S B;  3MVD B;  3B0C T;  3B6G A;  3UTB D;  5KDM A;  1P3I C;  3WA9 B;  4NE5 A;  5CPJ C;  2BYM A;  4J8U C;  4CAY B;  5BNX B;  2CV5 A;  5GSU D;  1AOI D;  3AN2 A;  3W96 D;  4Z66 B;  5GT3 D;  4JJN C;  1P3B A;  5BS7 A;  5CP6 C;  4J8V C;  3W98 D;  1P3M C;  5B0Z B;  3C1C D;  3VH6 A;  3MVD D;  4R8P A;  5DNN C;  2HIO C;  1P3G A;  4KUD C;  1TAF B;  4LD9 B;  3EG5 B;  1M19 B;  2JSS A;  3AZM D;  5G49 B;  4X23 B;  3LJA A;  5CPJ B;  3AZK C;  4J8U B;  1P3F A;  5E5A C;  3H0M C;  4J8W A;  1H3O B;  3AZI D;  4J8X D;  1P3P B;  4EO5 B;  3UT9 C;  1P3K C;  1TZY C;  2Y2P A;  3AZF C;  5B40 A;  5CP6 B;  3REL B;  4LD9 D;  5C3I C;  1BH9 B;  1M19 D;  2W8S A;  5B33 C;  4WU8 A;  3W97 D;  2HIO B;  1M1A A;  3AZL D;  1ZLA B;  3C1B C;  3WAA C;  5AV8 D;  4X23 D;  1KU5 A;  3UTA B;  3MGS D;  1KX4 A;  2CWE A;  4H9R B;  5AV9 C;  3AZK B;  1KX3 A;  3MNN D;  3KWQ B;  3REH B;  5B2J C;  3AFA C;  5E5A B;  1P3P D;  3B6G C;  3AV1 A;  3KXB B;  2PYO B;  5AY8 B;  3W99 B;  3REL D;  5B1L B;  3MGR B;  1P3K B;  1TZY B;  3AZF B;  5CPK C;  2UWX A;  4Z5T A;  5C3I B;  1ZLA D;  2CV5 C;  5B33 B;  3H0L C;  5BO0 A;  2YFW B;  3AN2 C;  3C1B B;  1P3B C;  5BS7 C;  2ZM5 A;  3WKJ A;  5B24 A;  3REH D;  1ID3 B;  1F66 C;  4R8P C;  5AV9 B;  1P3G C;  5DNM D;  3KXB D;  1AOI A;  2PYO D;  5AY8 D;  3W99 D;  5B2J B;  3AFA B;  5B1L D;  5GT0 A;  3MGR D;  5GXQ D;  1BFM A;  3WTP D;  1EQZ D;  3LJA C;  3W98 A;  5F99 D;  5CPK B;  5CPI A;  1P3F C;  2CV5 B;  2DF4 C;  3LZ0 A;  5B2I A;  4UUZ B;  3X1T D;  3LZ1 A;  1ID3 D;  1P3B B;  4KHA A;  3B6F D;  5B40 C;  3LEL D;  3AZE D;  1F66 B;  5AVB B;  4KGC B;  4ZUX B;  3X1V A;  1M1A C;  3NQU A;  3AZI A;  3REJ D;  3A1I A;  4WNN A;  3NQJ B;  4H9N B;  1KX4 C;  1P3O A;  3LJA B;  1P3L C;  4YM6 A;  3W97 A;  3VH5 W;  4YS3 A;  2ARO D;  2BG1 A;  4WZS B; 
#chains in the Genus database with same CATH homology
 3AZL A;  2F8N A;  2Y2Q A;  3AV1 C;  5AV8 A;  2JCH A;  3AZJ C;  5FUG A;  3KUY D;  5B0Y A;  5B32 D;  5AVB D;  4ZUX D;  5B1M C;  2LY8 A;  4Z5T C;  3VH6 T;  4G92 C;  1U35 D;  5JRG D;  5CHL B;  2VQR A;  2RVQ D;  4XUJ A;  5BNV A;  3A6N A;  3WKJ C;  5B24 C;  1KX4 B;  3AZN A;  2BYK A;  1P3L B;  1P3A A;  3AZH D;  4Z2M G;  1AOI C;  1N1J B;  5GT0 C;  2NZD A;  1R4V A;  5AV6 D;  3TU4 B;  3AZJ B;  3MGQ A;  3V9R B;  4NE6 A;  3F6T A;  3O62 A;  3W98 C;  5CPI C;  3H0R C;  5AV5 D;  5AVC D;  5B1M B;  1Q9C A;  1P34 A;  3AV2 D;  4XZQ A;  3LZ0 C;  3MGP D;  5B31 G;  5B31 B;  5B2I C;  3WTP A;  3LZ1 C;  1EQZ A;  1BH8 A;  2FJ7 B;  5F99 A;  3WKJ B;  5B24 B;  2G5H C;  1KX5 D;  1M18 A;  3P5J B;  3B0B A;  3X1V C;  2NQB A;  1HQ3 C;  2YFV A;  3REK B;  4H9S C;  3X1S D;  3B6F A;  5BT1 D;  4QLC B;  2F8N H;  1P3O C;  3REI A;  4YM6 C;  3WA9 D;  4H9Q A;  5CPI B;  4YS3 C;  5B31 D;  3AZL C;  3REJ A;  1P3I B;  4AWL C;  2FJ7 D;  5B2I B;  5B0Y C;  3FDD A;  4WU9 A;  3LZ1 B;  4Z66 D;  3AZG C;  2ZY4 A;  2RIQ A;  3A1K A;  4JJN B;  5B0Z D;  3X1V B;  3NQU B;  1HQ3 B;  5B32 A;  4J8V B;  1P3M B;  4XUJ C;  3A6N C;  3X1U A;  5DNN B;  3AYW A;  3AZN C;  1P3O B;  4KUD B;  1P3A C;  4E45 A;  1P3I D;  5CPJ D;  2NZD C;  4CSR A;  4J8U D;  4AWL B;  3MGQ C;  1S32 C;  3O62 C;  3AZG B;  4JJN D;  5JA4 A;  3EPH A;  5CP6 D;  1P34 C;  4J8V D;  4HGA C;  3UT9 B;  5AV6 A;  4XZQ C;  5DNN D;  3WTP C;  2HIO D;  4KUD D;  4XUJ B;  5BNV B;  5F99 C;  3A6N B;  5AV5 A;  5AVC A;  3UTB A;  3UTA D;  1M18 C;  1P3A B;  3WAA B;  2NQB C;  3MGP A;  3AZK D;  1WWI A;  2NZD B;  3KWQ D;  5E5A D;  3B6F C;  3MGQ B;  5GSU A;  1S32 B;  3REI C;  3W96 A;  1KX5 A;  5GT3 A;  3UT9 D;  1P3K D;  1TZY D;  2Y2M A;  1T3U A;  3B6G B;  1WWS A;  3AZF D;  4H9O A;  2ZY3 A;  3VH5 A;  5KDM B;  3REJ C;  1P34 B;  4HGA B;  5B33 D;  3C1C A;  4WU9 C;  3X1S A;  3MVD A;  2BYM B;  3B0C W;  3C1B D;  3WAA D;  4J8W C;  2Y2N A;  3AN2 B;  3AZM A;  1M18 B;  4G91 C;  3EPK A;  5BNX A;  4CAY A;  5AV9 D;  5B2J D;  1ULY A;  2JE5 A;  2Y2O A;  3AFA D;  4WU8 C;  2Y2G A;  3X1U C;  4R8P B;  1P3G B;  3AYW C;  3REI B;  4J8X A;  3R45 A;  5B0Z A;  5CPK D;  4NE3 A;  4LD9 A;  2XD5 A;  2CV5 D;  1M19 A;  1KX3 C;  1W2E A;  1P3F B;  5G49 A;  1P3B D;  4X23 A;  4J8W B;  3MGS A;  1F66 D;  4G91 B;  4KGC D;  5B40 B;  1P3G D;  1H3O A;  3MNN A;  1P3P A;  4WU8 B;  3UTB C;  1M1A B;  5CP6 A;  1B67 A;  3REL A;  3LJA D;  1BH9 A;  1P3F D;  1ZLA A;  5GSU C;  4E44 A;  1KX3 B;  3UTA A;  3W96 C;  5GT3 C;  3AV1 B;  5B40 D;  4H9R A;  3AZK A;  3KWQ A;  3REH A;  3C1C C;  3MVD C;  3X1S C;  2F8N G;  1M1A D;  5DNM A;  3KXB A;  4Z5T B;  2PYO A;  5AY8 A;  3W99 A;  5B1L A;  5BO0 B;  3MGR A;  1P3K A;  1A7W A;  1TZY A;  3B0D C;  5GXQ A;  4G92 B;  3UTB B;  2XD1 A;  2Y2H A;  3AZM C;  3AZF A;  1KX4 D;  1P3L D;  1PZR A;  2YFW A;  3C1B A;  3TU4 D;  2G5I C;  2L5A A;  4H9P A;  3AV1 D;  1AOI B;  3AZJ D;  3AZI C;  3W96 B;  4J8X C;  5GT0 B;  2J8P A;  3X1T A;  1ID3 A;  5AV9 A;  3LEL A;  5B1M D;  4LD9 C;  3AZE A;  3W98 B;  5B2J A;  3AFA A;  1M19 C;  3W97 C;  5AV8 C;  4X23 C;  3B0D B;  3LZ0 B;  3AZM B;  5CPK A;  3MGS C;  3WKJ D;  5B24 D;  4KHA B;  3MNN C;  2ARO A;  3REK D;  1P3P C;  5GT0 D;  4EO5 C;  4UUZ A;  3AL0 C;  3AZI B;  3KSY A;  4QLC D;  3KUY A;  4J8X B;  4DQY B;  4WNN B;  3REL C;  2ZY2 A;  3R45 B;  1F66 A;  5AVB A;  4KGC A;  5CPI D;  4ZUX A;  3VH5 T;  1ZLA C;  4YM6 B;  3W97 B;  3LZ0 D;  4YS3 B;  5B2I D;  3EPL A;  3UTA C;  3NQJ A;  4H9N A;  4M6B A;  5JRG A;  3LZ1 D;  3AZL B;  1U35 A;  1JFI A;  2F8N B;  5AV8 B;  2Y2L A;  5FUG B;  5B0Y B;  3MGS B;  2FFF B;  2IO5 C;  3KWQ C;  3REH C;  4WJ3 C;  3AZH A;  3X1V D;  5DNM C;  3KXB C;  2PYO C;  1HQ3 D;  5AY8 C;  3W99 C;  3MNN B;  2HUE C;  5B1L C;  3MGR C;  1P3M D;  4DRB A;  5GXQ C;  1P3O D;  1EQZ C;  4YM6 D;  4YS3 D;  2F8N D;  3AZN B;  2BYK B;  3VH6 W;  3AV2 A;  5B0Y D;  3X1T C;  3AZG D;  2Y2K A;  1P3L A;  1ID3 C;  1HTA A;  3LEL C;  1N1J A;  3O62 B;  2IO5 B;  3AZE C;  3TU4 A;  5DNM B;  3AZJ A;  2HUE B;  3V9R A;  4DRA A;  5GXQ B;  4XUJ D;  4XZQ B;  3A6N D;  3WTP B;  3AZN D;  5B1M A;  1EQZ B;  1BH8 B;  1P3A D;  5F99 B;  3WA9 A;  2ARO C;  5B31 A;  2NZD D;  4H9P B;  2NQB B;  2FJ7 A;  3MGQ D;  2YFV B;  3KUY C;  1S32 D;  5B32 C;  3O62 D;  1B6W A;  3X1T B;  4Z66 A;  5AVB C;  3B6F B;  4KGC C;  4ZUX C;  3B6G D;  3LEL B;  3AZE B;  3REK A;  1P34 D;  4H9Q B;  4XZQ D;  1U35 C;  5JRG C;  4QLC A;  3REJ B;  2ZY5 A;  2RVQ C;  1TAF A;  2DQN C;  4NFT A;  4WU9 B;  2Y2I A;  3AN2 D;  1M18 D;  4UPK A;  3AZH C;  1P3I A;  2NQB D;  5CPJ A;  2ARO B;  4ZBJ C;  3EPJ A;  5AV6 C;  4J8U A;  1Z2C B;  4R8P D;  3KUY B;  5B32 G;  5B32 B;  3REI D;  3WTP E;  4JJN A;  3X1U B;  5AV5 C;  5AVC C;  3AYW B;  1HQ3 A;  4H9S A;  4J8V A;  3AV2 C;  1P3M A;  4Z2M H;  4WU9 D;  1U35 B;  3MGP C;  5JRG B;  5DNN A;  1JFI B;  2HIO A;  1F1E A;  4CSR B;  4KUD A;  2F8N K;  2F2A C;  4J8W D;  1KX5 C;  3TU4 C;  5JA4 B;  3AZH B;  4ZBJ B;  5AV6 B;  3AZG A;  5E5A A;  4WU8 D;  3X1U D;  5BT1 C;  3AYW D;  3UT9 A;  3WA9 C;  5AV5 B;  5AVC B;  5B31 C;  3IP4 C;  3AV2 B;  4WV4 B;  2FJ7 C;  5B33 A;  3MGP B;  1KX3 D;  4Z66 C;  3WAA A;  5GSU B;  2Y2J A;  3REK C;  5GT3 B;  1KX5 B;  3KFU G;  5B0Z C;  4H9O B;  4QLC C;  4Z5T D;  1S32 A;  3C1C B;  3X1S B;  3MVD B;  3B0C T;  3B6G A;  3UTB D;  5KDM A;  1P3I C;  3WA9 B;  4NE5 A;  5CPJ C;  2BYM A;  4J8U C;  4CAY B;  5BNX B;  2CV5 A;  5GSU D;  1AOI D;  3AN2 A;  3W96 D;  4Z66 B;  5GT3 D;  4JJN C;  1P3B A;  5BS7 A;  5CP6 C;  4J8V C;  3W98 D;  1P3M C;  5B0Z B;  3C1C D;  3VH6 A;  3MVD D;  4R8P A;  5DNN C;  2HIO C;  1P3G A;  4KUD C;  1TAF B;  4LD9 B;  3EG5 B;  1M19 B;  2JSS A;  3AZM D;  5G49 B;  4X23 B;  3LJA A;  5CPJ B;  3AZK C;  4J8U B;  1P3F A;  5E5A C;  3H0M C;  4J8W A;  1H3O B;  3AZI D;  4J8X D;  1P3P B;  4EO5 B;  3UT9 C;  1P3K C;  1TZY C;  2Y2P A;  3AZF C;  5B40 A;  5CP6 B;  3REL B;  4LD9 D;  5C3I C;  1BH9 B;  1M19 D;  2W8S A;  5B33 C;  4WU8 A;  3W97 D;  2HIO B;  1M1A A;  3AZL D;  1ZLA B;  3C1B C;  3WAA C;  5AV8 D;  4X23 D;  1KU5 A;  3UTA B;  3MGS D;  1KX4 A;  2CWE A;  4H9R B;  5AV9 C;  3AZK B;  1KX3 A;  3MNN D;  3KWQ B;  3REH B;  5B2J C;  3AFA C;  5E5A B;  1P3P D;  3B6G C;  3AV1 A;  3KXB B;  2PYO B;  5AY8 B;  3W99 B;  3REL D;  5B1L B;  3MGR B;  1P3K B;  1TZY B;  3AZF B;  5CPK C;  2UWX A;  4Z5T A;  5C3I B;  1ZLA D;  2CV5 C;  5B33 B;  3H0L C;  5BO0 A;  2YFW B;  3AN2 C;  3C1B B;  1P3B C;  5BS7 C;  2ZM5 A;  3WKJ A;  5B24 A;  3REH D;  1ID3 B;  1F66 C;  4R8P C;  5AV9 B;  1P3G C;  5DNM D;  3KXB D;  1AOI A;  2PYO D;  5AY8 D;  3W99 D;  5B2J B;  3AFA B;  5B1L D;  5GT0 A;  3MGR D;  5GXQ D;  1BFM A;  3WTP D;  1EQZ D;  3LJA C;  3W98 A;  5F99 D;  5CPK B;  5CPI A;  1P3F C;  2CV5 B;  2DF4 C;  3LZ0 A;  5B2I A;  4UUZ B;  3X1T D;  3LZ1 A;  1ID3 D;  1P3B B;  4KHA A;  3B6F D;  5B40 C;  3LEL D;  3AZE D;  1F66 B;  5AVB B;  4KGC B;  4ZUX B;  3X1V A;  1M1A C;  3NQU A;  3AZI A;  3REJ D;  3A1I A;  4WNN A;  3NQJ B;  4H9N B;  1KX4 C;  1P3O A;  3LJA B;  1P3L C;  4YM6 A;  3W97 A;  3VH5 W;  4YS3 A;  2ARO D;  2BG1 A;  4WZS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...