4XUJA

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding protein/dna
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujA00
5AY8A 3AV1A 3WA9B 1P3IA 3AZLD 3NQUA 1P3PB 4Z66C 3W96D 3X1SC 3KUYD 1P3MB 3AZEB 3W97A 3WKJC 3X1VA 4E44A 5DNNB 1N1JA 4J8UB 3LZ1C 3LJAC 4KGCB 4H9OB 4KUDC 5CP6A 4XUJA 3AZLC 1WWIA 5B31B 4X23B 5C3IC 5B0ZC 5B2JA 5GSUA 3KXBC 3AZIA 5E5AC 5JRGC 3UTBD 4H9SC 5AVCA 3VH5W 3AZFC 4LD9A 2HIOA 3MGQB 3MNNA 3MGPB 3X1UB 1S32C 1HQ3B 4H9PB 5B32G 5B32B 5B33D 1ZLAB 3C1BD 1M18B 3VH5A 3AYWD 3X1TD 3VH6W 4XZQD 3MVDD 2CV5D 3MGSA 4G92B 3AN2A 2F8NG 1KX5A 3MGRC 4YS3A 3AZJB 4CSRB 2BYMB 5B1MC 5AV9A 3KWQD 1P3LC 4R8PB 2F8NB 3A6NB 3WTPA 3LELB 5BO0A 4YM6B 3C1CB 2NQBC 5B1LA 4J8XD 5GXQC 3AV1C 5GT3D 4WU8D 1P3IC 3X1TC 4XZQC 1P3PD 2CV5C 3R45B 5B2ID 3B0CT 1P3OB 4H9NB 5AV6D 4WU9B 1P3MD 4J8WA 3W97C 3AFAA 3UTAA 4QLCD 5DNND 3LJAB 1M1AD 4Z2MH 5BT1D 4J8XC 1P3KA 3AZLB 5CP6C 2AROA 4ZBJC 4XUJC 3W96B 5C3IB 5B0ZB 3REHD 4H9RB 1BH8B 5B2IC 4DRAA 5E5AB 5B2JC 3AZIC 5G49A 2NZDA 3W98D 5AV6C 1JFIB 4LD9C 5BNVB 5AVCC 1M19A 4Z5TA 3V9RA 3MNNC 4QLCC 4KHAA 5CPJD 4H9QB 5BT1C 3UT9D 5B32D 1P34D 1EQZA 3W99D 1H3OB 2RVQD 4UUZB 1Q9CA 3MGSC 1KX5C 4YS3C 5AVBD 5AV9C 5AV5A 3AZKD 3WTPC 5B24D 1U35A 5CPJC 3UT9C 5B33B 1P34C 3C1BB 1TAFA 3REIA 3NQUB 4CAYA 3MVDB 4E45A 4XZQB 3O62D 4J8VD 4Z66D 3AZNA 3X1TB 2CV5B 1ID3A 5CPIA 5CPKA 2PYOA 3X1SD 3KWQB 3AZHD 3B6GA 4NFTA 3WKJD 3W97B 3AZKC 1F66A 4J8WC 3AFAC 3AV2A 5B24C 3LZ1D 3UTAC 4J8XB 2YFVA 4KUDD 2FJ7A 3B6FA 5GT3B 5DNMA 4WU8B 3KSYA 4J8VC 3O62C 5KDMA 2AROC 5B2IB 5B0ZD 3KXBD 5E5AD 5JRGD 5AV6B 1A7WA 2YFWA 3AZHC 3AZFD 4NE6A 4LD9B 2NZDC 3AZMA 1P3AA 1P3GD 4ZUXA 4NE3A 3MNNB 1BH9B 1P3FD 4QLCB 1M19C 1S32D 1M1AB 4Z5TC 3REKA 1P3BA 1TZYA 3AZGA 2IO5C 3REHB 4JJND 3WAAD 5JA4A 3TU4D 3MGRD 5GT0D 1P3LD 5B1MD 3W98B 5AV9B 4G91C 1P3GC 2F8NK 3RELA 1AOID 1P3FC 5CPJB 2NQBD 5FUGA 3UT9B 1P34B 5B40A 5GXQD 5F99D 5AY8D 3AV1D 3REJA 1P3ID 3WA9A 3W99B 3REIC 4JJNC 3WAAC 3AZNC 1ID3C 5CPIC 3TU4C 3B0DC 4WNNA 5CPKC 5GT0C 5AVBB 3B6GC 3AZKB 3W97D 3AZEA 3AFAB 1AOIC 1ULYA 5B24B 5BS7C 3X1VD 4J8UA 1KX4A 5F99C 4KGCA 5AY8C 4H9OA 5CP6D 4J8VB 3O62B 4XUJD 4Z66B 4AWLC 5B31A 4X23A 3X1SB 5B2JD 5GSUD 3AZID 3AZHB 5G49B 2NZDB 3WKJB 4LD9D 5AVCD 2HIOD 3AZMC 3MGQA 2F8NH 3MNND 3X1VC 3LZ1B 3MGPA 3X1UA 4KUDB 1HQ3A 4H9PA 3REKC 1HTAA 3LZ0A 5BNXB 1ZLAA 3KXBB 3AZGC 1M18A 1KX3A 3MGSD 3AN2D 2HUEC 5GSUC 5JRGB 3AZFB 4YS3D 1KX5D 5AV9D 3AZJA 4G91B 2BYMA 2F8NA 1P3GB 5AV8A 4R8PA 5F99A 2HIOC 3A6NA 5B0YA 1P3FB 3WTPD 3RELC 1S32B 3LELA 1R4VA 4YM6A 3C1CA 2BYKB 5B1LD 5B40C 4JJNB 3WAAB 3AZNB 3WA9C 3TU4B 5CPIB 3MGRB 3AN2C 3R45A 5GT0B 5B1MB 1P3LB 1P3OA 3NQJB 4H9NA 4WU9A 1AOIB 4J8WD 3AFAD 2NQBB 3UTAD 2JSSA 2YFVB 5GXQB 5B1LC 5AY8B 5F99B 3LJAA 4J8UC 3AV1B 1P3IB 3VH5T 1P3KD 1KX4C 4KGCC 3AZLA 2AROD 4AWLB 1B67A 3W96A 5CHLB 4X23C 4H9RA 1BH8A 3KUYA 2NZDD 3AZMB 1JFIA 5BNVA 1M19D 3VH6T 3X1VB 4Z5TD 1N1JB 3MGPC 3X1UC 4H9QA 5CP6B 4ZBJB 4XUJB 1P3KC 1EQZD 3LZ0C 1ZLAC 4NE5A 1H3OA 2HUEB 5GSUB 5B2JB 1KX3C 4UUZA 3AZIB 4G92C 3UTBA 5AVCB 2HIOB 5AV8C 4R8PC 5AV5D 5B0YC 1WWSA 1U35D 3C1CC 4WV4B 5B33A 3C1BA 1EQZC 3REID 3AYWA 3MVDA 3AZND 4XZQA 3MGSB 3X1TA 1ID3D 3AN2B 2CV5A 5CPID 5CPKD 4WNNB 2PYOD 1KX5B 4YS3B 3KWQA 3B6GD 1P3OC 1F1EA 3WTPB 4WU9C 5BO0B 5AV5C 1F66D 3AV2D 1U35C 5B1LB 4J8XA 1KX4B 2FJ7D 3B6FD 5DNMD 5GT3A 4WU8A 5B31G 1P3PA 3W96C 5B2IA 2PYOC 4EO5C 3KUYC 5AV6A 1P3MA 4J8WB 3AZMD 1P3AD 4ZUXD 1BFMA 1F66C 3UTAB 1BH9A 4QLCA 4HGAC 5DNNA 3AV2C 1M1AA 3REKD 3WTPE 1P3KB 2FJ7C 3B6FC 5DNMC 1P3BD 2AROB 4M6BA 3LZ0B 1TZYD 3AZGD 1KX3B 3REHA 3W98A 3UTBC 5AV8B 4Z2MG 1P3AC 4ZUXC 1M19B 5B0YB 3RELD 4Z5TB 3V9RB 4KHAB 5CPJA 3VH6A 3UT9A 5B40D 5B32A 1P34A 1EQZB 2IO5B 3REJD 1P3BC 5B33C 1TZYC 3WA9D 3C1BC 3W99A 3AYWC 3MVDC 4CSRA 5AVBA 3KWQC 4DRBA 5AV5B 3AZKA 3AZED 1U35B 5B24A 4J8UD 1TAFB 1KX4D 4KGCD 3REIB 4CAYB 3REJC 4J8VA 3O62A 5GT3C 4WU8C 4Z66A 1ID3B 5CPKB 3B0DB 5B31D 4X23D 1B6WA 1P3PC 2PYOB 3X1SA 4EO5B 3KUYB 3B6GB 3AZHA 1P3MC 3WKJA 1F66B 3MGQD 3AZEC 3AV2B 4HGAB 3MGPD 3X1UD 3B0BA 3LZ1A 5DNNC 1M1AC 2FJ7B 1HQ3D 3B6FB 4KUDA 5DNMB 2CWEA 3LZ0D 5KDMB 1ZLAD 4WZSB 5BNXA 1M18D 1KX3D 3KXBA 5B31C 5B0ZA 3REHC 5E5AA 5JRGA 2YFWB 3UTBB 4H9SA 3AZFA 3AZJD 1P3AB 2F8ND 4ZUXB 5AV8D 4R8PD 1P3GA 3W98C 3A6ND 5B0YD 3MGQC 1P3FA 3LELD 1S32A 3B0CW 4YM6D 3REKB 3C1CD 2LY8A 1HQ3C 2BYKA 1KU5A 1P3BB 1TZYB 5B32C 3AZGB 3AYWB 5JA4B 4JJNA 1M18C 3WAAA 3W99C 2RVQC 3TU4A 3MGRA 5GT0A 1P3LA 5B1MA 3AZJC 5AVBC 1P3OD 4WU9D 3RELB 2L5AA 3NQJA 3A6NC 1AOIA 3LELC 5BS7A 5FUGB 2NQBA 4YM6C 5B40B 3LJAD 5GXQA 3REJB
chains in the Genus database with same CATH superfamily
5AY8A 3AV1A 3WA9B 1P3IA 3AZLD 3NQUA 1P3PB 4Z66C 3W96D 3X1SC 3FDDA 3KUYD 2Y2HA 2ZY4A 1P3MB 2Y2MA 3AZEB 2Y2GA 3W97A 3WKJC 3X1VA 4E44A 5DNNB 1N1JA 4J8UB 3LZ1C 3LJAC 4KGCB 4H9OB 4KUDC 5CP6A 4XUJA 3AZLC 1WWIA 5B31B 4X23B 5C3IC 5B0ZC 5B2JA 5GSUA 3KXBC 2JE5A 3AZIA 5E5AC 5JRGC 3UTBD 4WJ3C 4H9SC 5AVCA 3VH5W 3AZFC 4LD9A 2HIOA 3MGQB 4DQYB 3MNNA 3MGPB 3X1UB 1S32C 1HQ3B 4H9PB 5B32G 5B32B 3EPJA 5B33D 1ZLAB 3C1BD 1M18B 3VH5A 3AYWD 3X1TD 3VH6W 4XZQD 3MVDD 2CV5D 3MGSA 4G92B 3AN2A 2Y2QA 2F8NG 1KX5A 3MGRC 4YS3A 3AZJB 4CSRB 2BYMB 5B1MC 5AV9A 3KWQD 1P3LC 4R8PB 2F8NB 3A6NB 3WTPA 3LELB 5BO0A 4YM6B 3C1CB 2NQBC 5B1LA 4J8XD 5GXQC 3AV1C 5GT3D 4WU8D 1P3IC 3X1TC 4XZQC 1P3PD 2CV5C 3R45B 2G5HC 5B2ID 3B0CT 1P3OB 4H9NB 5AV6D 4WU9B 1P3MD 4J8WA 3W97C 3AFAA 3P5JB 3UTAA 4QLCD 5DNND 3LJAB 1M1AD 4Z2MH 5BT1D 4J8XC 1P3KA 3AZLB 5CP6C 2AROA 4ZBJC 4XUJC 3W96B 5C3IB 5B0ZB 3REHD 4H9RB 1BH8B 5B2IC 4DRAA 5E5AB 5B2JC 2Y2LA 3AZIC 5G49A 2NZDA 3W98D 5AV6C 1JFIB 4LD9C 5BNVB 5AVCC 1M19A 4Z5TA 3V9RA 3MNNC 4QLCC 4KHAA 5CPJD 4H9QB 5BT1C 3UT9D 5B32D 1P34D 1EQZA 3W99D 1H3OB 2RVQD 4UUZB 1Q9CA 3MGSC 2Y2JA 1KX5C 5AVBD 4YS3C 5AV9C 2XD1A 5AV5A 3AZKD 3WTPC 5B24D 1U35A 5CPJC 3UT9C 5B33B 1P34C 3C1BB 1TAFA 3REIA 3NQUB 4CAYA 3MVDB 4E45A 2JCHA 4XZQB 3O62D 4Z66D 4J8VD 3AZNA 3X1TB 2CV5B 1ID3A 5CPIA 5CPKA 2PYOA 3X1SD 3KWQB 2ZY3A 3AZHD 4NFTA 3B6GA 3WKJD 3W97B 3AZKC 1F66A 4J8WC 3AFAC 3H0LC 3AV2A 5B24C 3LZ1D 3UTAC 4J8XB 1PZRA 2YFVA 4KUDD 2FJ7A 3B6FA 5GT3B 5DNMA 4WU8B 3KSYA 4J8VC 3O62C 5KDMA 2AROC 5B2IB 5B0ZD 3KXBD 5E5AD 5JRGD 5AV6B 1A7WA 2YFWA 3AZHC 3AZFD 4NE6A 4LD9B 2NZDC 3AZMA 1P3AA 1P3GD 4ZUXA 4NE3A 3MNNB 1BH9B 1P3FD 4QLCB 1M19C 1S32D 1M1AB 4Z5TC 3REKA 1P3BA 1TZYA 3AZGA 2IO5C 3REHB 4JJND 3WAAD 5JA4A 3TU4D 3MGRD 5GT0D 1P3LD 5B1MD 3W98B 5AV9B 4G91C 1P3GC 2F8NK 3RELA 1AOID 1P3FC 5CPJB 2NQBD 5FUGA 3UT9B 1P34B 5B40A 5GXQD 5F99D 5AY8D 3AV1D 3REJA 1P3ID 3WA9A 3W99B 3REIC 4JJNC 3WAAC 3AZNC 1ID3C 5CPIC 3TU4C 3B0DC 4WNNA 5CPKC 5GT0C 5AVBB 3B6GC 2FFFB 3AZKB 3W97D 3AZEA 3AFAB 1AOIC 1ULYA 5B24B 5BS7C 3X1VD 2ZM5A 4J8UA 1KX4A 5F99C 4KGCA 5AY8C 4H9OA 5CP6D 4J8VB 3O62B 4XUJD 4Z66B 4AWLC 5B31A 4X23A 3X1SB 5B2JD 5GSUD 2Y2PA 3AZID 3AZHB 5G49B 2NZDB 3WKJB 4LD9D 2VQRA 5AVCD 2HIOD 3AZMC 3MGQA 2F8NH 3MNND 3X1VC 3LZ1B 3MGPA 3X1UA 4KUDB 1HQ3A 4H9PA 3REKC 1HTAA 3LZ0A 5BNXB 1ZLAA 3KXBB 3AZGC 1M18A 1KX3A 3MGSD 3AN2D 2HUEC 2F2AC 5GSUC 5JRGB 3AZFB 4YS3D 1KX5D 5AV9D 3AZJA 4G91B 2BYMA 2F8NA 1P3GB 5AV8A 4R8PA 2HIOC 3A6NA 5B0YA 1P3FB 3WTPD 3KFUG 3RELC 1S32B 3LELA 1R4VA 3EG5B 4YM6A 3C1CA 2BYKB 5B1LD 5B40C 4JJNB 3WAAB 3AZNB 3WA9C 3TU4B 5CPIB 3MGRB 3AN2C 3R45A 5GT0B 3H0MC 5B1MB 1P3LB 1P3OA 3NQJB 4H9NA 4WU9A 1AOIB 4J8WD 3AFAD 2NQBB 3UTAD 2JSSA 2YFVB 5GXQB 5B1LC 5AY8B 5F99B 3LJAA 4J8UC 3AV1B 1P3IB 3VH5T 1P3KD 1KX4C 3EPKA 4KGCC 3AZLA 2AROD 4AWLB 1B67A 3W96A 5CHLB 4X23C 4H9RA 1BH8A 3KUYA 4UPKA 1T3UA 2NZDD 3AZMB 1JFIA 5BNVA 3A1KA 2Y2IA 3VH6T 3EPLA 3X1VB 1M19D 4Z5TD 2Y2NA 1N1JB 3MGPC 3X1UC 4H9QA 2XD5A 5CP6B 4ZBJB 4XUJB 1P3KC 1EQZD 3LZ0C 1ZLAC 4NE5A 1H3OA 2HUEB 5GSUB 5B2JB 1KX3C 4UUZA 3AZIB 4G92C 3UTBA 5AVCB 2HIOB 2Y2OA 2G5IC 5AV8C 4R8PC 5AV5D 5B0YC 1WWSA 1U35D 2ZY2A 3F6TA 3C1CC 4WV4B 5B33A 3C1BA 1EQZC 3REID 3AYWA 3MVDA 3AZND 4XZQA 3MGSB 3X1TA 1ID3D 3AN2B 2CV5A 5CPID 5CPKD 4WNNB 2PYOD 1KX5B 4YS3B 2RIQA 3KWQA 3B6GD 1P3OC 1F1EA 2BG1A 3WTPB 4WU9C 1Z2CB 5BO0B 5AV5C 1F66D 3AV2D 1U35C 5B1LB 3IP4C 4J8XA 1KX4B 2FJ7D 3B6FD 5DNMD 5GT3A 4WU8A 5B31G 1P3PA 3W96C 5B2IA 2PYOC 4EO5C 1W2EA 3KUYC 5AV6A 1P3MA 4J8WB 3AZMD 1P3AD 4ZUXD 3AL0C 1BFMA 1F66C 3UTAB 1BH9A 4QLCA 4HGAC 5DNNA 3AV2C 1M1AA 3REKD 3WTPE 1P3KB 2ZY5A 2FJ7C 3B6FC 5DNMC 1P3BD 2AROB 4M6BA 3LZ0B 1TZYD 3AZGD 1KX3B 3REHA 3W98A 3UTBC 5AV8B 4Z2MG 1P3AC 4ZUXC 1M19B 5B0YB 3RELD 4Z5TB 3V9RB 4KHAB 5CPJA 3VH6A 3UT9A 5B40D 2DQNC 5B32A 1P34A 1EQZB 2IO5B 3REJD 1P3BC 5B33C 1TZYC 3WA9D 3C1BC 3W99A 3AYWC 3MVDC 3EPHA 4CSRA 5AVBA 2Y2KA 3KWQC 4DRBA 5AV5B 3AZKA 3AZED 3H0RC 1U35B 5B24A 2UWXA 4J8UD 1TAFB 1KX4D 4KGCD 3REIB 4CAYB 3REJC 4J8VA 3O62A 5GT3C 4WU8C 4Z66A 1ID3B 5CPKB 3B0DB 5B31D 4X23D 1B6WA 1P3PC 2PYOB 3X1SA 4EO5B 3KUYB 3B6GB 3AZHA 1P3MC 3WKJA 1F66B 3MGQD 3AZEC 3AV2B 4HGAB 3MGPD 3X1UD 3B0BA 3LZ1A 5DNNC 1M1AC 2FJ7B 1HQ3D 3B6FB 4KUDA 5DNMB 2CWEA 3LZ0D 5KDMB 1ZLAD 4WZSB 5BNXA 1M18D 1KX3D 2W8SA 5B31C 5B0ZA 3KXBA 3REHC 5E5AA 5JRGA 2YFWB 3UTBB 4H9SA 3AZFA 3AZJD 1P3AB 2F8ND 4ZUXB 2DF4C 5AV8D 4R8PD 1P3GA 3A6ND 3W98C 5B0YD 3MGQC 1P3FA 3LELD 1S32A 3B0CW 4YM6D 3REKB 3C1CD 2LY8A 1HQ3C 2BYKA 1KU5A 1P3BB 1TZYB 5B32C 3AZGB 3AYWB 5JA4B 4JJNA 1M18C 5GXQA 3W99C 3WAAA 2RVQC 3TU4A 3MGRA 5GT0A 1P3LA 5B1MA 3AZJC 5AVBC 1P3OD 2J8PA 4WU9D 2L5AA 3NQJA 3A6NC 3RELB 1AOIA 3LELC 5BS7A 5FUGB 2NQBA 4YM6C 3A1IA 5B40B 3LJAD 5F99A 3REJB
chains in the Genus database with same CATH topology
5AY8A 3AV1A 3WA9B 1P3IA 3AZLD 3NQUA 1P3PB 4Z66C 3W96D 3X1SC 3FDDA 3KUYD 2Y2HA 2ZY4A 1P3MB 2Y2MA 3AZEB 2Y2GA 3W97A 3WKJC 3X1VA 4E44A 5DNNB 1N1JA 4J8UB 3LZ1C 3LJAC 4KGCB 4H9OB 4KUDC 5CP6A 4XUJA 3AZLC 1WWIA 5B31B 4X23B 5C3IC 5B0ZC 5B2JA 5GSUA 3KXBC 2JE5A 3AZIA 5E5AC 5JRGC 3UTBD 4WJ3C 4H9SC 5AVCA 3VH5W 3AZFC 4LD9A 2HIOA 3MGQB 4DQYB 3MNNA 3MGPB 3X1UB 1S32C 1HQ3B 4H9PB 5B32G 5B32B 3EPJA 5B33D 1ZLAB 3C1BD 1M18B 3VH5A 3AYWD 3X1TD 3VH6W 4XZQD 3MVDD 2CV5D 3MGSA 4G92B 3AN2A 2Y2QA 2F8NG 1KX5A 3MGRC 4YS3A 3AZJB 4CSRB 2BYMB 5B1MC 5AV9A 3KWQD 1P3LC 4R8PB 2F8NB 3A6NB 3WTPA 3LELB 5BO0A 4YM6B 3C1CB 2NQBC 5B1LA 4J8XD 5GXQC 3AV1C 5GT3D 4WU8D 1P3IC 3X1TC 4XZQC 1P3PD 2CV5C 3R45B 2G5HC 5B2ID 3B0CT 1P3OB 4H9NB 5AV6D 4WU9B 1P3MD 4J8WA 3W97C 3AFAA 3P5JB 3UTAA 4QLCD 5DNND 3LJAB 1M1AD 4Z2MH 5BT1D 4J8XC 1P3KA 3AZLB 5CP6C 2AROA 4ZBJC 4XUJC 3W96B 5C3IB 5B0ZB 3REHD 4H9RB 1BH8B 5B2IC 4DRAA 5E5AB 5B2JC 2Y2LA 3AZIC 5G49A 2NZDA 3W98D 5AV6C 1JFIB 4LD9C 5BNVB 5AVCC 1M19A 4Z5TA 3V9RA 3MNNC 4QLCC 4KHAA 5CPJD 4H9QB 5BT1C 3UT9D 5B32D 1P34D 1EQZA 3W99D 1H3OB 2RVQD 4UUZB 1Q9CA 3MGSC 2Y2JA 1KX5C 5AVBD 4YS3C 5AV9C 2XD1A 5AV5A 3AZKD 3WTPC 5B24D 1U35A 5CPJC 3UT9C 5B33B 1P34C 3C1BB 1TAFA 3REIA 3NQUB 4CAYA 3MVDB 4E45A 2JCHA 4XZQB 3O62D 4Z66D 4J8VD 3AZNA 3X1TB 2CV5B 1ID3A 5CPIA 5CPKA 2PYOA 3X1SD 3KWQB 2ZY3A 3AZHD 4NFTA 3B6GA 3WKJD 3W97B 3AZKC 1F66A 4J8WC 3AFAC 3H0LC 3AV2A 5B24C 3LZ1D 3UTAC 4J8XB 1PZRA 2YFVA 4KUDD 2FJ7A 3B6FA 5GT3B 5DNMA 4WU8B 3KSYA 4J8VC 3O62C 5KDMA 2AROC 5B2IB 5B0ZD 3KXBD 5E5AD 5JRGD 5AV6B 1A7WA 2YFWA 3AZHC 3AZFD 4NE6A 4LD9B 2NZDC 3AZMA 1P3AA 1P3GD 4ZUXA 4NE3A 3MNNB 1BH9B 1P3FD 4QLCB 1M19C 1S32D 1M1AB 4Z5TC 3REKA 1P3BA 1TZYA 3AZGA 2IO5C 3REHB 4JJND 3WAAD 5JA4A 3TU4D 3MGRD 5GT0D 1P3LD 5B1MD 3W98B 5AV9B 4G91C 1P3GC 2F8NK 3RELA 1AOID 1P3FC 5CPJB 2NQBD 5FUGA 3UT9B 1P34B 5B40A 5GXQD 5F99D 5AY8D 3AV1D 3REJA 1P3ID 3WA9A 3W99B 3REIC 4JJNC 3WAAC 3AZNC 1ID3C 5CPIC 3TU4C 3B0DC 4WNNA 5CPKC 5GT0C 5AVBB 3B6GC 2FFFB 3AZKB 3W97D 3AZEA 3AFAB 1AOIC 1ULYA 5B24B 5BS7C 3X1VD 2ZM5A 4J8UA 1KX4A 5F99C 4KGCA 5AY8C 4H9OA 5CP6D 4J8VB 3O62B 4XUJD 4Z66B 4AWLC 5B31A 4X23A 3X1SB 5B2JD 5GSUD 2Y2PA 3AZID 3AZHB 5G49B 2NZDB 3WKJB 4LD9D 2VQRA 5AVCD 2HIOD 3AZMC 3MGQA 2F8NH 3MNND 3X1VC 3LZ1B 3MGPA 3X1UA 4KUDB 1HQ3A 4H9PA 3REKC 1HTAA 3LZ0A 5BNXB 1ZLAA 3KXBB 3AZGC 1M18A 1KX3A 3MGSD 3AN2D 2HUEC 2F2AC 5GSUC 5JRGB 3AZFB 4YS3D 1KX5D 5AV9D 3AZJA 4G91B 2BYMA 2F8NA 1P3GB 5AV8A 4R8PA 2HIOC 3A6NA 5B0YA 1P3FB 3WTPD 3KFUG 3RELC 1S32B 3LELA 1R4VA 3EG5B 4YM6A 3C1CA 2BYKB 5B1LD 5B40C 4JJNB 3WAAB 3AZNB 3WA9C 3TU4B 5CPIB 3MGRB 3AN2C 3R45A 5GT0B 3H0MC 5B1MB 1P3LB 1P3OA 3NQJB 4H9NA 4WU9A 1AOIB 4J8WD 3AFAD 2NQBB 3UTAD 2JSSA 2YFVB 5GXQB 5B1LC 5AY8B 5F99B 3LJAA 4J8UC 3AV1B 1P3IB 3VH5T 1P3KD 1KX4C 3EPKA 4KGCC 3AZLA 2AROD 4AWLB 1B67A 3W96A 5CHLB 4X23C 4H9RA 1BH8A 3KUYA 4UPKA 1T3UA 2NZDD 3AZMB 1JFIA 5BNVA 3A1KA 2Y2IA 3VH6T 3EPLA 3X1VB 1M19D 4Z5TD 2Y2NA 1N1JB 3MGPC 3X1UC 4H9QA 2XD5A 5CP6B 4ZBJB 4XUJB 1P3KC 1EQZD 3LZ0C 1ZLAC 4NE5A 1H3OA 2HUEB 5GSUB 5B2JB 1KX3C 4UUZA 3AZIB 4G92C 3UTBA 5AVCB 2HIOB 2Y2OA 2G5IC 5AV8C 4R8PC 5AV5D 5B0YC 1WWSA 1U35D 2ZY2A 3F6TA 3C1CC 4WV4B 5B33A 3C1BA 1EQZC 3REID 3AYWA 3MVDA 3AZND 4XZQA 3MGSB 3X1TA 1ID3D 3AN2B 2CV5A 5CPID 5CPKD 4WNNB 2PYOD 1KX5B 4YS3B 2RIQA 3KWQA 3B6GD 1P3OC 1F1EA 2BG1A 3WTPB 4WU9C 1Z2CB 5BO0B 5AV5C 1F66D 3AV2D 1U35C 5B1LB 3IP4C 4J8XA 1KX4B 2FJ7D 3B6FD 5DNMD 5GT3A 4WU8A 5B31G 1P3PA 3W96C 5B2IA 2PYOC 4EO5C 1W2EA 3KUYC 5AV6A 1P3MA 4J8WB 3AZMD 1P3AD 4ZUXD 3AL0C 1BFMA 1F66C 3UTAB 1BH9A 4QLCA 4HGAC 5DNNA 3AV2C 1M1AA 3REKD 3WTPE 1P3KB 2ZY5A 2FJ7C 3B6FC 5DNMC 1P3BD 2AROB 4M6BA 3LZ0B 1TZYD 3AZGD 1KX3B 3REHA 3W98A 3UTBC 5AV8B 4Z2MG 1P3AC 4ZUXC 1M19B 5B0YB 3RELD 4Z5TB 3V9RB 4KHAB 5CPJA 3VH6A 3UT9A 5B40D 2DQNC 5B32A 1P34A 1EQZB 2IO5B 3REJD 1P3BC 5B33C 1TZYC 3WA9D 3C1BC 3W99A 3AYWC 3MVDC 3EPHA 4CSRA 5AVBA 2Y2KA 3KWQC 4DRBA 5AV5B 3AZKA 3AZED 3H0RC 1U35B 5B24A 2UWXA 4J8UD 1TAFB 1KX4D 4KGCD 3REIB 4CAYB 3REJC 4J8VA 3O62A 5GT3C 4WU8C 4Z66A 1ID3B 5CPKB 3B0DB 5B31D 4X23D 1B6WA 1P3PC 2PYOB 3X1SA 4EO5B 3KUYB 3B6GB 3AZHA 1P3MC 3WKJA 1F66B 3MGQD 3AZEC 3AV2B 4HGAB 3MGPD 3X1UD 3B0BA 3LZ1A 5DNNC 1M1AC 2FJ7B 1HQ3D 3B6FB 4KUDA 5DNMB 2CWEA 3LZ0D 5KDMB 1ZLAD 4WZSB 5BNXA 1M18D 1KX3D 2W8SA 5B31C 5B0ZA 3KXBA 3REHC 5E5AA 5JRGA 2YFWB 3UTBB 4H9SA 3AZFA 3AZJD 1P3AB 2F8ND 4ZUXB 2DF4C 5AV8D 4R8PD 1P3GA 3A6ND 3W98C 5B0YD 3MGQC 1P3FA 3LELD 1S32A 3B0CW 4YM6D 3REKB 3C1CD 2LY8A 1HQ3C 2BYKA 1KU5A 1P3BB 1TZYB 5B32C 3AZGB 3AYWB 5JA4B 4JJNA 1M18C 5GXQA 3W99C 3WAAA 2RVQC 3TU4A 3MGRA 5GT0A 1P3LA 5B1MA 3AZJC 5AVBC 1P3OD 2J8PA 4WU9D 2L5AA 3NQJA 3A6NC 3RELB 1AOIA 3LELC 5BS7A 5FUGB 2NQBA 4YM6C 3A1IA 5B40B 3LJAD 5F99A 3REJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 A;  3AV1 A;  3WA9 B;  1P3I A;  3AZL D;  3NQU A;  1P3P B;  4Z66 C;  3W96 D;  3X1S C;  3KUY D;  1P3M B;  3AZE B;  3W97 A;  3WKJ C;  3X1V A;  4E44 A;  5DNN B;  1N1J A;  4J8U B;  3LZ1 C;  3LJA C;  4KGC B;  4H9O B;  4KUD C;  5CP6 A;  4XUJ A;  3AZL C;  1WWI A;  5B31 B;  4X23 B;  5C3I C;  5B0Z C;  5B2J A;  5GSU A;  3KXB C;  3AZI A;  5E5A C;  5JRG C;  3UTB D;  4H9S C;  5AVC A;  3VH5 W;  3AZF C;  4LD9 A;  2HIO A;  3MGQ B;  3MNN A;  3MGP B;  3X1U B;  1S32 C;  1HQ3 B;  4H9P B;  5B32 G;  5B32 B;  5B33 D;  1ZLA B;  3C1B D;  1M18 B;  3VH5 A;  3AYW D;  3X1T D;  3VH6 W;  4XZQ D;  3MVD D;  2CV5 D;  3MGS A;  4G92 B;  3AN2 A;  2F8N G;  1KX5 A;  3MGR C;  4YS3 A;  3AZJ B;  4CSR B;  2BYM B;  5B1M C;  5AV9 A;  3KWQ D;  1P3L C;  4R8P B;  2F8N B;  3A6N B;  3WTP A;  3LEL B;  5BO0 A;  4YM6 B;  3C1C B;  2NQB C;  5B1L A;  4J8X D;  5GXQ C;  3AV1 C;  5GT3 D;  4WU8 D;  1P3I C;  3X1T C;  4XZQ C;  1P3P D;  2CV5 C;  3R45 B;  5B2I D;  3B0C T;  1P3O B;  4H9N B;  5AV6 D;  4WU9 B;  1P3M D;  4J8W A;  3W97 C;  3AFA A;  3UTA A;  4QLC D;  5DNN D;  3LJA B;  1M1A D;  4Z2M H;  5BT1 D;  4J8X C;  1P3K A;  3AZL B;  5CP6 C;  2ARO A;  4ZBJ C;  4XUJ C;  3W96 B;  5C3I B;  5B0Z B;  3REH D;  4H9R B;  1BH8 B;  5B2I C;  4DRA A;  5E5A B;  5B2J C;  3AZI C;  5G49 A;  2NZD A;  3W98 D;  5AV6 C;  1JFI B;  4LD9 C;  5BNV B;  5AVC C;  1M19 A;  4Z5T A;  3V9R A;  3MNN C;  4QLC C;  4KHA A;  5CPJ D;  4H9Q B;  5BT1 C;  3UT9 D;  5B32 D;  1P34 D;  1EQZ A;  3W99 D;  1H3O B;  2RVQ D;  4UUZ B;  1Q9C A;  3MGS C;  1KX5 C;  4YS3 C;  5AVB D;  5AV9 C;  5AV5 A;  3AZK D;  3WTP C;  5B24 D;  1U35 A;  5CPJ C;  3UT9 C;  5B33 B;  1P34 C;  3C1B B;  1TAF A;  3REI A;  3NQU B;  4CAY A;  3MVD B;  4E45 A;  4XZQ B;  3O62 D;  4J8V D;  4Z66 D;  3AZN A;  3X1T B;  2CV5 B;  1ID3 A;  5CPI A;  5CPK A;  2PYO A;  3X1S D;  3KWQ B;  3AZH D;  3B6G A;  4NFT A;  3WKJ D;  3W97 B;  3AZK C;  1F66 A;  4J8W C;  3AFA C;  3AV2 A;  5B24 C;  3LZ1 D;  3UTA C;  4J8X B;  2YFV A;  4KUD D;  2FJ7 A;  3B6F A;  5GT3 B;  5DNM A;  4WU8 B;  3KSY A;  4J8V C;  3O62 C;  5KDM A;  2ARO C;  5B2I B;  5B0Z D;  3KXB D;  5E5A D;  5JRG D;  5AV6 B;  1A7W A;  2YFW A;  3AZH C;  3AZF D;  4NE6 A;  4LD9 B;  2NZD C;  3AZM A;  1P3A A;  1P3G D;  4ZUX A;  4NE3 A;  3MNN B;  1BH9 B;  1P3F D;  4QLC B;  1M19 C;  1S32 D;  1M1A B;  4Z5T C;  3REK A;  1P3B A;  1TZY A;  3AZG A;  2IO5 C;  3REH B;  4JJN D;  3WAA D;  5JA4 A;  3TU4 D;  3MGR D;  5GT0 D;  1P3L D;  5B1M D;  3W98 B;  5AV9 B;  4G91 C;  1P3G C;  2F8N K;  3REL A;  1AOI D;  1P3F C;  5CPJ B;  2NQB D;  5FUG A;  3UT9 B;  1P34 B;  5B40 A;  5GXQ D;  5F99 D;  5AY8 D;  3AV1 D;  3REJ A;  1P3I D;  3WA9 A;  3W99 B;  3REI C;  4JJN C;  3WAA C;  3AZN C;  1ID3 C;  5CPI C;  3TU4 C;  3B0D C;  4WNN A;  5CPK C;  5GT0 C;  5AVB B;  3B6G C;  3AZK B;  3W97 D;  3AZE A;  3AFA B;  1AOI C;  1ULY A;  5B24 B;  5BS7 C;  3X1V D;  4J8U A;  1KX4 A;  5F99 C;  4KGC A;  5AY8 C;  4H9O A;  5CP6 D;  4J8V B;  3O62 B;  4XUJ D;  4Z66 B;  4AWL C;  5B31 A;  4X23 A;  3X1S B;  5B2J D;  5GSU D;  3AZI D;  3AZH B;  5G49 B;  2NZD B;  3WKJ B;  4LD9 D;  5AVC D;  2HIO D;  3AZM C;  3MGQ A;  2F8N H;  3MNN D;  3X1V C;  3LZ1 B;  3MGP A;  3X1U A;  4KUD B;  1HQ3 A;  4H9P A;  3REK C;  1HTA A;  3LZ0 A;  5BNX B;  1ZLA A;  3KXB B;  3AZG C;  1M18 A;  1KX3 A;  3MGS D;  3AN2 D;  2HUE C;  5GSU C;  5JRG B;  3AZF B;  4YS3 D;  1KX5 D;  5AV9 D;  3AZJ A;  4G91 B;  2BYM A;  2F8N A;  1P3G B;  5AV8 A;  4R8P A;  5F99 A;  2HIO C;  3A6N A;  5B0Y A;  1P3F B;  3WTP D;  3REL C;  1S32 B;  3LEL A;  1R4V A;  4YM6 A;  3C1C A;  2BYK B;  5B1L D;  5B40 C;  4JJN B;  3WAA B;  3AZN B;  3WA9 C;  3TU4 B;  5CPI B;  3MGR B;  3AN2 C;  3R45 A;  5GT0 B;  5B1M B;  1P3L B;  1P3O A;  3NQJ B;  4H9N A;  4WU9 A;  1AOI B;  4J8W D;  3AFA D;  2NQB B;  3UTA D;  2JSS A;  2YFV B;  5GXQ B;  5B1L C;  5AY8 B;  5F99 B;  3LJA A;  4J8U C;  3AV1 B;  1P3I B;  3VH5 T;  1P3K D;  1KX4 C;  4KGC C;  3AZL A;  2ARO D;  4AWL B;  1B67 A;  3W96 A;  5CHL B;  4X23 C;  4H9R A;  1BH8 A;  3KUY A;  2NZD D;  3AZM B;  1JFI A;  5BNV A;  1M19 D;  3VH6 T;  3X1V B;  4Z5T D;  1N1J B;  3MGP C;  3X1U C;  4H9Q A;  5CP6 B;  4ZBJ B;  4XUJ B;  1P3K C;  1EQZ D;  3LZ0 C;  1ZLA C;  4NE5 A;  1H3O A;  2HUE B;  5GSU B;  5B2J B;  1KX3 C;  4UUZ A;  3AZI B;  4G92 C;  3UTB A;  5AVC B;  2HIO B;  5AV8 C;  4R8P C;  5AV5 D;  5B0Y C;  1WWS A;  1U35 D;  3C1C C;  4WV4 B;  5B33 A;  3C1B A;  1EQZ C;  3REI D;  3AYW A;  3MVD A;  3AZN D;  4XZQ A;  3MGS B;  3X1T A;  1ID3 D;  3AN2 B;  2CV5 A;  5CPI D;  5CPK D;  4WNN B;  2PYO D;  1KX5 B;  4YS3 B;  3KWQ A;  3B6G D;  1P3O C;  1F1E A;  3WTP B;  4WU9 C;  5BO0 B;  5AV5 C;  1F66 D;  3AV2 D;  1U35 C;  5B1L B;  4J8X A;  1KX4 B;  2FJ7 D;  3B6F D;  5DNM D;  5GT3 A;  4WU8 A;  5B31 G;  1P3P A;  3W96 C;  5B2I A;  2PYO C;  4EO5 C;  3KUY C;  5AV6 A;  1P3M A;  4J8W B;  3AZM D;  1P3A D;  4ZUX D;  1BFM A;  1F66 C;  3UTA B;  1BH9 A;  4QLC A;  4HGA C;  5DNN A;  3AV2 C;  1M1A A;  3REK D;  3WTP E;  1P3K B;  2FJ7 C;  3B6F C;  5DNM C;  1P3B D;  2ARO B;  4M6B A;  3LZ0 B;  1TZY D;  3AZG D;  1KX3 B;  3REH A;  3W98 A;  3UTB C;  5AV8 B;  4Z2M G;  1P3A C;  4ZUX C;  1M19 B;  5B0Y B;  3REL D;  4Z5T B;  3V9R B;  4KHA B;  5CPJ A;  3VH6 A;  3UT9 A;  5B40 D;  5B32 A;  1P34 A;  1EQZ B;  2IO5 B;  3REJ D;  1P3B C;  5B33 C;  1TZY C;  3WA9 D;  3C1B C;  3W99 A;  3AYW C;  3MVD C;  4CSR A;  5AVB A;  3KWQ C;  4DRB A;  5AV5 B;  3AZK A;  3AZE D;  1U35 B;  5B24 A;  4J8U D;  1TAF B;  1KX4 D;  4KGC D;  3REI B;  4CAY B;  3REJ C;  4J8V A;  3O62 A;  5GT3 C;  4WU8 C;  4Z66 A;  1ID3 B;  5CPK B;  3B0D B;  5B31 D;  4X23 D;  1B6W A;  1P3P C;  2PYO B;  3X1S A;  4EO5 B;  3KUY B;  3B6G B;  3AZH A;  1P3M C;  3WKJ A;  1F66 B;  3MGQ D;  3AZE C;  3AV2 B;  4HGA B;  3MGP D;  3X1U D;  3B0B A;  3LZ1 A;  5DNN C;  1M1A C;  2FJ7 B;  1HQ3 D;  3B6F B;  4KUD A;  5DNM B;  2CWE A;  3LZ0 D;  5KDM B;  1ZLA D;  4WZS B;  5BNX A;  1M18 D;  1KX3 D;  3KXB A;  5B31 C;  5B0Z A;  3REH C;  5E5A A;  5JRG A;  2YFW B;  3UTB B;  4H9S A;  3AZF A;  3AZJ D;  1P3A B;  2F8N D;  4ZUX B;  5AV8 D;  4R8P D;  1P3G A;  3W98 C;  3A6N D;  5B0Y D;  3MGQ C;  1P3F A;  3LEL D;  1S32 A;  3B0C W;  4YM6 D;  3REK B;  3C1C D;  2LY8 A;  1HQ3 C;  2BYK A;  1KU5 A;  1P3B B;  1TZY B;  5B32 C;  3AZG B;  3AYW B;  5JA4 B;  4JJN A;  1M18 C;  3WAA A;  3W99 C;  2RVQ C;  3TU4 A;  3MGR A;  5GT0 A;  1P3L A;  5B1M A;  3AZJ C;  5AVB C;  1P3O D;  4WU9 D;  3REL B;  2L5A A;  3NQJ A;  3A6N C;  1AOI A;  3LEL C;  5BS7 A;  5FUG B;  2NQB A;  4YM6 C;  5B40 B;  3LJA D;  5GXQ A;  3REJ B; 
#chains in the Genus database with same CATH topology
 5AY8 A;  3AV1 A;  3WA9 B;  1P3I A;  3AZL D;  3NQU A;  1P3P B;  4Z66 C;  3W96 D;  3X1S C;  3FDD A;  3KUY D;  2Y2H A;  2ZY4 A;  1P3M B;  2Y2M A;  3AZE B;  2Y2G A;  3W97 A;  3WKJ C;  3X1V A;  4E44 A;  5DNN B;  1N1J A;  4J8U B;  3LZ1 C;  3LJA C;  4KGC B;  4H9O B;  4KUD C;  5CP6 A;  4XUJ A;  3AZL C;  1WWI A;  5B31 B;  4X23 B;  5C3I C;  5B0Z C;  5B2J A;  5GSU A;  3KXB C;  2JE5 A;  3AZI A;  5E5A C;  5JRG C;  3UTB D;  4WJ3 C;  4H9S C;  5AVC A;  3VH5 W;  3AZF C;  4LD9 A;  2HIO A;  3MGQ B;  4DQY B;  3MNN A;  3MGP B;  3X1U B;  1S32 C;  1HQ3 B;  4H9P B;  5B32 G;  5B32 B;  3EPJ A;  5B33 D;  1ZLA B;  3C1B D;  1M18 B;  3VH5 A;  3AYW D;  3X1T D;  3VH6 W;  4XZQ D;  3MVD D;  2CV5 D;  3MGS A;  4G92 B;  3AN2 A;  2Y2Q A;  2F8N G;  1KX5 A;  3MGR C;  4YS3 A;  3AZJ B;  4CSR B;  2BYM B;  5B1M C;  5AV9 A;  3KWQ D;  1P3L C;  4R8P B;  2F8N B;  3A6N B;  3WTP A;  3LEL B;  5BO0 A;  4YM6 B;  3C1C B;  2NQB C;  5B1L A;  4J8X D;  5GXQ C;  3AV1 C;  5GT3 D;  4WU8 D;  1P3I C;  3X1T C;  4XZQ C;  1P3P D;  2CV5 C;  3R45 B;  2G5H C;  5B2I D;  3B0C T;  1P3O B;  4H9N B;  5AV6 D;  4WU9 B;  1P3M D;  4J8W A;  3W97 C;  3AFA A;  3P5J B;  3UTA A;  4QLC D;  5DNN D;  3LJA B;  1M1A D;  4Z2M H;  5BT1 D;  4J8X C;  1P3K A;  3AZL B;  5CP6 C;  2ARO A;  4ZBJ C;  4XUJ C;  3W96 B;  5C3I B;  5B0Z B;  3REH D;  4H9R B;  1BH8 B;  5B2I C;  4DRA A;  5E5A B;  5B2J C;  2Y2L A;  3AZI C;  5G49 A;  2NZD A;  3W98 D;  5AV6 C;  1JFI B;  4LD9 C;  5BNV B;  5AVC C;  1M19 A;  4Z5T A;  3V9R A;  3MNN C;  4QLC C;  4KHA A;  5CPJ D;  4H9Q B;  5BT1 C;  3UT9 D;  5B32 D;  1P34 D;  1EQZ A;  3W99 D;  1H3O B;  2RVQ D;  4UUZ B;  1Q9C A;  3MGS C;  2Y2J A;  1KX5 C;  5AVB D;  4YS3 C;  5AV9 C;  2XD1 A;  5AV5 A;  3AZK D;  3WTP C;  5B24 D;  1U35 A;  5CPJ C;  3UT9 C;  5B33 B;  1P34 C;  3C1B B;  1TAF A;  3REI A;  3NQU B;  4CAY A;  3MVD B;  4E45 A;  2JCH A;  4XZQ B;  3O62 D;  4Z66 D;  4J8V D;  3AZN A;  3X1T B;  2CV5 B;  1ID3 A;  5CPI A;  5CPK A;  2PYO A;  3X1S D;  3KWQ B;  2ZY3 A;  3AZH D;  4NFT A;  3B6G A;  3WKJ D;  3W97 B;  3AZK C;  1F66 A;  4J8W C;  3AFA C;  3H0L C;  3AV2 A;  5B24 C;  3LZ1 D;  3UTA C;  4J8X B;  1PZR A;  2YFV A;  4KUD D;  2FJ7 A;  3B6F A;  5GT3 B;  5DNM A;  4WU8 B;  3KSY A;  4J8V C;  3O62 C;  5KDM A;  2ARO C;  5B2I B;  5B0Z D;  3KXB D;  5E5A D;  5JRG D;  5AV6 B;  1A7W A;  2YFW A;  3AZH C;  3AZF D;  4NE6 A;  4LD9 B;  2NZD C;  3AZM A;  1P3A A;  1P3G D;  4ZUX A;  4NE3 A;  3MNN B;  1BH9 B;  1P3F D;  4QLC B;  1M19 C;  1S32 D;  1M1A B;  4Z5T C;  3REK A;  1P3B A;  1TZY A;  3AZG A;  2IO5 C;  3REH B;  4JJN D;  3WAA D;  5JA4 A;  3TU4 D;  3MGR D;  5GT0 D;  1P3L D;  5B1M D;  3W98 B;  5AV9 B;  4G91 C;  1P3G C;  2F8N K;  3REL A;  1AOI D;  1P3F C;  5CPJ B;  2NQB D;  5FUG A;  3UT9 B;  1P34 B;  5B40 A;  5GXQ D;  5F99 D;  5AY8 D;  3AV1 D;  3REJ A;  1P3I D;  3WA9 A;  3W99 B;  3REI C;  4JJN C;  3WAA C;  3AZN C;  1ID3 C;  5CPI C;  3TU4 C;  3B0D C;  4WNN A;  5CPK C;  5GT0 C;  5AVB B;  3B6G C;  2FFF B;  3AZK B;  3W97 D;  3AZE A;  3AFA B;  1AOI C;  1ULY A;  5B24 B;  5BS7 C;  3X1V D;  2ZM5 A;  4J8U A;  1KX4 A;  5F99 C;  4KGC A;  5AY8 C;  4H9O A;  5CP6 D;  4J8V B;  3O62 B;  4XUJ D;  4Z66 B;  4AWL C;  5B31 A;  4X23 A;  3X1S B;  5B2J D;  5GSU D;  2Y2P A;  3AZI D;  3AZH B;  5G49 B;  2NZD B;  3WKJ B;  4LD9 D;  2VQR A;  5AVC D;  2HIO D;  3AZM C;  3MGQ A;  2F8N H;  3MNN D;  3X1V C;  3LZ1 B;  3MGP A;  3X1U A;  4KUD B;  1HQ3 A;  4H9P A;  3REK C;  1HTA A;  3LZ0 A;  5BNX B;  1ZLA A;  3KXB B;  3AZG C;  1M18 A;  1KX3 A;  3MGS D;  3AN2 D;  2HUE C;  2F2A C;  5GSU C;  5JRG B;  3AZF B;  4YS3 D;  1KX5 D;  5AV9 D;  3AZJ A;  4G91 B;  2BYM A;  2F8N A;  1P3G B;  5AV8 A;  4R8P A;  2HIO C;  3A6N A;  5B0Y A;  1P3F B;  3WTP D;  3KFU G;  3REL C;  1S32 B;  3LEL A;  1R4V A;  3EG5 B;  4YM6 A;  3C1C A;  2BYK B;  5B1L D;  5B40 C;  4JJN B;  3WAA B;  3AZN B;  3WA9 C;  3TU4 B;  5CPI B;  3MGR B;  3AN2 C;  3R45 A;  5GT0 B;  3H0M C;  5B1M B;  1P3L B;  1P3O A;  3NQJ B;  4H9N A;  4WU9 A;  1AOI B;  4J8W D;  3AFA D;  2NQB B;  3UTA D;  2JSS A;  2YFV B;  5GXQ B;  5B1L C;  5AY8 B;  5F99 B;  3LJA A;  4J8U C;  3AV1 B;  1P3I B;  3VH5 T;  1P3K D;  1KX4 C;  3EPK A;  4KGC C;  3AZL A;  2ARO D;  4AWL B;  1B67 A;  3W96 A;  5CHL B;  4X23 C;  4H9R A;  1BH8 A;  3KUY A;  4UPK A;  1T3U A;  2NZD D;  3AZM B;  1JFI A;  5BNV A;  3A1K A;  2Y2I A;  3VH6 T;  3EPL A;  3X1V B;  1M19 D;  4Z5T D;  2Y2N A;  1N1J B;  3MGP C;  3X1U C;  4H9Q A;  2XD5 A;  5CP6 B;  4ZBJ B;  4XUJ B;  1P3K C;  1EQZ D;  3LZ0 C;  1ZLA C;  4NE5 A;  1H3O A;  2HUE B;  5GSU B;  5B2J B;  1KX3 C;  4UUZ A;  3AZI B;  4G92 C;  3UTB A;  5AVC B;  2HIO B;  2Y2O A;  2G5I C;  5AV8 C;  4R8P C;  5AV5 D;  5B0Y C;  1WWS A;  1U35 D;  2ZY2 A;  3F6T A;  3C1C C;  4WV4 B;  5B33 A;  3C1B A;  1EQZ C;  3REI D;  3AYW A;  3MVD A;  3AZN D;  4XZQ A;  3MGS B;  3X1T A;  1ID3 D;  3AN2 B;  2CV5 A;  5CPI D;  5CPK D;  4WNN B;  2PYO D;  1KX5 B;  4YS3 B;  2RIQ A;  3KWQ A;  3B6G D;  1P3O C;  1F1E A;  2BG1 A;  3WTP B;  4WU9 C;  1Z2C B;  5BO0 B;  5AV5 C;  1F66 D;  3AV2 D;  1U35 C;  5B1L B;  3IP4 C;  4J8X A;  1KX4 B;  2FJ7 D;  3B6F D;  5DNM D;  5GT3 A;  4WU8 A;  5B31 G;  1P3P A;  3W96 C;  5B2I A;  2PYO C;  4EO5 C;  1W2E A;  3KUY C;  5AV6 A;  1P3M A;  4J8W B;  3AZM D;  1P3A D;  4ZUX D;  3AL0 C;  1BFM A;  1F66 C;  3UTA B;  1BH9 A;  4QLC A;  4HGA C;  5DNN A;  3AV2 C;  1M1A A;  3REK D;  3WTP E;  1P3K B;  2ZY5 A;  2FJ7 C;  3B6F C;  5DNM C;  1P3B D;  2ARO B;  4M6B A;  3LZ0 B;  1TZY D;  3AZG D;  1KX3 B;  3REH A;  3W98 A;  3UTB C;  5AV8 B;  4Z2M G;  1P3A C;  4ZUX C;  1M19 B;  5B0Y B;  3REL D;  4Z5T B;  3V9R B;  4KHA B;  5CPJ A;  3VH6 A;  3UT9 A;  5B40 D;  2DQN C;  5B32 A;  1P34 A;  1EQZ B;  2IO5 B;  3REJ D;  1P3B C;  5B33 C;  1TZY C;  3WA9 D;  3C1B C;  3W99 A;  3AYW C;  3MVD C;  3EPH A;  4CSR A;  5AVB A;  2Y2K A;  3KWQ C;  4DRB A;  5AV5 B;  3AZK A;  3AZE D;  3H0R C;  1U35 B;  5B24 A;  2UWX A;  4J8U D;  1TAF B;  1KX4 D;  4KGC D;  3REI B;  4CAY B;  3REJ C;  4J8V A;  3O62 A;  5GT3 C;  4WU8 C;  4Z66 A;  1ID3 B;  5CPK B;  3B0D B;  5B31 D;  4X23 D;  1B6W A;  1P3P C;  2PYO B;  3X1S A;  4EO5 B;  3KUY B;  3B6G B;  3AZH A;  1P3M C;  3WKJ A;  1F66 B;  3MGQ D;  3AZE C;  3AV2 B;  4HGA B;  3MGP D;  3X1U D;  3B0B A;  3LZ1 A;  5DNN C;  1M1A C;  2FJ7 B;  1HQ3 D;  3B6F B;  4KUD A;  5DNM B;  2CWE A;  3LZ0 D;  5KDM B;  1ZLA D;  4WZS B;  5BNX A;  1M18 D;  1KX3 D;  2W8S A;  5B31 C;  5B0Z A;  3KXB A;  3REH C;  5E5A A;  5JRG A;  2YFW B;  3UTB B;  4H9S A;  3AZF A;  3AZJ D;  1P3A B;  2F8N D;  4ZUX B;  2DF4 C;  5AV8 D;  4R8P D;  1P3G A;  3A6N D;  3W98 C;  5B0Y D;  3MGQ C;  1P3F A;  3LEL D;  1S32 A;  3B0C W;  4YM6 D;  3REK B;  3C1C D;  2LY8 A;  1HQ3 C;  2BYK A;  1KU5 A;  1P3B B;  1TZY B;  5B32 C;  3AZG B;  3AYW B;  5JA4 B;  4JJN A;  1M18 C;  5GXQ A;  3W99 C;  3WAA A;  2RVQ C;  3TU4 A;  3MGR A;  5GT0 A;  1P3L A;  5B1M A;  3AZJ C;  5AVB C;  1P3O D;  2J8P A;  4WU9 D;  2L5A A;  3NQJ A;  3A6N C;  3REL B;  1AOI A;  3LEL C;  5BS7 A;  5FUG B;  2NQB A;  4YM6 C;  3A1I A;  5B40 B;  3LJA D;  5F99 A;  3REJ B; 
#chains in the Genus database with same CATH homology
 5AY8 A;  3AV1 A;  3WA9 B;  1P3I A;  3AZL D;  3NQU A;  1P3P B;  4Z66 C;  3W96 D;  3X1S C;  3FDD A;  3KUY D;  2Y2H A;  2ZY4 A;  1P3M B;  2Y2M A;  3AZE B;  2Y2G A;  3W97 A;  3WKJ C;  3X1V A;  4E44 A;  5DNN B;  1N1J A;  4J8U B;  3LZ1 C;  3LJA C;  4KGC B;  4H9O B;  4KUD C;  5CP6 A;  4XUJ A;  3AZL C;  1WWI A;  5B31 B;  4X23 B;  5C3I C;  5B0Z C;  5B2J A;  5GSU A;  3KXB C;  2JE5 A;  3AZI A;  5E5A C;  5JRG C;  3UTB D;  4WJ3 C;  4H9S C;  5AVC A;  3VH5 W;  3AZF C;  4LD9 A;  2HIO A;  3MGQ B;  4DQY B;  3MNN A;  3MGP B;  3X1U B;  1S32 C;  1HQ3 B;  4H9P B;  5B32 G;  5B32 B;  3EPJ A;  5B33 D;  1ZLA B;  3C1B D;  1M18 B;  3VH5 A;  3AYW D;  3X1T D;  3VH6 W;  4XZQ D;  3MVD D;  2CV5 D;  3MGS A;  4G92 B;  3AN2 A;  2Y2Q A;  2F8N G;  1KX5 A;  3MGR C;  4YS3 A;  3AZJ B;  4CSR B;  2BYM B;  5B1M C;  5AV9 A;  3KWQ D;  1P3L C;  4R8P B;  2F8N B;  3A6N B;  3WTP A;  3LEL B;  5BO0 A;  4YM6 B;  3C1C B;  2NQB C;  5B1L A;  4J8X D;  5GXQ C;  3AV1 C;  5GT3 D;  4WU8 D;  1P3I C;  3X1T C;  4XZQ C;  1P3P D;  2CV5 C;  3R45 B;  2G5H C;  5B2I D;  3B0C T;  1P3O B;  4H9N B;  5AV6 D;  4WU9 B;  1P3M D;  4J8W A;  3W97 C;  3AFA A;  3P5J B;  3UTA A;  4QLC D;  5DNN D;  3LJA B;  1M1A D;  4Z2M H;  5BT1 D;  4J8X C;  1P3K A;  3AZL B;  5CP6 C;  2ARO A;  4ZBJ C;  4XUJ C;  3W96 B;  5C3I B;  5B0Z B;  3REH D;  4H9R B;  1BH8 B;  5B2I C;  4DRA A;  5E5A B;  5B2J C;  2Y2L A;  3AZI C;  5G49 A;  2NZD A;  3W98 D;  5AV6 C;  1JFI B;  4LD9 C;  5BNV B;  5AVC C;  1M19 A;  4Z5T A;  3V9R A;  3MNN C;  4QLC C;  4KHA A;  5CPJ D;  4H9Q B;  5BT1 C;  3UT9 D;  5B32 D;  1P34 D;  1EQZ A;  3W99 D;  1H3O B;  2RVQ D;  4UUZ B;  1Q9C A;  3MGS C;  2Y2J A;  1KX5 C;  5AVB D;  4YS3 C;  5AV9 C;  2XD1 A;  5AV5 A;  3AZK D;  3WTP C;  5B24 D;  1U35 A;  5CPJ C;  3UT9 C;  5B33 B;  1P34 C;  3C1B B;  1TAF A;  3REI A;  3NQU B;  4CAY A;  3MVD B;  4E45 A;  2JCH A;  4XZQ B;  3O62 D;  4Z66 D;  4J8V D;  3AZN A;  3X1T B;  2CV5 B;  1ID3 A;  5CPI A;  5CPK A;  2PYO A;  3X1S D;  3KWQ B;  2ZY3 A;  3AZH D;  4NFT A;  3B6G A;  3WKJ D;  3W97 B;  3AZK C;  1F66 A;  4J8W C;  3AFA C;  3H0L C;  3AV2 A;  5B24 C;  3LZ1 D;  3UTA C;  4J8X B;  1PZR A;  2YFV A;  4KUD D;  2FJ7 A;  3B6F A;  5GT3 B;  5DNM A;  4WU8 B;  3KSY A;  4J8V C;  3O62 C;  5KDM A;  2ARO C;  5B2I B;  5B0Z D;  3KXB D;  5E5A D;  5JRG D;  5AV6 B;  1A7W A;  2YFW A;  3AZH C;  3AZF D;  4NE6 A;  4LD9 B;  2NZD C;  3AZM A;  1P3A A;  1P3G D;  4ZUX A;  4NE3 A;  3MNN B;  1BH9 B;  1P3F D;  4QLC B;  1M19 C;  1S32 D;  1M1A B;  4Z5T C;  3REK A;  1P3B A;  1TZY A;  3AZG A;  2IO5 C;  3REH B;  4JJN D;  3WAA D;  5JA4 A;  3TU4 D;  3MGR D;  5GT0 D;  1P3L D;  5B1M D;  3W98 B;  5AV9 B;  4G91 C;  1P3G C;  2F8N K;  3REL A;  1AOI D;  1P3F C;  5CPJ B;  2NQB D;  5FUG A;  3UT9 B;  1P34 B;  5B40 A;  5GXQ D;  5F99 D;  5AY8 D;  3AV1 D;  3REJ A;  1P3I D;  3WA9 A;  3W99 B;  3REI C;  4JJN C;  3WAA C;  3AZN C;  1ID3 C;  5CPI C;  3TU4 C;  3B0D C;  4WNN A;  5CPK C;  5GT0 C;  5AVB B;  3B6G C;  2FFF B;  3AZK B;  3W97 D;  3AZE A;  3AFA B;  1AOI C;  1ULY A;  5B24 B;  5BS7 C;  3X1V D;  2ZM5 A;  4J8U A;  1KX4 A;  5F99 C;  4KGC A;  5AY8 C;  4H9O A;  5CP6 D;  4J8V B;  3O62 B;  4XUJ D;  4Z66 B;  4AWL C;  5B31 A;  4X23 A;  3X1S B;  5B2J D;  5GSU D;  2Y2P A;  3AZI D;  3AZH B;  5G49 B;  2NZD B;  3WKJ B;  4LD9 D;  2VQR A;  5AVC D;  2HIO D;  3AZM C;  3MGQ A;  2F8N H;  3MNN D;  3X1V C;  3LZ1 B;  3MGP A;  3X1U A;  4KUD B;  1HQ3 A;  4H9P A;  3REK C;  1HTA A;  3LZ0 A;  5BNX B;  1ZLA A;  3KXB B;  3AZG C;  1M18 A;  1KX3 A;  3MGS D;  3AN2 D;  2HUE C;  2F2A C;  5GSU C;  5JRG B;  3AZF B;  4YS3 D;  1KX5 D;  5AV9 D;  3AZJ A;  4G91 B;  2BYM A;  2F8N A;  1P3G B;  5AV8 A;  4R8P A;  2HIO C;  3A6N A;  5B0Y A;  1P3F B;  3WTP D;  3KFU G;  3REL C;  1S32 B;  3LEL A;  1R4V A;  3EG5 B;  4YM6 A;  3C1C A;  2BYK B;  5B1L D;  5B40 C;  4JJN B;  3WAA B;  3AZN B;  3WA9 C;  3TU4 B;  5CPI B;  3MGR B;  3AN2 C;  3R45 A;  5GT0 B;  3H0M C;  5B1M B;  1P3L B;  1P3O A;  3NQJ B;  4H9N A;  4WU9 A;  1AOI B;  4J8W D;  3AFA D;  2NQB B;  3UTA D;  2JSS A;  2YFV B;  5GXQ B;  5B1L C;  5AY8 B;  5F99 B;  3LJA A;  4J8U C;  3AV1 B;  1P3I B;  3VH5 T;  1P3K D;  1KX4 C;  3EPK A;  4KGC C;  3AZL A;  2ARO D;  4AWL B;  1B67 A;  3W96 A;  5CHL B;  4X23 C;  4H9R A;  1BH8 A;  3KUY A;  4UPK A;  1T3U A;  2NZD D;  3AZM B;  1JFI A;  5BNV A;  3A1K A;  2Y2I A;  3VH6 T;  3EPL A;  3X1V B;  1M19 D;  4Z5T D;  2Y2N A;  1N1J B;  3MGP C;  3X1U C;  4H9Q A;  2XD5 A;  5CP6 B;  4ZBJ B;  4XUJ B;  1P3K C;  1EQZ D;  3LZ0 C;  1ZLA C;  4NE5 A;  1H3O A;  2HUE B;  5GSU B;  5B2J B;  1KX3 C;  4UUZ A;  3AZI B;  4G92 C;  3UTB A;  5AVC B;  2HIO B;  2Y2O A;  2G5I C;  5AV8 C;  4R8P C;  5AV5 D;  5B0Y C;  1WWS A;  1U35 D;  2ZY2 A;  3F6T A;  3C1C C;  4WV4 B;  5B33 A;  3C1B A;  1EQZ C;  3REI D;  3AYW A;  3MVD A;  3AZN D;  4XZQ A;  3MGS B;  3X1T A;  1ID3 D;  3AN2 B;  2CV5 A;  5CPI D;  5CPK D;  4WNN B;  2PYO D;  1KX5 B;  4YS3 B;  2RIQ A;  3KWQ A;  3B6G D;  1P3O C;  1F1E A;  2BG1 A;  3WTP B;  4WU9 C;  1Z2C B;  5BO0 B;  5AV5 C;  1F66 D;  3AV2 D;  1U35 C;  5B1L B;  3IP4 C;  4J8X A;  1KX4 B;  2FJ7 D;  3B6F D;  5DNM D;  5GT3 A;  4WU8 A;  5B31 G;  1P3P A;  3W96 C;  5B2I A;  2PYO C;  4EO5 C;  1W2E A;  3KUY C;  5AV6 A;  1P3M A;  4J8W B;  3AZM D;  1P3A D;  4ZUX D;  3AL0 C;  1BFM A;  1F66 C;  3UTA B;  1BH9 A;  4QLC A;  4HGA C;  5DNN A;  3AV2 C;  1M1A A;  3REK D;  3WTP E;  1P3K B;  2ZY5 A;  2FJ7 C;  3B6F C;  5DNM C;  1P3B D;  2ARO B;  4M6B A;  3LZ0 B;  1TZY D;  3AZG D;  1KX3 B;  3REH A;  3W98 A;  3UTB C;  5AV8 B;  4Z2M G;  1P3A C;  4ZUX C;  1M19 B;  5B0Y B;  3REL D;  4Z5T B;  3V9R B;  4KHA B;  5CPJ A;  3VH6 A;  3UT9 A;  5B40 D;  2DQN C;  5B32 A;  1P34 A;  1EQZ B;  2IO5 B;  3REJ D;  1P3B C;  5B33 C;  1TZY C;  3WA9 D;  3C1B C;  3W99 A;  3AYW C;  3MVD C;  3EPH A;  4CSR A;  5AVB A;  2Y2K A;  3KWQ C;  4DRB A;  5AV5 B;  3AZK A;  3AZE D;  3H0R C;  1U35 B;  5B24 A;  2UWX A;  4J8U D;  1TAF B;  1KX4 D;  4KGC D;  3REI B;  4CAY B;  3REJ C;  4J8V A;  3O62 A;  5GT3 C;  4WU8 C;  4Z66 A;  1ID3 B;  5CPK B;  3B0D B;  5B31 D;  4X23 D;  1B6W A;  1P3P C;  2PYO B;  3X1S A;  4EO5 B;  3KUY B;  3B6G B;  3AZH A;  1P3M C;  3WKJ A;  1F66 B;  3MGQ D;  3AZE C;  3AV2 B;  4HGA B;  3MGP D;  3X1U D;  3B0B A;  3LZ1 A;  5DNN C;  1M1A C;  2FJ7 B;  1HQ3 D;  3B6F B;  4KUD A;  5DNM B;  2CWE A;  3LZ0 D;  5KDM B;  1ZLA D;  4WZS B;  5BNX A;  1M18 D;  1KX3 D;  2W8S A;  5B31 C;  5B0Z A;  3KXB A;  3REH C;  5E5A A;  5JRG A;  2YFW B;  3UTB B;  4H9S A;  3AZF A;  3AZJ D;  1P3A B;  2F8N D;  4ZUX B;  2DF4 C;  5AV8 D;  4R8P D;  1P3G A;  3A6N D;  3W98 C;  5B0Y D;  3MGQ C;  1P3F A;  3LEL D;  1S32 A;  3B0C W;  4YM6 D;  3REK B;  3C1C D;  2LY8 A;  1HQ3 C;  2BYK A;  1KU5 A;  1P3B B;  1TZY B;  5B32 C;  3AZG B;  3AYW B;  5JA4 B;  4JJN A;  1M18 C;  5GXQ A;  3W99 C;  3WAA A;  2RVQ C;  3TU4 A;  3MGR A;  5GT0 A;  1P3L A;  5B1M A;  3AZJ C;  5AVB C;  1P3O D;  2J8P A;  4WU9 D;  2L5A A;  3NQJ A;  3A6N C;  3REL B;  1AOI A;  3LEL C;  5BS7 A;  5FUG B;  2NQB A;  4YM6 C;  3A1I A;  5B40 B;  3LJA D;  5F99 A;  3REJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...