4XUJA

Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)ru(3-hydroxy-2-pyridone)cl] compound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
rcsb
source organism Xenopus laevis
molecule tags Dna-binding protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xujA00
1F66C 5GT3C 5B31C 1M19C 5CPID 3WTPA 1B6WA 3REHB 3X1UD 2HUEC 5GSUC 4J8UC 4XUJA 3REJC 3AZFC 1U35D 3RELA 1EQZC 2PYOD 1P3FD 1P3BB 1BH8A 3B6FD 2BYMA 2NZDC 4H9PB 3X1SC 4G92B 1KX4B 3A6NB 3AZEC 5AVCB 3LELB 5CHLB 3WA9B 2YFVA 5CPKA 5B24C 1P34B 5JRGB 5DNMD 1P3KA 1P3IC 4LD9B 3UT9A 4J8VD 1ID3B 1KX5B 2F8NH 5AV9A 4M6BA 3W99C 4H9RB 5B33B 5BO0B 4Z66A 3AZMC 1S32C 5AV5A 4KGCB 2NQBB 3O62B 5AY8D 3B0CT 5CPJC 3NQJB 2CV5B 3REIA 3KUYA 3X1VA 1TZYC 1P3OD 3MGRD 3AV1D 5B2JD 3AFAD 1M1AD 1KU5A 3W96C 1F66A 5B0ZD 3B0DC 3AZJA 4WU8A 3KWQC 1BH9A 5B31A 3UTAA 4EO5B 3LJAA 4R8PB 4H9QB 4KUDD 3AYWB 4WU9C 4J8UA 3REJA 3TU4C 3AZFA 5GT0D 5CPIB 4YS3A 3X1UB 5B1LC 5AV8D 4X23D 4J8WB 4ZBJB 2NZDA 3AZIC 1U35B 4DRBA 5AV6C 1AOIC 5B2IA 2PYOB 5F99C 5B0YD 1P3FB 3AZEA 3B6GC 3AZLC 5B1MD 3REKD 4ZUXC 3MVDD 5JA4A 5B24A 1P3GC 3MGSB 5E5AA 4J8XC 3AZND 1TAFB 1JFIA 3VH6W 3W99A 5DNMB 5AVBC 3C1BB 1P3MC 1P3PC 4H9OB 5GT3B 3C1CA 1M19B 2YFWA 2F8NK 3WTPC 1TZYA 3W98B 3RELC 4Z5TC 3A6ND 3AZKA 4CAYA 5AVCD 3WTPE 3WA9D 5B32A 3X1SB 3KXBB 1P3OB 3MGQD 3MGRB 3KWQA 3MNNC 5JRGD 3W97B 5B2JB 1M1AB 3MGPC 3AZGB 1KX5D 5B0ZB 5CPKC 3AV2B 1HQ3D 1P3KC 1P3IB 1H3OA 5BT1D 4KUDB 2NQBD 3UT9C 2FJ7B 3AZIA 4QLCA 5BNXB 1S32B 1AOIA 4JJNC 3AZLA 4X23B 1ZLAA 3V9RA 2AROC 3UTBB 5B0YB 5GXQA 1P3GA 5CP6C 5B1MB 2HIOC 1B67A 1P3BA 3AZNB 4CSRA 4HGAB 1P3PA 3AZJC 3WKJB 4WU8C 3AN2D 4H9PA 1M18B 3UTAC 3LJAC 3AZHB 4NFTA 4WU9B 3LELA 4J8WD 3LZ0C 3B6FC 4YM6D 4Z66D 4Z5TA 1Q9CA 1WWIA 5AV5D 1P34A 5B1LB 4YS3C 1P3LB 3NQUB 5FUGB 4LD9A 3MNNA 5B2IC 3B6GB 3REID 3X1VD 5B33A 3MGSD 3MGPA 4ZUXB 4AWLB 1P3AD 5B31G 3R45B 1KX3A 3MGQB 4J8VC 3O62A 3WAAD 4J8XB 4KHAB 5E5AC 3X1TD 3C1BD 1F66D 3NQJA 4UUZB 5GT3D 1M19D 3LZ1C 5C3IB 1HQ3B 1A7WA 1ULYA 4JJNA 5AVBB 1P3MB 5GSUD 4J8UD 3REJD 2BYKA 2CWEA 5BNVA 2AROA 3C1CC 3AZFD 1EQZD 3W98D 3WTPB 5B40A 1N1JA 5CP6A 2HIOA 4R8PA 4XUJB 4XZQC 3X1SD 3KXBD 3W97D 3AZKC 1BH8B 2BYMB 3AZGD 5B32C 5B24D 5DNNC 3AV2D 3VH6A 1P3ID 1P3FA 3VH5T 2FJ7D 2YFVB 3W99D 5AV8C 3LZ0A 3B6FA 3AN2B 3AZMD 1S32D 1P3KB 4G91C 5AV9B 4QLCC 4NE5A 3REKC 4Z66B 4YM6B 5CPJD 3UTBD 3MVDC 5AV5B 5B32G 4H9SA 1ZLAC 4H9NA 4J8VA 3REIB 3KUYB 4Z2MG 5GXQC 3X1VB 3W96D 1P3AB 3REHC 3WKJD 3KWQD 3LZ1A 1M18D 5AY8A 3WAAB 3AZHD 3X1TB 1F66B 4WU9D 1P3BC 2L5AA 3TU4D 1BH9B 5B31B 3UTAB 4G92C 3MGRA 3AV1A 1KX4C 5B1LD 3A6NC 4WV4B 3AFAA 2HUEB 5GSUB 3LELC 4J8UB 3REJB 4WNNA 4XZQA 5AV6D 3AZID 3AZFB 1P3LD 1EQZB 5F99D 5B0ZA 3B6GD 3AZLD 1P34C 5JRGC 4NE3A 2NZDB 4ZUXD 2IO5C 2F8NA 4LD9C 5BS7A 5DNNA 1ID3C 3AZEB 5G49A 5GT0A 5B33C 4J8XD 5KDMA 4NE6A 5JA4B 4X23A 5AV8A 1KX3C 4KGCC 5B24B 3O62C 4WZSB 5AVBD 1P3MD 2CV5C 1JFIB 3W99B 2RVQC 5B1MA 3REKA 3AZMB 3MVDA 3WTPD 3C1CB 4XUJD 3RELD 4Z5TD 3AZNA 5CPJB 4E45A 5B40C 1TZYB 4EO5C 4R8PC 3REHA 3MNND 3AYWC 4CAYB 5CPIC 3W96B 1HTAA 3B0DB 3X1UC 3KWQB 4J8WC 5CPKD 1U35C 1P3KD 1KX4A 2PYOC 3A6NA 3UT9D 1P3FC 5AVCA 5AV9D 3TU4B 3WA9A 4JJND 1H3OB 5JRGA 3AZIB 5AV6B 1AOIB 4UUZA 1ID3A 5F99B 1KX5A 1M1AA 3AZLB 3KUYD 4H9RA 5BO0A 1HQ3A 2HIOD 4H9SC 3V9RB 5DNMC 4KGCA 3B0CW 2NQBA 5GXQB 1P3GB 3KSYA 2CV5A 3AZJD 4WU8D 5B31D 3UTAD 3LJAD 3W98C 5AY8C 1F1EA 4CSRB 1P3PB 3LZ0D 3KXBC 1P3OC 4YS3D 3MGRC 3AV1C 3VH5W 3W97C 5B2JC 2NZDD 3AFAC 1M1AC 4H9QA 3RELB 4Z5TB 5B2ID 3AYWA 3AZGC 5B0ZC 3AZED 3AN2A 3AV2C 2IO5B 5CPIA 3X1UA 4KUDC 5BS7C 3MNNB 4J8WA 2FJ7C 1R4VA 4E44A 1U35A 4YM6A 5E5AD 5GT0C 3MGPB 2PYOA 4Z2MH 1KX3B 4X23C 3LZ1D 5CPKB 3UTBC 5B0YC 3UT9B 3MGSA 3C1CD 5B1MC 1P3AA 1TAFA 4JJNB 1TZYD 2F8NG 3WAAA 2BYKB 5BNVB 5DNMA 2AROB 4XZQD 3X1TA 3C1BA 3AZNC 4HGAC 4H9OA 3AZKD 3WKJC 5GT3A 1M19A 5B40B 1N1JB 5CP6B 1M18C 2HIOB 2LY8A 5B32D 3AZHC 2F8ND 5DNND 5GSUA 3W98A 1EQZA 1BFMA 3AZJB 4WU8B 3X1SA 3LJAB 3KXBA 1P3LC 1P3OA 3B0BA 3W97A 5B2JA 5AVCC 4QLCD 3LZ0B 3B6FB 4AWLC 1AOID 3WA9C 3AZGA 3MGQC 4YS3B 3AV2A 1ZLAD 1P3IA 4KUDA 5B2IB 2FJ7A 1KX5C 5GXQD 1P3GD 5C3IC 5BNXA 3AZMA 1S32A 1HQ3C 3REHD 4H9NB 5BT1C 4J8VB 2NQBC 2JSSA 5CPJA 5E5AB 3UTBA 1P3BD 5B0YA 1WWSA 1P3PD 3LZ1B 5AY8B 4XUJC 1KX4D 3VH6T 3LELD 3W96A 2YFWB 3WKJA 3AV1B 4DRAA 1P34D 1M18A 3AFAB 4WNNB 4XZQB 3AZHA 4LD9D 1ID3D 4WU9A 3TU4A 3AZKB 5B33D 3AN2C 3MGPD 5B32B 2F8NB 5B1LA 1KX3D 4KGCD 5DNNB 3O62D 4ZBJC 5AV9C 5G49B 5AV6A 1P3LA 3NQUA 5FUGA 5GT0B 4YM6C 4Z66C 5KDMB 5F99A 5AV5C 2CV5D 3B6GA 5AV8B 2RVQD 4ZUXA 3R45A 4G91B 3MGQA 3REIC 3X1VC 3KUYC 3VH5A 4QLCB 2AROD 4KHAA 3MGSC 4J8XA 3REKB 1P3AC 3MVDB 5B40D 5CP6D 1ZLAB 4R8PD 3WAAC 5AVBA 1P3MA 3X1TC 3C1BC 3AYWD
chains in the Genus database with same CATH superfamily
1F66C 5GT3C 5B31C 2ZY4A 1M19C 2Y2OA 5CPID 3WTPA 1B6WA 3REHB 3X1UD 2Y2NA 2HUEC 5GSUC 4J8UC 4XUJA 3REJC 3AZFC 1U35D 3RELA 1EQZC 2PYOD 3EG5B 1P3FD 1P3BB 1BH8A 3B6FD 2BYMA 2NZDC 4H9PB 3X1SC 4G92B 2Y2QA 1KX4B 3A6NB 3AZEC 5AVCB 3LELB 5CHLB 3WA9B 2YFVA 5CPKA 5B24C 1P34B 5JRGB 5DNMD 1P3KA 2Y2GA 1P3IC 4LD9B 3UT9A 4J8VD 1ID3B 1KX5B 2F8NH 4WJ3C 5AV9A 4M6BA 3W99C 4H9RB 5B33B 5BO0B 4Z66A 3AZMC 1S32C 5AV5A 4KGCB 2NQBB 3O62B 5AY8D 3B0CT 5CPJC 3NQJB 2CV5B 3REIA 3KUYA 3X1VA 1TZYC 1P3OD 3MGRD 3AV1D 5B2JD 3AFAD 1M1AD 1KU5A 3W96C 1F66A 5B0ZD 3B0DC 3AZJA 4WU8A 3KWQC 1BH9A 5B31A 3UTAA 4EO5B 3LJAA 4R8PB 4H9QB 2Y2JA 4KUDD 3AYWB 4WU9C 4J8UA 3REJA 3TU4C 3AZFA 5GT0D 5CPIB 4YS3A 3X1UB 5B1LC 5AV8D 4X23D 4J8WB 4ZBJB 2NZDA 3AZIC 1U35B 4DRBA 5AV6C 1AOIC 5B2IA 2PYOB 5F99C 5B0YD 1P3FB 3AZEA 3B6GC 3AZLC 5B1MD 3REKD 2ZY5A 4ZUXC 3MVDD 5JA4A 5B24A 3EPJA 2BG1A 1P3GC 3MGSB 5E5AA 4J8XC 3AZND 1TAFB 1JFIA 3VH6W 3W99A 5DNMB 2Y2LA 5AVBC 3C1BB 1P3MC 1P3PC 4H9OB 5GT3B 3C1CA 1M19B 2YFWA 2F8NK 3WTPC 1TZYA 3W98B 3RELC 4Z5TC 3A6ND 3AZKA 4CAYA 5AVCD 3WTPE 3WA9D 5B32A 3X1SB 3KXBB 1P3OB 3MGQD 3MGRB 3KWQA 3MNNC 4UPKA 5JRGD 3W97B 2Y2PA 5B2JB 1M1AB 3MGPC 3AZGB 1KX5D 5B0ZB 2UWXA 5CPKC 3AV2B 1HQ3D 1P3KC 1P3IB 1H3OA 5BT1D 4KUDB 2NQBD 3UT9C 2FJ7B 3AZIA 4QLCA 4DQYB 2Y2MA 5BNXB 1S32B 1AOIA 4JJNC 2JCHA 2G5HC 3AZLA 4X23B 1ZLAA 3V9RA 2AROC 3KFUG 3UTBB 5B0YB 5GXQA 1P3GA 5CP6C 5B1MB 2HIOC 1B67A 1P3BA 3AZNB 4CSRA 4HGAB 1P3PA 3AZJC 3WKJB 4WU8C 3AN2D 4H9PA 1M18B 3UTAC 3LJAC 3AZHB 4NFTA 4WU9B 3LELA 4J8WD 3LZ0C 3B6FC 4YM6D 4Z66D 4Z5TA 1Q9CA 1WWIA 5AV5D 2XD1A 2Y2IA 5B1LB 4YS3C 1P34A 3EPHA 1P3LB 3NQUB 5FUGB 4LD9A 3MNNA 5B2IC 3B6GB 3REID 3X1VD 5B33A 3MGSD 3MGPA 4ZUXB 4AWLB 1P3AD 5B31G 3R45B 1KX3A 3MGQB 4J8VC 3O62A 3WAAD 4J8XB 4KHAB 5E5AC 3X1TD 3C1BD 1F66D 3NQJA 4UUZB 5GT3D 1M19D 3LZ1C 5C3IB 1HQ3B 1A7WA 1ULYA 4JJNA 5AVBB 1P3MB 5GSUD 4J8UD 3REJD 2BYKA 2CWEA 5BNVA 2AROA 3C1CC 3AZFD 1EQZD 3W98D 3WTPB 5B40A 1N1JA 5CP6A 2HIOA 4R8PA 4XUJB 4XZQC 3X1SD 3KXBD 3W97D 3AZKC 1BH8B 2BYMB 3AZGD 5B32C 5B24D 5DNNC 3AV2D 3P5JB 3VH6A 1P3ID 1P3FA 3VH5T 2FJ7D 2YFVB 3W99D 5AV8C 3LZ0A 3B6FA 3AN2B 3AZMD 1S32D 1P3KB 4G91C 5AV9B 2ZY3A 4QLCC 4NE5A 3REKC 4Z66B 4YM6B 5CPJD 3UTBD 3MVDC 5AV5B 5B32G 4H9SA 1ZLAC 4H9NA 4J8VA 3REIB 3KUYB 2G5IC 4Z2MG 5GXQC 3X1VB 3W96D 1P3AB 2VQRA 3REHC 3WKJD 3KWQD 3LZ1A 1M18D 5AY8A 3WAAB 3AZHD 3X1TB 1F66B 4WU9D 1P3BC 2L5AA 3TU4D 1BH9B 5B31B 3UTAB 4G92C 3MGRA 3AV1A 1KX4C 3H0RC 5B1LD 3A6NC 4WV4B 3AFAA 2HUEB 5GSUB 3LELC 4J8UB 3REJB 4WNNA 4XZQA 5AV6D 3AZID 3AZFB 1P3LD 1EQZB 5F99D 5B0ZA 3B6GD 3AZLD 1P34C 5JRGC 2J8PA 4NE3A 2NZDB 4ZUXD 2IO5C 2F8NA 4LD9C 5BS7A 5DNNA 1ID3C 3AZEB 5G49A 2JE5A 5GT0A 5B33C 4J8XD 5KDMA 4NE6A 5JA4B 4X23A 5AV8A 1KX3C 4KGCC 5B24B 3O62C 2F2AC 1T3UA 4WZSB 5AVBD 1P3MD 2CV5C 1JFIB 3W99B 2RVQC 5B1MA 3REKA 3AZMB 3MVDA 3WTPD 3C1CB 4XUJD 3RELD 4Z5TD 3AZNA 5CPJB 4E45A 5B40C 1TZYB 4EO5C 4R8PC 3REHA 3H0LC 3MNND 3AYWC 2FFFB 2ZM5A 4CAYB 5CPIC 2DQNC 3W96B 1HTAA 3B0DB 3X1UC 3KWQB 4J8WC 5CPKD 2ZY2A 1U35C 1P3KD 1KX4A 2PYOC 3A6NA 3UT9D 1P3FC 5AVCA 5AV9D 3TU4B 3WA9A 4JJND 1H3OB 3AL0C 5JRGA 3AZIB 5AV6B 1AOIB 4UUZA 1ID3A 5F99B 1KX5A 1M1AA 3AZLB 3KUYD 4H9RA 5BO0A 1HQ3A 2HIOD 4H9SC 3V9RB 5DNMC 4KGCA 3B0CW 2NQBA 5GXQB 1P3GB 3KSYA 2CV5A 3AZJD 4WU8D 5B31D 3UTAD 3LJAD 3W98C 5AY8C 1W2EA 1F1EA 4CSRB 1P3PB 3FDDA 3LZ0D 2W8SA 3KXBC 2DF4C 1P3OC 4YS3D 3MGRC 3AV1C 3VH5W 3W97C 5B2JC 2NZDD 3F6TA 1PZRA 3AFAC 1M1AC 4H9QA 3RELB 4Z5TB 5B2ID 3AYWA 3AZGC 5B0ZC 3AZED 3AN2A 3AV2C 2IO5B 5CPIA 3X1UA 4KUDC 5BS7C 3MNNB 4J8WA 2FJ7C 1R4VA 4E44A 1U35A 4YM6A 5E5AD 5GT0C 3MGPB 2PYOA 4Z2MH 1KX3B 4X23C 3LZ1D 5CPKB 3UTBC 5B0YC 3UT9B 3MGSA 3C1CD 5B1MC 1P3AA 1TAFA 4JJNB 3EPLA 1TZYD 2F8NG 3WAAA 2BYKB 5BNVB 5DNMA 2AROB 4XZQD 3X1TA 3C1BA 3AZNC 4HGAC 4H9OA 3AZKD 3WKJC 5GT3A 1M19A 5B40B 1N1JB 5CP6B 1M18C 2HIOB 2LY8A 5B32D 3AZHC 2F8ND 5DNND 5GSUA 3W98A 1EQZA 1BFMA 3AZJB 4WU8B 1Z2CB 3X1SA 3LJAB 3KXBA 2Y2KA 1P3LC 1P3OA 3B0BA 3W97A 5B2JA 5AVCC 4QLCD 3LZ0B 3B6FB 4AWLC 1AOID 3WA9C 3AZGA 3MGQC 4YS3B 3AV2A 1ZLAD 1P3IA 3A1KA 4KUDA 5B2IB 2FJ7A 1KX5C 2RIQA 5GXQD 1P3GD 5C3IC 5BNXA 3AZMA 1S32A 1HQ3C 3REHD 3IP4C 4H9NB 5BT1C 4J8VB 2NQBC 2JSSA 3EPKA 3H0MC 5E5AB 3UTBA 5CPJA 1P3BD 5B0YA 1WWSA 1P3PD 3LZ1B 5AY8B 4XUJC 1KX4D 3VH6T 3LELD 3W96A 2YFWB 3WKJA 3AV1B 4DRAA 1P34D 1M18A 3AFAB 4WNNB 4XZQB 3AZHA 4LD9D 1ID3D 4WU9A 3TU4A 3AZKB 5B33D 3AN2C 3MGPD 5B32B 2F8NB 5B1LA 3A1IA 1KX3D 4KGCD 5DNNB 3O62D 4ZBJC 5AV9C 5G49B 5AV6A 1P3LA 3NQUA 5FUGA 5GT0B 4YM6C 4Z66C 2XD5A 5F99A 5KDMB 5AV5C 2CV5D 3B6GA 5AV8B 2RVQD 4ZUXA 2Y2HA 3R45A 4G91B 3MGQA 3REIC 3X1VC 3KUYC 3VH5A 4QLCB 2AROD 4KHAA 3MGSC 4J8XA 3REKB 1P3AC 3MVDB 5B40D 5CP6D 1ZLAB 4R8PD 3WAAC 5AVBA 1P3MA 3X1TC 3C1BC 3AYWD
chains in the Genus database with same CATH topology
1F66C 5GT3C 5B31C 2ZY4A 1M19C 2Y2OA 5CPID 3WTPA 1B6WA 3REHB 3X1UD 2Y2NA 2HUEC 5GSUC 4J8UC 4XUJA 3REJC 3AZFC 1U35D 3RELA 1EQZC 2PYOD 3EG5B 1P3FD 1P3BB 1BH8A 3B6FD 2BYMA 2NZDC 4H9PB 3X1SC 4G92B 2Y2QA 1KX4B 3A6NB 3AZEC 5AVCB 3LELB 5CHLB 3WA9B 2YFVA 5CPKA 5B24C 1P34B 5JRGB 5DNMD 1P3KA 2Y2GA 1P3IC 4LD9B 3UT9A 4J8VD 1ID3B 1KX5B 2F8NH 4WJ3C 5AV9A 4M6BA 3W99C 4H9RB 5B33B 5BO0B 4Z66A 3AZMC 1S32C 5AV5A 4KGCB 2NQBB 3O62B 5AY8D 3B0CT 5CPJC 3NQJB 2CV5B 3REIA 3KUYA 3X1VA 1TZYC 1P3OD 3MGRD 3AV1D 5B2JD 3AFAD 1M1AD 1KU5A 3W96C 1F66A 5B0ZD 3B0DC 3AZJA 4WU8A 3KWQC 1BH9A 5B31A 3UTAA 4EO5B 3LJAA 4R8PB 4H9QB 2Y2JA 4KUDD 3AYWB 4WU9C 4J8UA 3REJA 3TU4C 3AZFA 5GT0D 5CPIB 4YS3A 3X1UB 5B1LC 5AV8D 4X23D 4J8WB 4ZBJB 2NZDA 3AZIC 1U35B 4DRBA 5AV6C 1AOIC 5B2IA 2PYOB 5F99C 5B0YD 1P3FB 3AZEA 3B6GC 3AZLC 5B1MD 3REKD 2ZY5A 4ZUXC 3MVDD 5JA4A 5B24A 3EPJA 2BG1A 1P3GC 3MGSB 5E5AA 4J8XC 3AZND 1TAFB 1JFIA 3VH6W 3W99A 5DNMB 2Y2LA 5AVBC 3C1BB 1P3MC 1P3PC 4H9OB 5GT3B 3C1CA 1M19B 2YFWA 2F8NK 3WTPC 1TZYA 3W98B 3RELC 4Z5TC 3A6ND 3AZKA 4CAYA 5AVCD 3WTPE 3WA9D 5B32A 3X1SB 3KXBB 1P3OB 3MGQD 3MGRB 3KWQA 3MNNC 4UPKA 5JRGD 3W97B 2Y2PA 5B2JB 1M1AB 3MGPC 3AZGB 1KX5D 5B0ZB 2UWXA 5CPKC 3AV2B 1HQ3D 1P3KC 1P3IB 1H3OA 5BT1D 4KUDB 2NQBD 3UT9C 2FJ7B 3AZIA 4QLCA 4DQYB 2Y2MA 5BNXB 1S32B 1AOIA 4JJNC 2JCHA 2G5HC 3AZLA 4X23B 1ZLAA 3V9RA 2AROC 3KFUG 3UTBB 5B0YB 5GXQA 1P3GA 5CP6C 5B1MB 2HIOC 1B67A 1P3BA 3AZNB 4CSRA 4HGAB 1P3PA 3AZJC 3WKJB 4WU8C 3AN2D 4H9PA 1M18B 3UTAC 3LJAC 3AZHB 4NFTA 4WU9B 3LELA 4J8WD 3LZ0C 3B6FC 4YM6D 4Z66D 4Z5TA 1Q9CA 1WWIA 5AV5D 2XD1A 2Y2IA 5B1LB 4YS3C 1P34A 3EPHA 1P3LB 3NQUB 5FUGB 4LD9A 3MNNA 5B2IC 3B6GB 3REID 3X1VD 5B33A 3MGSD 3MGPA 4ZUXB 4AWLB 1P3AD 5B31G 3R45B 1KX3A 3MGQB 4J8VC 3O62A 3WAAD 4J8XB 4KHAB 5E5AC 3X1TD 3C1BD 1F66D 3NQJA 4UUZB 5GT3D 1M19D 3LZ1C 5C3IB 1HQ3B 1A7WA 1ULYA 4JJNA 5AVBB 1P3MB 5GSUD 4J8UD 3REJD 2BYKA 2CWEA 5BNVA 2AROA 3C1CC 3AZFD 1EQZD 3W98D 3WTPB 5B40A 1N1JA 5CP6A 2HIOA 4R8PA 4XUJB 4XZQC 3X1SD 3KXBD 3W97D 3AZKC 1BH8B 2BYMB 3AZGD 5B32C 5B24D 5DNNC 3AV2D 3P5JB 3VH6A 1P3ID 1P3FA 3VH5T 2FJ7D 2YFVB 3W99D 5AV8C 3LZ0A 3B6FA 3AN2B 3AZMD 1S32D 1P3KB 4G91C 5AV9B 2ZY3A 4QLCC 4NE5A 3REKC 4Z66B 4YM6B 5CPJD 3UTBD 3MVDC 5AV5B 5B32G 4H9SA 1ZLAC 4H9NA 4J8VA 3REIB 3KUYB 2G5IC 4Z2MG 5GXQC 3X1VB 3W96D 1P3AB 2VQRA 3REHC 3WKJD 3KWQD 3LZ1A 1M18D 5AY8A 3WAAB 3AZHD 3X1TB 1F66B 4WU9D 1P3BC 2L5AA 3TU4D 1BH9B 5B31B 3UTAB 4G92C 3MGRA 3AV1A 1KX4C 3H0RC 5B1LD 3A6NC 4WV4B 3AFAA 2HUEB 5GSUB 3LELC 4J8UB 3REJB 4WNNA 4XZQA 5AV6D 3AZID 3AZFB 1P3LD 1EQZB 5F99D 5B0ZA 3B6GD 3AZLD 1P34C 5JRGC 2J8PA 4NE3A 2NZDB 4ZUXD 2IO5C 2F8NA 4LD9C 5BS7A 5DNNA 1ID3C 3AZEB 5G49A 2JE5A 5GT0A 5B33C 4J8XD 5KDMA 4NE6A 5JA4B 4X23A 5AV8A 1KX3C 4KGCC 5B24B 3O62C 2F2AC 1T3UA 4WZSB 5AVBD 1P3MD 2CV5C 1JFIB 3W99B 2RVQC 5B1MA 3REKA 3AZMB 3MVDA 3WTPD 3C1CB 4XUJD 3RELD 4Z5TD 3AZNA 5CPJB 4E45A 5B40C 1TZYB 4EO5C 4R8PC 3REHA 3H0LC 3MNND 3AYWC 2FFFB 2ZM5A 4CAYB 5CPIC 2DQNC 3W96B 1HTAA 3B0DB 3X1UC 3KWQB 4J8WC 5CPKD 2ZY2A 1U35C 1P3KD 1KX4A 2PYOC 3A6NA 3UT9D 1P3FC 5AVCA 5AV9D 3TU4B 3WA9A 4JJND 1H3OB 3AL0C 5JRGA 3AZIB 5AV6B 1AOIB 4UUZA 1ID3A 5F99B 1KX5A 1M1AA 3AZLB 3KUYD 4H9RA 5BO0A 1HQ3A 2HIOD 4H9SC 3V9RB 5DNMC 4KGCA 3B0CW 2NQBA 5GXQB 1P3GB 3KSYA 2CV5A 3AZJD 4WU8D 5B31D 3UTAD 3LJAD 3W98C 5AY8C 1W2EA 1F1EA 4CSRB 1P3PB 3FDDA 3LZ0D 2W8SA 3KXBC 2DF4C 1P3OC 4YS3D 3MGRC 3AV1C 3VH5W 3W97C 5B2JC 2NZDD 3F6TA 1PZRA 3AFAC 1M1AC 4H9QA 3RELB 4Z5TB 5B2ID 3AYWA 3AZGC 5B0ZC 3AZED 3AN2A 3AV2C 2IO5B 5CPIA 3X1UA 4KUDC 5BS7C 3MNNB 4J8WA 2FJ7C 1R4VA 4E44A 1U35A 4YM6A 5E5AD 5GT0C 3MGPB 2PYOA 4Z2MH 1KX3B 4X23C 3LZ1D 5CPKB 3UTBC 5B0YC 3UT9B 3MGSA 3C1CD 5B1MC 1P3AA 1TAFA 4JJNB 3EPLA 1TZYD 2F8NG 3WAAA 2BYKB 5BNVB 5DNMA 2AROB 4XZQD 3X1TA 3C1BA 3AZNC 4HGAC 4H9OA 3AZKD 3WKJC 5GT3A 1M19A 5B40B 1N1JB 5CP6B 1M18C 2HIOB 2LY8A 5B32D 3AZHC 2F8ND 5DNND 5GSUA 3W98A 1EQZA 1BFMA 3AZJB 4WU8B 1Z2CB 3X1SA 3LJAB 3KXBA 2Y2KA 1P3LC 1P3OA 3B0BA 3W97A 5B2JA 5AVCC 4QLCD 3LZ0B 3B6FB 4AWLC 1AOID 3WA9C 3AZGA 3MGQC 4YS3B 3AV2A 1ZLAD 1P3IA 3A1KA 4KUDA 5B2IB 2FJ7A 1KX5C 2RIQA 5GXQD 1P3GD 5C3IC 5BNXA 3AZMA 1S32A 1HQ3C 3REHD 3IP4C 4H9NB 5BT1C 4J8VB 2NQBC 2JSSA 3EPKA 3H0MC 5E5AB 3UTBA 5CPJA 1P3BD 5B0YA 1WWSA 1P3PD 3LZ1B 5AY8B 4XUJC 1KX4D 3VH6T 3LELD 3W96A 2YFWB 3WKJA 3AV1B 4DRAA 1P34D 1M18A 3AFAB 4WNNB 4XZQB 3AZHA 4LD9D 1ID3D 4WU9A 3TU4A 3AZKB 5B33D 3AN2C 3MGPD 5B32B 2F8NB 5B1LA 3A1IA 1KX3D 4KGCD 5DNNB 3O62D 4ZBJC 5AV9C 5G49B 5AV6A 1P3LA 3NQUA 5FUGA 5GT0B 4YM6C 4Z66C 2XD5A 5F99A 5KDMB 5AV5C 2CV5D 3B6GA 5AV8B 2RVQD 4ZUXA 2Y2HA 3R45A 4G91B 3MGQA 3REIC 3X1VC 3KUYC 3VH5A 4QLCB 2AROD 4KHAA 3MGSC 4J8XA 3REKB 1P3AC 3MVDB 5B40D 5CP6D 1ZLAB 4R8PD 3WAAC 5AVBA 1P3MA 3X1TC 3C1BC 3AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 C;  5GT3 C;  5B31 C;  1M19 C;  5CPI D;  3WTP A;  1B6W A;  3REH B;  3X1U D;  2HUE C;  5GSU C;  4J8U C;  4XUJ A;  3REJ C;  3AZF C;  1U35 D;  3REL A;  1EQZ C;  2PYO D;  1P3F D;  1P3B B;  1BH8 A;  3B6F D;  2BYM A;  2NZD C;  4H9P B;  3X1S C;  4G92 B;  1KX4 B;  3A6N B;  3AZE C;  5AVC B;  3LEL B;  5CHL B;  3WA9 B;  2YFV A;  5CPK A;  5B24 C;  1P34 B;  5JRG B;  5DNM D;  1P3K A;  1P3I C;  4LD9 B;  3UT9 A;  4J8V D;  1ID3 B;  1KX5 B;  2F8N H;  5AV9 A;  4M6B A;  3W99 C;  4H9R B;  5B33 B;  5BO0 B;  4Z66 A;  3AZM C;  1S32 C;  5AV5 A;  4KGC B;  2NQB B;  3O62 B;  5AY8 D;  3B0C T;  5CPJ C;  3NQJ B;  2CV5 B;  3REI A;  3KUY A;  3X1V A;  1TZY C;  1P3O D;  3MGR D;  3AV1 D;  5B2J D;  3AFA D;  1M1A D;  1KU5 A;  3W96 C;  1F66 A;  5B0Z D;  3B0D C;  3AZJ A;  4WU8 A;  3KWQ C;  1BH9 A;  5B31 A;  3UTA A;  4EO5 B;  3LJA A;  4R8P B;  4H9Q B;  4KUD D;  3AYW B;  4WU9 C;  4J8U A;  3REJ A;  3TU4 C;  3AZF A;  5GT0 D;  5CPI B;  4YS3 A;  3X1U B;  5B1L C;  5AV8 D;  4X23 D;  4J8W B;  4ZBJ B;  2NZD A;  3AZI C;  1U35 B;  4DRB A;  5AV6 C;  1AOI C;  5B2I A;  2PYO B;  5F99 C;  5B0Y D;  1P3F B;  3AZE A;  3B6G C;  3AZL C;  5B1M D;  3REK D;  4ZUX C;  3MVD D;  5JA4 A;  5B24 A;  1P3G C;  3MGS B;  5E5A A;  4J8X C;  3AZN D;  1TAF B;  1JFI A;  3VH6 W;  3W99 A;  5DNM B;  5AVB C;  3C1B B;  1P3M C;  1P3P C;  4H9O B;  5GT3 B;  3C1C A;  1M19 B;  2YFW A;  2F8N K;  3WTP C;  1TZY A;  3W98 B;  3REL C;  4Z5T C;  3A6N D;  3AZK A;  4CAY A;  5AVC D;  3WTP E;  3WA9 D;  5B32 A;  3X1S B;  3KXB B;  1P3O B;  3MGQ D;  3MGR B;  3KWQ A;  3MNN C;  5JRG D;  3W97 B;  5B2J B;  1M1A B;  3MGP C;  3AZG B;  1KX5 D;  5B0Z B;  5CPK C;  3AV2 B;  1HQ3 D;  1P3K C;  1P3I B;  1H3O A;  5BT1 D;  4KUD B;  2NQB D;  3UT9 C;  2FJ7 B;  3AZI A;  4QLC A;  5BNX B;  1S32 B;  1AOI A;  4JJN C;  3AZL A;  4X23 B;  1ZLA A;  3V9R A;  2ARO C;  3UTB B;  5B0Y B;  5GXQ A;  1P3G A;  5CP6 C;  5B1M B;  2HIO C;  1B67 A;  1P3B A;  3AZN B;  4CSR A;  4HGA B;  1P3P A;  3AZJ C;  3WKJ B;  4WU8 C;  3AN2 D;  4H9P A;  1M18 B;  3UTA C;  3LJA C;  3AZH B;  4NFT A;  4WU9 B;  3LEL A;  4J8W D;  3LZ0 C;  3B6F C;  4YM6 D;  4Z66 D;  4Z5T A;  1Q9C A;  1WWI A;  5AV5 D;  1P34 A;  5B1L B;  4YS3 C;  1P3L B;  3NQU B;  5FUG B;  4LD9 A;  3MNN A;  5B2I C;  3B6G B;  3REI D;  3X1V D;  5B33 A;  3MGS D;  3MGP A;  4ZUX B;  4AWL B;  1P3A D;  5B31 G;  3R45 B;  1KX3 A;  3MGQ B;  4J8V C;  3O62 A;  3WAA D;  4J8X B;  4KHA B;  5E5A C;  3X1T D;  3C1B D;  1F66 D;  3NQJ A;  4UUZ B;  5GT3 D;  1M19 D;  3LZ1 C;  5C3I B;  1HQ3 B;  1A7W A;  1ULY A;  4JJN A;  5AVB B;  1P3M B;  5GSU D;  4J8U D;  3REJ D;  2BYK A;  2CWE A;  5BNV A;  2ARO A;  3C1C C;  3AZF D;  1EQZ D;  3W98 D;  3WTP B;  5B40 A;  1N1J A;  5CP6 A;  2HIO A;  4R8P A;  4XUJ B;  4XZQ C;  3X1S D;  3KXB D;  3W97 D;  3AZK C;  1BH8 B;  2BYM B;  3AZG D;  5B32 C;  5B24 D;  5DNN C;  3AV2 D;  3VH6 A;  1P3I D;  1P3F A;  3VH5 T;  2FJ7 D;  2YFV B;  3W99 D;  5AV8 C;  3LZ0 A;  3B6F A;  3AN2 B;  3AZM D;  1S32 D;  1P3K B;  4G91 C;  5AV9 B;  4QLC C;  4NE5 A;  3REK C;  4Z66 B;  4YM6 B;  5CPJ D;  3UTB D;  3MVD C;  5AV5 B;  5B32 G;  4H9S A;  1ZLA C;  4H9N A;  4J8V A;  3REI B;  3KUY B;  4Z2M G;  5GXQ C;  3X1V B;  3W96 D;  1P3A B;  3REH C;  3WKJ D;  3KWQ D;  3LZ1 A;  1M18 D;  5AY8 A;  3WAA B;  3AZH D;  3X1T B;  1F66 B;  4WU9 D;  1P3B C;  2L5A A;  3TU4 D;  1BH9 B;  5B31 B;  3UTA B;  4G92 C;  3MGR A;  3AV1 A;  1KX4 C;  5B1L D;  3A6N C;  4WV4 B;  3AFA A;  2HUE B;  5GSU B;  3LEL C;  4J8U B;  3REJ B;  4WNN A;  4XZQ A;  5AV6 D;  3AZI D;  3AZF B;  1P3L D;  1EQZ B;  5F99 D;  5B0Z A;  3B6G D;  3AZL D;  1P34 C;  5JRG C;  4NE3 A;  2NZD B;  4ZUX D;  2IO5 C;  2F8N A;  4LD9 C;  5BS7 A;  5DNN A;  1ID3 C;  3AZE B;  5G49 A;  5GT0 A;  5B33 C;  4J8X D;  5KDM A;  4NE6 A;  5JA4 B;  4X23 A;  5AV8 A;  1KX3 C;  4KGC C;  5B24 B;  3O62 C;  4WZS B;  5AVB D;  1P3M D;  2CV5 C;  1JFI B;  3W99 B;  2RVQ C;  5B1M A;  3REK A;  3AZM B;  3MVD A;  3WTP D;  3C1C B;  4XUJ D;  3REL D;  4Z5T D;  3AZN A;  5CPJ B;  4E45 A;  5B40 C;  1TZY B;  4EO5 C;  4R8P C;  3REH A;  3MNN D;  3AYW C;  4CAY B;  5CPI C;  3W96 B;  1HTA A;  3B0D B;  3X1U C;  3KWQ B;  4J8W C;  5CPK D;  1U35 C;  1P3K D;  1KX4 A;  2PYO C;  3A6N A;  3UT9 D;  1P3F C;  5AVC A;  5AV9 D;  3TU4 B;  3WA9 A;  4JJN D;  1H3O B;  5JRG A;  3AZI B;  5AV6 B;  1AOI B;  4UUZ A;  1ID3 A;  5F99 B;  1KX5 A;  1M1A A;  3AZL B;  3KUY D;  4H9R A;  5BO0 A;  1HQ3 A;  2HIO D;  4H9S C;  3V9R B;  5DNM C;  4KGC A;  3B0C W;  2NQB A;  5GXQ B;  1P3G B;  3KSY A;  2CV5 A;  3AZJ D;  4WU8 D;  5B31 D;  3UTA D;  3LJA D;  3W98 C;  5AY8 C;  1F1E A;  4CSR B;  1P3P B;  3LZ0 D;  3KXB C;  1P3O C;  4YS3 D;  3MGR C;  3AV1 C;  3VH5 W;  3W97 C;  5B2J C;  2NZD D;  3AFA C;  1M1A C;  4H9Q A;  3REL B;  4Z5T B;  5B2I D;  3AYW A;  3AZG C;  5B0Z C;  3AZE D;  3AN2 A;  3AV2 C;  2IO5 B;  5CPI A;  3X1U A;  4KUD C;  5BS7 C;  3MNN B;  4J8W A;  2FJ7 C;  1R4V A;  4E44 A;  1U35 A;  4YM6 A;  5E5A D;  5GT0 C;  3MGP B;  2PYO A;  4Z2M H;  1KX3 B;  4X23 C;  3LZ1 D;  5CPK B;  3UTB C;  5B0Y C;  3UT9 B;  3MGS A;  3C1C D;  5B1M C;  1P3A A;  1TAF A;  4JJN B;  1TZY D;  2F8N G;  3WAA A;  2BYK B;  5BNV B;  5DNM A;  2ARO B;  4XZQ D;  3X1T A;  3C1B A;  3AZN C;  4HGA C;  4H9O A;  3AZK D;  3WKJ C;  5GT3 A;  1M19 A;  5B40 B;  1N1J B;  5CP6 B;  1M18 C;  2HIO B;  2LY8 A;  5B32 D;  3AZH C;  2F8N D;  5DNN D;  5GSU A;  3W98 A;  1EQZ A;  1BFM A;  3AZJ B;  4WU8 B;  3X1S A;  3LJA B;  3KXB A;  1P3L C;  1P3O A;  3B0B A;  3W97 A;  5B2J A;  5AVC C;  4QLC D;  3LZ0 B;  3B6F B;  4AWL C;  1AOI D;  3WA9 C;  3AZG A;  3MGQ C;  4YS3 B;  3AV2 A;  1ZLA D;  1P3I A;  4KUD A;  5B2I B;  2FJ7 A;  1KX5 C;  5GXQ D;  1P3G D;  5C3I C;  5BNX A;  3AZM A;  1S32 A;  1HQ3 C;  3REH D;  4H9N B;  5BT1 C;  4J8V B;  2NQB C;  2JSS A;  5CPJ A;  5E5A B;  3UTB A;  1P3B D;  5B0Y A;  1WWS A;  1P3P D;  3LZ1 B;  5AY8 B;  4XUJ C;  1KX4 D;  3VH6 T;  3LEL D;  3W96 A;  2YFW B;  3WKJ A;  3AV1 B;  4DRA A;  1P34 D;  1M18 A;  3AFA B;  4WNN B;  4XZQ B;  3AZH A;  4LD9 D;  1ID3 D;  4WU9 A;  3TU4 A;  3AZK B;  5B33 D;  3AN2 C;  3MGP D;  5B32 B;  2F8N B;  5B1L A;  1KX3 D;  4KGC D;  5DNN B;  3O62 D;  4ZBJ C;  5AV9 C;  5G49 B;  5AV6 A;  1P3L A;  3NQU A;  5FUG A;  5GT0 B;  4YM6 C;  4Z66 C;  5KDM B;  5F99 A;  5AV5 C;  2CV5 D;  3B6G A;  5AV8 B;  2RVQ D;  4ZUX A;  3R45 A;  4G91 B;  3MGQ A;  3REI C;  3X1V C;  3KUY C;  3VH5 A;  4QLC B;  2ARO D;  4KHA A;  3MGS C;  4J8X A;  3REK B;  1P3A C;  3MVD B;  5B40 D;  5CP6 D;  1ZLA B;  4R8P D;  3WAA C;  5AVB A;  1P3M A;  3X1T C;  3C1B C;  3AYW D; 
#chains in the Genus database with same CATH topology
 1F66 C;  5GT3 C;  5B31 C;  2ZY4 A;  1M19 C;  2Y2O A;  5CPI D;  3WTP A;  1B6W A;  3REH B;  3X1U D;  2Y2N A;  2HUE C;  5GSU C;  4J8U C;  4XUJ A;  3REJ C;  3AZF C;  1U35 D;  3REL A;  1EQZ C;  2PYO D;  3EG5 B;  1P3F D;  1P3B B;  1BH8 A;  3B6F D;  2BYM A;  2NZD C;  4H9P B;  3X1S C;  4G92 B;  2Y2Q A;  1KX4 B;  3A6N B;  3AZE C;  5AVC B;  3LEL B;  5CHL B;  3WA9 B;  2YFV A;  5CPK A;  5B24 C;  1P34 B;  5JRG B;  5DNM D;  1P3K A;  2Y2G A;  1P3I C;  4LD9 B;  3UT9 A;  4J8V D;  1ID3 B;  1KX5 B;  2F8N H;  4WJ3 C;  5AV9 A;  4M6B A;  3W99 C;  4H9R B;  5B33 B;  5BO0 B;  4Z66 A;  3AZM C;  1S32 C;  5AV5 A;  4KGC B;  2NQB B;  3O62 B;  5AY8 D;  3B0C T;  5CPJ C;  3NQJ B;  2CV5 B;  3REI A;  3KUY A;  3X1V A;  1TZY C;  1P3O D;  3MGR D;  3AV1 D;  5B2J D;  3AFA D;  1M1A D;  1KU5 A;  3W96 C;  1F66 A;  5B0Z D;  3B0D C;  3AZJ A;  4WU8 A;  3KWQ C;  1BH9 A;  5B31 A;  3UTA A;  4EO5 B;  3LJA A;  4R8P B;  4H9Q B;  2Y2J A;  4KUD D;  3AYW B;  4WU9 C;  4J8U A;  3REJ A;  3TU4 C;  3AZF A;  5GT0 D;  5CPI B;  4YS3 A;  3X1U B;  5B1L C;  5AV8 D;  4X23 D;  4J8W B;  4ZBJ B;  2NZD A;  3AZI C;  1U35 B;  4DRB A;  5AV6 C;  1AOI C;  5B2I A;  2PYO B;  5F99 C;  5B0Y D;  1P3F B;  3AZE A;  3B6G C;  3AZL C;  5B1M D;  3REK D;  2ZY5 A;  4ZUX C;  3MVD D;  5JA4 A;  5B24 A;  3EPJ A;  2BG1 A;  1P3G C;  3MGS B;  5E5A A;  4J8X C;  3AZN D;  1TAF B;  1JFI A;  3VH6 W;  3W99 A;  5DNM B;  2Y2L A;  5AVB C;  3C1B B;  1P3M C;  1P3P C;  4H9O B;  5GT3 B;  3C1C A;  1M19 B;  2YFW A;  2F8N K;  3WTP C;  1TZY A;  3W98 B;  3REL C;  4Z5T C;  3A6N D;  3AZK A;  4CAY A;  5AVC D;  3WTP E;  3WA9 D;  5B32 A;  3X1S B;  3KXB B;  1P3O B;  3MGQ D;  3MGR B;  3KWQ A;  3MNN C;  4UPK A;  5JRG D;  3W97 B;  2Y2P A;  5B2J B;  1M1A B;  3MGP C;  3AZG B;  1KX5 D;  5B0Z B;  2UWX A;  5CPK C;  3AV2 B;  1HQ3 D;  1P3K C;  1P3I B;  1H3O A;  5BT1 D;  4KUD B;  2NQB D;  3UT9 C;  2FJ7 B;  3AZI A;  4QLC A;  4DQY B;  2Y2M A;  5BNX B;  1S32 B;  1AOI A;  4JJN C;  2JCH A;  2G5H C;  3AZL A;  4X23 B;  1ZLA A;  3V9R A;  2ARO C;  3KFU G;  3UTB B;  5B0Y B;  5GXQ A;  1P3G A;  5CP6 C;  5B1M B;  2HIO C;  1B67 A;  1P3B A;  3AZN B;  4CSR A;  4HGA B;  1P3P A;  3AZJ C;  3WKJ B;  4WU8 C;  3AN2 D;  4H9P A;  1M18 B;  3UTA C;  3LJA C;  3AZH B;  4NFT A;  4WU9 B;  3LEL A;  4J8W D;  3LZ0 C;  3B6F C;  4YM6 D;  4Z66 D;  4Z5T A;  1Q9C A;  1WWI A;  5AV5 D;  2XD1 A;  2Y2I A;  5B1L B;  4YS3 C;  1P34 A;  3EPH A;  1P3L B;  3NQU B;  5FUG B;  4LD9 A;  3MNN A;  5B2I C;  3B6G B;  3REI D;  3X1V D;  5B33 A;  3MGS D;  3MGP A;  4ZUX B;  4AWL B;  1P3A D;  5B31 G;  3R45 B;  1KX3 A;  3MGQ B;  4J8V C;  3O62 A;  3WAA D;  4J8X B;  4KHA B;  5E5A C;  3X1T D;  3C1B D;  1F66 D;  3NQJ A;  4UUZ B;  5GT3 D;  1M19 D;  3LZ1 C;  5C3I B;  1HQ3 B;  1A7W A;  1ULY A;  4JJN A;  5AVB B;  1P3M B;  5GSU D;  4J8U D;  3REJ D;  2BYK A;  2CWE A;  5BNV A;  2ARO A;  3C1C C;  3AZF D;  1EQZ D;  3W98 D;  3WTP B;  5B40 A;  1N1J A;  5CP6 A;  2HIO A;  4R8P A;  4XUJ B;  4XZQ C;  3X1S D;  3KXB D;  3W97 D;  3AZK C;  1BH8 B;  2BYM B;  3AZG D;  5B32 C;  5B24 D;  5DNN C;  3AV2 D;  3P5J B;  3VH6 A;  1P3I D;  1P3F A;  3VH5 T;  2FJ7 D;  2YFV B;  3W99 D;  5AV8 C;  3LZ0 A;  3B6F A;  3AN2 B;  3AZM D;  1S32 D;  1P3K B;  4G91 C;  5AV9 B;  2ZY3 A;  4QLC C;  4NE5 A;  3REK C;  4Z66 B;  4YM6 B;  5CPJ D;  3UTB D;  3MVD C;  5AV5 B;  5B32 G;  4H9S A;  1ZLA C;  4H9N A;  4J8V A;  3REI B;  3KUY B;  2G5I C;  4Z2M G;  5GXQ C;  3X1V B;  3W96 D;  1P3A B;  2VQR A;  3REH C;  3WKJ D;  3KWQ D;  3LZ1 A;  1M18 D;  5AY8 A;  3WAA B;  3AZH D;  3X1T B;  1F66 B;  4WU9 D;  1P3B C;  2L5A A;  3TU4 D;  1BH9 B;  5B31 B;  3UTA B;  4G92 C;  3MGR A;  3AV1 A;  1KX4 C;  3H0R C;  5B1L D;  3A6N C;  4WV4 B;  3AFA A;  2HUE B;  5GSU B;  3LEL C;  4J8U B;  3REJ B;  4WNN A;  4XZQ A;  5AV6 D;  3AZI D;  3AZF B;  1P3L D;  1EQZ B;  5F99 D;  5B0Z A;  3B6G D;  3AZL D;  1P34 C;  5JRG C;  2J8P A;  4NE3 A;  2NZD B;  4ZUX D;  2IO5 C;  2F8N A;  4LD9 C;  5BS7 A;  5DNN A;  1ID3 C;  3AZE B;  5G49 A;  2JE5 A;  5GT0 A;  5B33 C;  4J8X D;  5KDM A;  4NE6 A;  5JA4 B;  4X23 A;  5AV8 A;  1KX3 C;  4KGC C;  5B24 B;  3O62 C;  2F2A C;  1T3U A;  4WZS B;  5AVB D;  1P3M D;  2CV5 C;  1JFI B;  3W99 B;  2RVQ C;  5B1M A;  3REK A;  3AZM B;  3MVD A;  3WTP D;  3C1C B;  4XUJ D;  3REL D;  4Z5T D;  3AZN A;  5CPJ B;  4E45 A;  5B40 C;  1TZY B;  4EO5 C;  4R8P C;  3REH A;  3H0L C;  3MNN D;  3AYW C;  2FFF B;  2ZM5 A;  4CAY B;  5CPI C;  2DQN C;  3W96 B;  1HTA A;  3B0D B;  3X1U C;  3KWQ B;  4J8W C;  5CPK D;  2ZY2 A;  1U35 C;  1P3K D;  1KX4 A;  2PYO C;  3A6N A;  3UT9 D;  1P3F C;  5AVC A;  5AV9 D;  3TU4 B;  3WA9 A;  4JJN D;  1H3O B;  3AL0 C;  5JRG A;  3AZI B;  5AV6 B;  1AOI B;  4UUZ A;  1ID3 A;  5F99 B;  1KX5 A;  1M1A A;  3AZL B;  3KUY D;  4H9R A;  5BO0 A;  1HQ3 A;  2HIO D;  4H9S C;  3V9R B;  5DNM C;  4KGC A;  3B0C W;  2NQB A;  5GXQ B;  1P3G B;  3KSY A;  2CV5 A;  3AZJ D;  4WU8 D;  5B31 D;  3UTA D;  3LJA D;  3W98 C;  5AY8 C;  1W2E A;  1F1E A;  4CSR B;  1P3P B;  3FDD A;  3LZ0 D;  2W8S A;  3KXB C;  2DF4 C;  1P3O C;  4YS3 D;  3MGR C;  3AV1 C;  3VH5 W;  3W97 C;  5B2J C;  2NZD D;  3F6T A;  1PZR A;  3AFA C;  1M1A C;  4H9Q A;  3REL B;  4Z5T B;  5B2I D;  3AYW A;  3AZG C;  5B0Z C;  3AZE D;  3AN2 A;  3AV2 C;  2IO5 B;  5CPI A;  3X1U A;  4KUD C;  5BS7 C;  3MNN B;  4J8W A;  2FJ7 C;  1R4V A;  4E44 A;  1U35 A;  4YM6 A;  5E5A D;  5GT0 C;  3MGP B;  2PYO A;  4Z2M H;  1KX3 B;  4X23 C;  3LZ1 D;  5CPK B;  3UTB C;  5B0Y C;  3UT9 B;  3MGS A;  3C1C D;  5B1M C;  1P3A A;  1TAF A;  4JJN B;  3EPL A;  1TZY D;  2F8N G;  3WAA A;  2BYK B;  5BNV B;  5DNM A;  2ARO B;  4XZQ D;  3X1T A;  3C1B A;  3AZN C;  4HGA C;  4H9O A;  3AZK D;  3WKJ C;  5GT3 A;  1M19 A;  5B40 B;  1N1J B;  5CP6 B;  1M18 C;  2HIO B;  2LY8 A;  5B32 D;  3AZH C;  2F8N D;  5DNN D;  5GSU A;  3W98 A;  1EQZ A;  1BFM A;  3AZJ B;  4WU8 B;  1Z2C B;  3X1S A;  3LJA B;  3KXB A;  2Y2K A;  1P3L C;  1P3O A;  3B0B A;  3W97 A;  5B2J A;  5AVC C;  4QLC D;  3LZ0 B;  3B6F B;  4AWL C;  1AOI D;  3WA9 C;  3AZG A;  3MGQ C;  4YS3 B;  3AV2 A;  1ZLA D;  1P3I A;  3A1K A;  4KUD A;  5B2I B;  2FJ7 A;  1KX5 C;  2RIQ A;  5GXQ D;  1P3G D;  5C3I C;  5BNX A;  3AZM A;  1S32 A;  1HQ3 C;  3REH D;  3IP4 C;  4H9N B;  5BT1 C;  4J8V B;  2NQB C;  2JSS A;  3EPK A;  3H0M C;  5E5A B;  3UTB A;  5CPJ A;  1P3B D;  5B0Y A;  1WWS A;  1P3P D;  3LZ1 B;  5AY8 B;  4XUJ C;  1KX4 D;  3VH6 T;  3LEL D;  3W96 A;  2YFW B;  3WKJ A;  3AV1 B;  4DRA A;  1P34 D;  1M18 A;  3AFA B;  4WNN B;  4XZQ B;  3AZH A;  4LD9 D;  1ID3 D;  4WU9 A;  3TU4 A;  3AZK B;  5B33 D;  3AN2 C;  3MGP D;  5B32 B;  2F8N B;  5B1L A;  3A1I A;  1KX3 D;  4KGC D;  5DNN B;  3O62 D;  4ZBJ C;  5AV9 C;  5G49 B;  5AV6 A;  1P3L A;  3NQU A;  5FUG A;  5GT0 B;  4YM6 C;  4Z66 C;  2XD5 A;  5F99 A;  5KDM B;  5AV5 C;  2CV5 D;  3B6G A;  5AV8 B;  2RVQ D;  4ZUX A;  2Y2H A;  3R45 A;  4G91 B;  3MGQ A;  3REI C;  3X1V C;  3KUY C;  3VH5 A;  4QLC B;  2ARO D;  4KHA A;  3MGS C;  4J8X A;  3REK B;  1P3A C;  3MVD B;  5B40 D;  5CP6 D;  1ZLA B;  4R8P D;  3WAA C;  5AVB A;  1P3M A;  3X1T C;  3C1B C;  3AYW D; 
#chains in the Genus database with same CATH homology
 1F66 C;  5GT3 C;  5B31 C;  2ZY4 A;  1M19 C;  2Y2O A;  5CPI D;  3WTP A;  1B6W A;  3REH B;  3X1U D;  2Y2N A;  2HUE C;  5GSU C;  4J8U C;  4XUJ A;  3REJ C;  3AZF C;  1U35 D;  3REL A;  1EQZ C;  2PYO D;  3EG5 B;  1P3F D;  1P3B B;  1BH8 A;  3B6F D;  2BYM A;  2NZD C;  4H9P B;  3X1S C;  4G92 B;  2Y2Q A;  1KX4 B;  3A6N B;  3AZE C;  5AVC B;  3LEL B;  5CHL B;  3WA9 B;  2YFV A;  5CPK A;  5B24 C;  1P34 B;  5JRG B;  5DNM D;  1P3K A;  2Y2G A;  1P3I C;  4LD9 B;  3UT9 A;  4J8V D;  1ID3 B;  1KX5 B;  2F8N H;  4WJ3 C;  5AV9 A;  4M6B A;  3W99 C;  4H9R B;  5B33 B;  5BO0 B;  4Z66 A;  3AZM C;  1S32 C;  5AV5 A;  4KGC B;  2NQB B;  3O62 B;  5AY8 D;  3B0C T;  5CPJ C;  3NQJ B;  2CV5 B;  3REI A;  3KUY A;  3X1V A;  1TZY C;  1P3O D;  3MGR D;  3AV1 D;  5B2J D;  3AFA D;  1M1A D;  1KU5 A;  3W96 C;  1F66 A;  5B0Z D;  3B0D C;  3AZJ A;  4WU8 A;  3KWQ C;  1BH9 A;  5B31 A;  3UTA A;  4EO5 B;  3LJA A;  4R8P B;  4H9Q B;  2Y2J A;  4KUD D;  3AYW B;  4WU9 C;  4J8U A;  3REJ A;  3TU4 C;  3AZF A;  5GT0 D;  5CPI B;  4YS3 A;  3X1U B;  5B1L C;  5AV8 D;  4X23 D;  4J8W B;  4ZBJ B;  2NZD A;  3AZI C;  1U35 B;  4DRB A;  5AV6 C;  1AOI C;  5B2I A;  2PYO B;  5F99 C;  5B0Y D;  1P3F B;  3AZE A;  3B6G C;  3AZL C;  5B1M D;  3REK D;  2ZY5 A;  4ZUX C;  3MVD D;  5JA4 A;  5B24 A;  3EPJ A;  2BG1 A;  1P3G C;  3MGS B;  5E5A A;  4J8X C;  3AZN D;  1TAF B;  1JFI A;  3VH6 W;  3W99 A;  5DNM B;  2Y2L A;  5AVB C;  3C1B B;  1P3M C;  1P3P C;  4H9O B;  5GT3 B;  3C1C A;  1M19 B;  2YFW A;  2F8N K;  3WTP C;  1TZY A;  3W98 B;  3REL C;  4Z5T C;  3A6N D;  3AZK A;  4CAY A;  5AVC D;  3WTP E;  3WA9 D;  5B32 A;  3X1S B;  3KXB B;  1P3O B;  3MGQ D;  3MGR B;  3KWQ A;  3MNN C;  4UPK A;  5JRG D;  3W97 B;  2Y2P A;  5B2J B;  1M1A B;  3MGP C;  3AZG B;  1KX5 D;  5B0Z B;  2UWX A;  5CPK C;  3AV2 B;  1HQ3 D;  1P3K C;  1P3I B;  1H3O A;  5BT1 D;  4KUD B;  2NQB D;  3UT9 C;  2FJ7 B;  3AZI A;  4QLC A;  4DQY B;  2Y2M A;  5BNX B;  1S32 B;  1AOI A;  4JJN C;  2JCH A;  2G5H C;  3AZL A;  4X23 B;  1ZLA A;  3V9R A;  2ARO C;  3KFU G;  3UTB B;  5B0Y B;  5GXQ A;  1P3G A;  5CP6 C;  5B1M B;  2HIO C;  1B67 A;  1P3B A;  3AZN B;  4CSR A;  4HGA B;  1P3P A;  3AZJ C;  3WKJ B;  4WU8 C;  3AN2 D;  4H9P A;  1M18 B;  3UTA C;  3LJA C;  3AZH B;  4NFT A;  4WU9 B;  3LEL A;  4J8W D;  3LZ0 C;  3B6F C;  4YM6 D;  4Z66 D;  4Z5T A;  1Q9C A;  1WWI A;  5AV5 D;  2XD1 A;  2Y2I A;  5B1L B;  4YS3 C;  1P34 A;  3EPH A;  1P3L B;  3NQU B;  5FUG B;  4LD9 A;  3MNN A;  5B2I C;  3B6G B;  3REI D;  3X1V D;  5B33 A;  3MGS D;  3MGP A;  4ZUX B;  4AWL B;  1P3A D;  5B31 G;  3R45 B;  1KX3 A;  3MGQ B;  4J8V C;  3O62 A;  3WAA D;  4J8X B;  4KHA B;  5E5A C;  3X1T D;  3C1B D;  1F66 D;  3NQJ A;  4UUZ B;  5GT3 D;  1M19 D;  3LZ1 C;  5C3I B;  1HQ3 B;  1A7W A;  1ULY A;  4JJN A;  5AVB B;  1P3M B;  5GSU D;  4J8U D;  3REJ D;  2BYK A;  2CWE A;  5BNV A;  2ARO A;  3C1C C;  3AZF D;  1EQZ D;  3W98 D;  3WTP B;  5B40 A;  1N1J A;  5CP6 A;  2HIO A;  4R8P A;  4XUJ B;  4XZQ C;  3X1S D;  3KXB D;  3W97 D;  3AZK C;  1BH8 B;  2BYM B;  3AZG D;  5B32 C;  5B24 D;  5DNN C;  3AV2 D;  3P5J B;  3VH6 A;  1P3I D;  1P3F A;  3VH5 T;  2FJ7 D;  2YFV B;  3W99 D;  5AV8 C;  3LZ0 A;  3B6F A;  3AN2 B;  3AZM D;  1S32 D;  1P3K B;  4G91 C;  5AV9 B;  2ZY3 A;  4QLC C;  4NE5 A;  3REK C;  4Z66 B;  4YM6 B;  5CPJ D;  3UTB D;  3MVD C;  5AV5 B;  5B32 G;  4H9S A;  1ZLA C;  4H9N A;  4J8V A;  3REI B;  3KUY B;  2G5I C;  4Z2M G;  5GXQ C;  3X1V B;  3W96 D;  1P3A B;  2VQR A;  3REH C;  3WKJ D;  3KWQ D;  3LZ1 A;  1M18 D;  5AY8 A;  3WAA B;  3AZH D;  3X1T B;  1F66 B;  4WU9 D;  1P3B C;  2L5A A;  3TU4 D;  1BH9 B;  5B31 B;  3UTA B;  4G92 C;  3MGR A;  3AV1 A;  1KX4 C;  3H0R C;  5B1L D;  3A6N C;  4WV4 B;  3AFA A;  2HUE B;  5GSU B;  3LEL C;  4J8U B;  3REJ B;  4WNN A;  4XZQ A;  5AV6 D;  3AZI D;  3AZF B;  1P3L D;  1EQZ B;  5F99 D;  5B0Z A;  3B6G D;  3AZL D;  1P34 C;  5JRG C;  2J8P A;  4NE3 A;  2NZD B;  4ZUX D;  2IO5 C;  2F8N A;  4LD9 C;  5BS7 A;  5DNN A;  1ID3 C;  3AZE B;  5G49 A;  2JE5 A;  5GT0 A;  5B33 C;  4J8X D;  5KDM A;  4NE6 A;  5JA4 B;  4X23 A;  5AV8 A;  1KX3 C;  4KGC C;  5B24 B;  3O62 C;  2F2A C;  1T3U A;  4WZS B;  5AVB D;  1P3M D;  2CV5 C;  1JFI B;  3W99 B;  2RVQ C;  5B1M A;  3REK A;  3AZM B;  3MVD A;  3WTP D;  3C1C B;  4XUJ D;  3REL D;  4Z5T D;  3AZN A;  5CPJ B;  4E45 A;  5B40 C;  1TZY B;  4EO5 C;  4R8P C;  3REH A;  3H0L C;  3MNN D;  3AYW C;  2FFF B;  2ZM5 A;  4CAY B;  5CPI C;  2DQN C;  3W96 B;  1HTA A;  3B0D B;  3X1U C;  3KWQ B;  4J8W C;  5CPK D;  2ZY2 A;  1U35 C;  1P3K D;  1KX4 A;  2PYO C;  3A6N A;  3UT9 D;  1P3F C;  5AVC A;  5AV9 D;  3TU4 B;  3WA9 A;  4JJN D;  1H3O B;  3AL0 C;  5JRG A;  3AZI B;  5AV6 B;  1AOI B;  4UUZ A;  1ID3 A;  5F99 B;  1KX5 A;  1M1A A;  3AZL B;  3KUY D;  4H9R A;  5BO0 A;  1HQ3 A;  2HIO D;  4H9S C;  3V9R B;  5DNM C;  4KGC A;  3B0C W;  2NQB A;  5GXQ B;  1P3G B;  3KSY A;  2CV5 A;  3AZJ D;  4WU8 D;  5B31 D;  3UTA D;  3LJA D;  3W98 C;  5AY8 C;  1W2E A;  1F1E A;  4CSR B;  1P3P B;  3FDD A;  3LZ0 D;  2W8S A;  3KXB C;  2DF4 C;  1P3O C;  4YS3 D;  3MGR C;  3AV1 C;  3VH5 W;  3W97 C;  5B2J C;  2NZD D;  3F6T A;  1PZR A;  3AFA C;  1M1A C;  4H9Q A;  3REL B;  4Z5T B;  5B2I D;  3AYW A;  3AZG C;  5B0Z C;  3AZE D;  3AN2 A;  3AV2 C;  2IO5 B;  5CPI A;  3X1U A;  4KUD C;  5BS7 C;  3MNN B;  4J8W A;  2FJ7 C;  1R4V A;  4E44 A;  1U35 A;  4YM6 A;  5E5A D;  5GT0 C;  3MGP B;  2PYO A;  4Z2M H;  1KX3 B;  4X23 C;  3LZ1 D;  5CPK B;  3UTB C;  5B0Y C;  3UT9 B;  3MGS A;  3C1C D;  5B1M C;  1P3A A;  1TAF A;  4JJN B;  3EPL A;  1TZY D;  2F8N G;  3WAA A;  2BYK B;  5BNV B;  5DNM A;  2ARO B;  4XZQ D;  3X1T A;  3C1B A;  3AZN C;  4HGA C;  4H9O A;  3AZK D;  3WKJ C;  5GT3 A;  1M19 A;  5B40 B;  1N1J B;  5CP6 B;  1M18 C;  2HIO B;  2LY8 A;  5B32 D;  3AZH C;  2F8N D;  5DNN D;  5GSU A;  3W98 A;  1EQZ A;  1BFM A;  3AZJ B;  4WU8 B;  1Z2C B;  3X1S A;  3LJA B;  3KXB A;  2Y2K A;  1P3L C;  1P3O A;  3B0B A;  3W97 A;  5B2J A;  5AVC C;  4QLC D;  3LZ0 B;  3B6F B;  4AWL C;  1AOI D;  3WA9 C;  3AZG A;  3MGQ C;  4YS3 B;  3AV2 A;  1ZLA D;  1P3I A;  3A1K A;  4KUD A;  5B2I B;  2FJ7 A;  1KX5 C;  2RIQ A;  5GXQ D;  1P3G D;  5C3I C;  5BNX A;  3AZM A;  1S32 A;  1HQ3 C;  3REH D;  3IP4 C;  4H9N B;  5BT1 C;  4J8V B;  2NQB C;  2JSS A;  3EPK A;  3H0M C;  5E5A B;  3UTB A;  5CPJ A;  1P3B D;  5B0Y A;  1WWS A;  1P3P D;  3LZ1 B;  5AY8 B;  4XUJ C;  1KX4 D;  3VH6 T;  3LEL D;  3W96 A;  2YFW B;  3WKJ A;  3AV1 B;  4DRA A;  1P34 D;  1M18 A;  3AFA B;  4WNN B;  4XZQ B;  3AZH A;  4LD9 D;  1ID3 D;  4WU9 A;  3TU4 A;  3AZK B;  5B33 D;  3AN2 C;  3MGP D;  5B32 B;  2F8N B;  5B1L A;  3A1I A;  1KX3 D;  4KGC D;  5DNN B;  3O62 D;  4ZBJ C;  5AV9 C;  5G49 B;  5AV6 A;  1P3L A;  3NQU A;  5FUG A;  5GT0 B;  4YM6 C;  4Z66 C;  2XD5 A;  5F99 A;  5KDM B;  5AV5 C;  2CV5 D;  3B6G A;  5AV8 B;  2RVQ D;  4ZUX A;  2Y2H A;  3R45 A;  4G91 B;  3MGQ A;  3REI C;  3X1V C;  3KUY C;  3VH5 A;  4QLC B;  2ARO D;  4KHA A;  3MGS C;  4J8X A;  3REK B;  1P3A C;  3MVD B;  5B40 D;  5CP6 D;  1ZLA B;  4R8P D;  3WAA C;  5AVB A;  1P3M A;  3X1T C;  3C1B C;  3AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...