3AZGB

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgB00
5G49B 1P34C 3VH5T 5GT3A 3WKJC 2CWEA 5AY8B 2F8NG 3AZFD 3B6FC 4HGAC 5AVBB 1WWIA 3AFAD 4M6BA 5BNXA 3AZKC 3MGPB 3AZJB 5B32C 1N1JB 1AOIC 1HQ3C 5B1MD 1P3FB 1BH9A 4Z2MG 1A7WA 3WKJA 2F8ND 2RVQD 3AZFB 3B6FA 3AZGC 3AZKA 3AFAB 1ZLAC 4LD9C 4J8WB 3WAAD 3AV1B 1KX3C 5B32A 5AV8D 3AN2D 1HQ3A 5AV6D 5DNMC 5B1MB 4XUJC 3VH6T 3C1CA 4EO5B 4J8VC 2F8NB 3MGSA 4ZUXD 3X1UC 5CPJB 1M19D 1ZLAA 4LD9A 1KX3A 3WAAB 1BFMA 5CPIA 5B33A 3VH5A 5AV6B 5DNMA 4H9SC 5AVCD 4KGCC 3KWQB 1U35D 5CPKA 5B1LA 3A6NC 5BNVA 3X1UA 3W96C 1M19B 5B40C 3X1VD 2NQBD 3MGRC 4H9SA 3KUYD 4KGCA 5AVCB 5B2ID 5BS7C 4XZQA 5CP6A 1P3AC 1U35B 3X1TC 3C1BA 3AV2A 1EQZD 4X23A 5C3IC 1M1AD 5B40A 1WWSA 2YFVA 3X1VB 3MNNC 4H9PB 5AV9C 3KUYB 2IO5C 3A6ND 5B2IB 3MGQB 1P3AA 1B6WA 3W96D 4Z5TC 2PYOB 3V9RB 1EQZB 3MGRD 1ID3D 3AZHA 3B0BA 1M1AB 1JFIA 4YS3C 4H9NA 5GXQB 5AV9A 3X1TD 1KU5A 3TU4D 3KXBC 3B0CW 1P3LD 4KUDD 1P3OD 4WU9B 5AV5D 2NZDC 5B0ZD 5GSUC 5F99C 1ID3B 5GT0C 4YS3A 4YM6D 4R8PA 4Z5TD 4CSRA 1P3LB 4KUDB 1TAFA 4E44A 4Z66C 1P3OB 4J8XA 2NZDA 5AY8C 5AV5B 5B0ZB 3O62C 1P3PB 5AVBC 5GT0A 5DNND 3MGPC 3AZJC 4WU8B 3B6GA 4YM6B 1KX5A 2LY8A 5CHLB 1P3FC 2YFWA 5AY8A 1P3MA 3O62A 3LJAD 3AZFC 3B0CT 3W98D 3REJA 1TZYA 3AFAC 2F8NH 5DNNB 3AV1C 1BH8B 1N1JA 4Z66D 2F8NK 5B1MC 4G92B 3AZLA 5B2JB 3AZID 4J8UD 2RVQC 3W97D 3WA9B 3LJAB 4JJND 3MGPD 3AZJD 4Z2MH 3W98B 4WNNB 1B67A 2FJ7D 3WAAC 1P3BA 4CAYA 5B0YD 3AN2C 5AV6C 4WZSB 5B1MA 1HTAA 4H9QB 3WTPA 3AZIB 4J8UB 2F8NA 3KWQC 1R4VA 3W97B 4J8WD 4JJNB 3AV1D 4ZUXC 1M19C 3WAAA 2FJ7B 2BYKB 5AV8A 3AN2A 5B0YB 1S32D 1P34A 5AVCC 3W99B 5CPJD 1U35C 4ZUXA 1M19A 1AOIA 3LELD 3X1VC 4H9RB 3LZ1D 1S32B 2NQBC 3KWQD 3KUYC 4UUZA 5AVCA 3LZ0D 5B2IC 3MGQC 3AZGA 1U35A 3MVDD 3X1SB 4H9OA 5FUGB 5JRGD 1EQZC 3NQJB 1M1AC 2CV5D 3X1VA 3LELB 2NQBA 4XUJA 3LZ1B 4H9PA 4J8VA 2L5AA 3KUYA 3LZ0B 3MVDB 5GT3B 3RELD 5B31G 5JRGB 1ID3C 2CV5B 5JA4A 3MGQD 5KDMB 3A6NA 2PYOD 3TU4C 4NE6A 1P3LC 4KUDC 3W96A 1BH9B 3C1CD 1P3OC 5B31D 5AV5C 3RELB 5B0ZC 3VH6A 3AZND 3MGRA 3R45A 1P3PC 1ID3A 3B6FB 3AZKB 5GXQD 3UTAD 3AYWD 4WU8C 5BS7A 3REID 5B32B 4YM6C 5B33D 3X1TA 4WU9D 3TU4A 1P3LA 4KUDA 5E5AD 3C1CB 1P3OA 5AV5A 5BO0A 5B31B 5B0ZA 5CPKD 3AZNB 3MNNA 3MGSB 4LD9B 3UTAB 4G91B 5DNNC 3AYWB 4KHAB 4WV4B 3REIB 4YM6A 3REHD 5CPIB 4Z5TA 5B33B 3AZED 4G92C 5E5AB 1P3PD 5CP6D 4XZQD 3WA9C 5BT1D 3LJAC 5CPKB 5B1LB 5BNVB 4WU8D 3AV2D 3W98C 4AWLC 5DNNA 4X23D 1BH8A 4ZBJB 3KXBA 3AZMD 3REHB 3AZEB 5F99A 5GSUA 3AZIC 4J8UC 4XZQB 5CP6B 3W97C 3LJAA 3C1BB 3KSYA 3B0DB 4JJNC 1Q9CA 3AV2B 4WNNA 1F66D 2FJ7C 1P3ID 3AZHD 4X23B 3AZMB 3UT9D 2YFVB 5B0YC 4Z66A 5G49A 5B2JD 2BYMB 3WA9D 3AZIA 4J8UA 3W99C 5AVBA 4QLCD 4JJNA 3MGPA 4J8WC 3AZJA 4E45A 4DRAA 1F66B 1P3IB 3AZHB 1P3FA 5B0YA 3UT9B 1JFIB 1S32C 1P3KD 4H9NB 3VH5W 4EO5C 1M18D 3AZFA 3REKD 3AFAA 4QLCB 5CPJC 4J8WA 3UTBD 3AV1A 3LELC 4H9RA 3LZ1C 1P3FD 3W99D 3B6GD 1P3KB 1M18B 4R8PB 5B24D 3REKB 3LZ0C 5CPJA 1TAFB 3MVDC 5GT3C 4J8XB 3UTBB 1P3MD 1ULYA 5JRGC 1KX4D 3NQJA 5AV6A 1TZYD 2CV5C 5GT0B 2AROD 1P3GD 3KWQA 3B6GB 2HIOD 1KX5B 3LZ0A 5B24B 3AZLD 3X1SD 3MVDA 3RELC 1P3MB 5JRGA 3O62B 1KX4B 3REJB 1TZYB 2CV5A 2AROB 1P3BD 5KDMA 1P3GB 2JSSA 2HIOB 2PYOC 5GT3D 3WTPD 3AZLB 3C1CC 3RELA 5B31C 3AZNC 3MGSC 4NFTA 5B32G 5GXQC 3UTAC 4G91C 1H3OB 3NQUB 3AYWC 5B2IA 3MGQA 3REIC 5CPIC 1P3BB 4CAYB 5B33C 1P34D 2PYOA 4WU9C 3WKJD 3V9RA 3WTPB 5E5AC 1EQZA 3B6FD 5B31A 3AZKD 1M1AA 3AZNA 5CPKC 5BNXB 5B1LC 2HUEB 5B32D 5GXQA 3UTAA 3AYWA 4KHAA 1HQ3D 1AOID 3REIA 4ZBJC 5AV8B 3REHC 3AN2B 3AZEC 4WU9A 1P34B 3WKJB 5E5AA 3MGSD 3AZGD 4HGAB 4XZQC 5CP6C 5BT1C 1ZLAD 4LD9D 3C1BC 3B0DC 1KX3D 3AV2C 4ZUXB 5CPID 1AOIB 1HQ3B 5DNMD 4X23C 3AZMC 3REHA 4XUJD 3AZEA 4J8VD 4UUZB 5B1LD 1P3PA 3AZGB 3X1UD 1ZLAB 4WU8A 1KX3B 4H9OB 1F66C 4NE5A 1P3IC 3AZMA 5DNMB 3AZHC 3UT9C 2NQBB 4XUJB 5B2JC 4KGCD 2BYMA 4J8VB 3C1BD 4QLCC 3X1UB 5B40D 1F66A 1P3IA 3UT9A 5B2JA 5JA4B 4KGCB 1P3KC 3WA9A 1P3AD 1M18C 4R8PC 3A6NB 3REKC 3W98A 4QLCA 3W96B 4J8XC 3UTBC 5B40B 3MGRB 3R45B 3MNND 4H9QA 5AV9D 1P3KA 3B6GC 3W97A 1P3AB 1M18A 3X1TB 1KX5C 3REKA 5B24C 3TU4B 3UTBA 5BO0B 2FJ7A 2BYKA 1P3MC 5C3IB 4YS3D 1KX4C 3MNNB 3REJC 1TZYC 2AROC 5AV9B 4R8PD 2IO5B 3W99A 3KXBD 1P3GC 2HIOC 4Z5TB 5B24A 4J8XD 2NZDD 3AZLC 3X1SC 5F99D 5GSUD 3WTPE 5GT0D 1KX4A 4YS3B 1F1EA 1S32A 2AROA 1KX5D 1P3BC 1P3GA 3KXBB 4CSRB 2HIOA 5AY8D 2NZDB 3X1SA 5FUGA 3WTPC 3O62D 5GSUB 5F99B 5AVBD 3REJD 3LELA 3LZ1A 2HUEC 3VH6W 4AWLB 4NE3A 1H3OA 3NQUA 4DRBA 5AV8C 4Z66B 2YFWB
chains in the Genus database with same CATH superfamily
5G49B 1P34C 3VH5T 5GT3A 3WKJC 2CWEA 5AY8B 2F8NG 3AZFD 3B6FC 4HGAC 5AVBB 1WWIA 3AFAD 4M6BA 5BNXA 3AZKC 3MGPB 3AZJB 5B32C 1N1JB 1AOIC 1HQ3C 5B1MD 1P3FB 1BH9A 3AL0C 4Z2MG 1A7WA 3WKJA 3H0MC 2F8ND 2RVQD 3AZFB 3B6FA 3AZGC 3AZKA 3EPKA 3AFAB 1ZLAC 4LD9C 4J8WB 3WAAD 3EPJA 3AV1B 1KX3C 5B32A 5AV8D 3AN2D 1HQ3A 5AV6D 5DNMC 5B1MB 4XUJC 3VH6T 3C1CA 4EO5B 4J8VC 2F8NB 3MGSA 4ZUXD 3X1UC 5CPJB 1M19D 1ZLAA 4LD9A 1KX3A 3WAAB 1BFMA 5CPIA 5B33A 3VH5A 5AV6B 5DNMA 4H9SC 2JCHA 5AVCD 2UWXA 4KGCC 2Y2QA 3KWQB 1U35D 5CPKA 5B1LA 3A6NC 5BNVA 3X1UA 3W96C 1M19B 5B40C 3X1VD 2NQBD 3MGRC 4H9SA 3KUYD 2Y2MA 4KGCA 5AVCB 5B2ID 2VQRA 4XZQA 5BS7C 5CP6A 1P3AC 1U35B 3X1TC 3C1BA 3AV2A 1EQZD 3F6TA 2F2AC 4X23A 5C3IC 1M1AD 5B40A 1WWSA 2YFVA 3X1VB 3MNNC 4H9PB 5AV9C 3KUYB 2IO5C 3A6ND 5B2IB 3MGQB 1P3AA 1Z2CB 1B6WA 3W96D 3A1IA 4Z5TC 2PYOB 3V9RB 1EQZB 3MGRD 1ID3D 2RIQA 3AZHA 3B0BA 1M1AB 1JFIA 4YS3C 4H9NA 5GXQB 5AV9A 3X1TD 1KU5A 3TU4D 3KXBC 3B0CW 1P3LD 4KUDD 1P3OD 4WU9B 5AV5D 2NZDC 5B0ZD 5GSUC 5F99C 1ID3B 2ZY5A 2Y2IA 5GT0C 4YS3A 4YM6D 4R8PA 4Z5TD 4CSRA 1P3LB 4KUDB 1TAFA 4E44A 4Z66C 1P3OB 4J8XA 2NZDA 5AY8C 5AV5B 5B0ZB 3O62C 1P3PB 5AVBC 5GT0A 5DNND 3MGPC 3AZJC 4WU8B 3B6GA 4YM6B 1KX5A 2LY8A 5CHLB 1P3FC 2YFWA 2G5HC 5AY8A 1P3MA 3O62A 3LJAD 3AZFC 3B0CT 3W98D 3REJA 1TZYA 3AFAC 4DQYB 2F8NH 5DNNB 3AV1C 1BH8B 1N1JA 4Z66D 2F8NK 3IP4C 5B1MC 4G92B 2Y2KA 3AZLA 5B2JB 3AZID 4J8UD 2RVQC 3W97D 3WA9B 3LJAB 4JJND 3MGPD 3AZJD 4Z2MH 3W98B 4WNNB 1B67A 2FJ7D 3WAAC 1P3BA 4CAYA 5B0YD 3AN2C 5AV6C 4WZSB 3A1KA 1HTAA 4H9QB 5B1MA 3WTPA 3AZIB 4J8UB 2F8NA 3KWQC 1R4VA 3W97B 4J8WD 4JJNB 3AV1D 4ZUXC 2JE5A 1M19C 3H0LC 3WAAA 3P5JB 2FJ7B 2BYKB 5AV8A 3AN2A 5B0YB 1S32D 1P34A 2Y2NA 3EG5B 5AVCC 3W99B 5CPJD 1U35C 4ZUXA 1M19A 1AOIA 3LELD 3X1VC 4H9RB 3LZ1D 1S32B 2NQBC 3KWQD 3KUYC 4UUZA 5AVCA 3LZ0D 5B2IC 3MGQC 3AZGA 1U35A 3MVDD 3X1SB 4H9OA 5FUGB 5JRGD 1EQZC 3H0RC 3NQJB 1M1AC 2CV5D 3X1VA 3LELB 2NQBA 4XUJA 3LZ1B 4WJ3C 4H9PA 4J8VA 2L5AA 3KUYA 3LZ0B 3KFUG 3MVDB 5GT3B 3RELD 5B31G 5JRGB 1ID3C 2CV5B 5JA4A 3MGQD 5KDMB 3A6NA 2PYOD 3TU4C 4NE6A 1P3LC 4KUDC 3W96A 1BH9B 3EPLA 3C1CD 1P3OC 5B31D 5AV5C 3RELB 5B0ZC 3VH6A 3AZND 3MGRA 3R45A 1P3PC 1ID3A 3B6FB 3AZKB 5GXQD 3UTAD 3AYWD 4WU8C 5BS7A 3REID 5B32B 4YM6C 5B33D 3X1TA 2W8SA 4WU9D 3TU4A 1P3LA 4KUDA 5E5AD 3C1CB 1P3OA 5AV5A 5BO0A 5B31B 5B0ZA 5CPKD 3AZNB 3MNNA 3MGSB 4LD9B 3UTAB 4G91B 5DNNC 3AYWB 4KHAB 4WV4B 3REIB 4YM6A 3REHD 5CPIB 4Z5TA 5B33B 3AZED 4G92C 5E5AB 1P3PD 5CP6D 4XZQD 3WA9C 5BT1D 2ZY2A 3LJAC 2XD5A 5CPKB 5B1LB 5BNVB 4WU8D 3AV2D 3W98C 4AWLC 2DQNC 5DNNA 4X23D 1BH8A 4ZBJB 3KXBA 3AZMD 3REHB 3AZEB 5F99A 5GSUA 3AZIC 4J8UC 4XZQB 5CP6B 3W97C 3LJAA 3C1BB 3KSYA 3B0DB 4JJNC 1Q9CA 1W2EA 3AV2B 4WNNA 1F66D 2FJ7C 1P3ID 3AZHD 4X23B 3AZMB 3UT9D 2YFVB 5B0YC 4Z66A 5G49A 5B2JD 2BYMB 2Y2LA 3WA9D 3AZIA 4J8UA 3W99C 5AVBA 4QLCD 2ZY3A 4JJNA 3MGPA 4J8WC 3AZJA 3FDDA 4E45A 4DRAA 1F66B 1P3IB 2ZY4A 3AZHB 1P3FA 5B0YA 3UT9B 1JFIB 1S32C 1P3KD 4H9NB 3VH5W 4EO5C 1M18D 3AZFA 3REKD 3AFAA 4QLCB 5CPJC 4J8WA 3UTBD 1T3UA 2BG1A 2FFFB 3AV1A 3LELC 4H9RA 3LZ1C 1P3FD 3W99D 3B6GD 1P3KB 1M18B 2Y2PA 2XD1A 4R8PB 5B24D 3REKB 3LZ0C 3EPHA 5CPJA 1TAFB 3MVDC 5GT3C 4J8XB 3UTBB 1P3MD 1ULYA 5JRGC 1KX4D 3NQJA 5AV6A 1TZYD 2CV5C 5GT0B 2AROD 4UPKA 1P3GD 3KWQA 3B6GB 2HIOD 2Y2OA 1KX5B 3LZ0A 5B24B 3AZLD 3X1SD 3MVDA 3RELC 1P3MB 5JRGA 3O62B 1KX4B 3REJB 1TZYB 2CV5A 2AROB 1P3BD 5KDMA 1P3GB 2JSSA 2HIOB 2PYOC 5GT3D 3WTPD 3AZLB 3C1CC 3RELA 5B31C 3AZNC 3MGSC 4NFTA 5B32G 5GXQC 3UTAC 4G91C 1H3OB 3NQUB 3AYWC 5B2IA 3MGQA 3REIC 5CPIC 1P3BB 4CAYB 5B33C 2J8PA 1P34D 4WU9C 2PYOA 3WKJD 3V9RA 3WTPB 5E5AC 1EQZA 3B6FD 5B31A 3AZKD 1M1AA 3AZNA 5CPKC 5BNXB 5B1LC 2HUEB 5B32D 5GXQA 3UTAA 3AYWA 4KHAA 1HQ3D 1AOID 3REIA 4ZBJC 5AV8B 3REHC 3AN2B 3AZEC 4WU9A 1P34B 3WKJB 5E5AA 3MGSD 3AZGD 4HGAB 4XZQC 2Y2GA 5CP6C 5BT1C 1ZLAD 4LD9D 3C1BC 1PZRA 3B0DC 1KX3D 3AV2C 4ZUXB 5CPID 1AOIB 1HQ3B 5DNMD 4X23C 3AZMC 3REHA 4XUJD 3AZEA 4J8VD 4UUZB 5B1LD 1P3PA 3AZGB 3X1UD 1ZLAB 4WU8A 1KX3B 4H9OB 1F66C 4NE5A 1P3IC 3AZMA 5DNMB 3AZHC 3UT9C 2NQBB 4XUJB 5B2JC 4KGCD 2BYMA 4J8VB 3C1BD 4QLCC 3X1UB 5B40D 1F66A 1P3IA 3UT9A 5B2JA 5JA4B 4KGCB 1P3KC 3WA9A 1P3AD 1M18C 4R8PC 3A6NB 3REKC 3W98A 4QLCA 3W96B 4J8XC 3UTBC 5B40B 3MGRB 3R45B 3MNND 4H9QA 5AV9D 2G5IC 1P3KA 3B6GC 3W97A 1P3AB 1M18A 3X1TB 2Y2HA 1KX5C 3REKA 5B24C 3TU4B 3UTBA 5BO0B 2FJ7A 2BYKA 1P3MC 5C3IB 4YS3D 1KX4C 2DF4C 3MNNB 3REJC 1TZYC 2AROC 5AV9B 4R8PD 2IO5B 3W99A 2Y2JA 3KXBD 1P3GC 2HIOC 4Z5TB 5B24A 4J8XD 2NZDD 3AZLC 3X1SC 5F99D 5GSUD 3WTPE 5GT0D 1KX4A 4YS3B 1F1EA 1S32A 2AROA 1KX5D 1P3BC 1P3GA 3KXBB 4CSRB 2HIOA 5AY8D 2NZDB 3X1SA 5FUGA 3WTPC 3O62D 5GSUB 5F99B 5AVBD 3REJD 3LELA 3LZ1A 2HUEC 2ZM5A 3VH6W 4AWLB 4NE3A 1H3OA 3NQUA 4DRBA 5AV8C 4Z66B 2YFWB
chains in the Genus database with same CATH topology
5G49B 1P34C 3VH5T 5GT3A 3WKJC 2CWEA 5AY8B 2F8NG 3AZFD 3B6FC 4HGAC 5AVBB 1WWIA 3AFAD 4M6BA 5BNXA 3AZKC 3MGPB 3AZJB 5B32C 1N1JB 1AOIC 1HQ3C 5B1MD 1P3FB 1BH9A 3AL0C 4Z2MG 1A7WA 3WKJA 3H0MC 2F8ND 2RVQD 3AZFB 3B6FA 3AZGC 3AZKA 3EPKA 3AFAB 1ZLAC 4LD9C 4J8WB 3WAAD 3EPJA 3AV1B 1KX3C 5B32A 5AV8D 3AN2D 1HQ3A 5AV6D 5DNMC 5B1MB 4XUJC 3VH6T 3C1CA 4EO5B 4J8VC 2F8NB 3MGSA 4ZUXD 3X1UC 5CPJB 1M19D 1ZLAA 4LD9A 1KX3A 3WAAB 1BFMA 5CPIA 5B33A 3VH5A 5AV6B 5DNMA 4H9SC 2JCHA 5AVCD 2UWXA 4KGCC 2Y2QA 3KWQB 1U35D 5CPKA 5B1LA 3A6NC 5BNVA 3X1UA 3W96C 1M19B 5B40C 3X1VD 2NQBD 3MGRC 4H9SA 3KUYD 2Y2MA 4KGCA 5AVCB 5B2ID 2VQRA 4XZQA 5BS7C 5CP6A 1P3AC 1U35B 3X1TC 3C1BA 3AV2A 1EQZD 3F6TA 2F2AC 4X23A 5C3IC 1M1AD 5B40A 1WWSA 2YFVA 3X1VB 3MNNC 4H9PB 5AV9C 3KUYB 2IO5C 3A6ND 5B2IB 3MGQB 1P3AA 1Z2CB 1B6WA 3W96D 3A1IA 4Z5TC 2PYOB 3V9RB 1EQZB 3MGRD 1ID3D 2RIQA 3AZHA 3B0BA 1M1AB 1JFIA 4YS3C 4H9NA 5GXQB 5AV9A 3X1TD 1KU5A 3TU4D 3KXBC 3B0CW 1P3LD 4KUDD 1P3OD 4WU9B 5AV5D 2NZDC 5B0ZD 5GSUC 5F99C 1ID3B 2ZY5A 2Y2IA 5GT0C 4YS3A 4YM6D 4R8PA 4Z5TD 4CSRA 1P3LB 4KUDB 1TAFA 4E44A 4Z66C 1P3OB 4J8XA 2NZDA 5AY8C 5AV5B 5B0ZB 3O62C 1P3PB 5AVBC 5GT0A 5DNND 3MGPC 3AZJC 4WU8B 3B6GA 4YM6B 1KX5A 2LY8A 5CHLB 1P3FC 2YFWA 2G5HC 5AY8A 1P3MA 3O62A 3LJAD 3AZFC 3B0CT 3W98D 3REJA 1TZYA 3AFAC 4DQYB 2F8NH 5DNNB 3AV1C 1BH8B 1N1JA 4Z66D 2F8NK 3IP4C 5B1MC 4G92B 2Y2KA 3AZLA 5B2JB 3AZID 4J8UD 2RVQC 3W97D 3WA9B 3LJAB 4JJND 3MGPD 3AZJD 4Z2MH 3W98B 4WNNB 1B67A 2FJ7D 3WAAC 1P3BA 4CAYA 5B0YD 3AN2C 5AV6C 4WZSB 3A1KA 1HTAA 4H9QB 5B1MA 3WTPA 3AZIB 4J8UB 2F8NA 3KWQC 1R4VA 3W97B 4J8WD 4JJNB 3AV1D 4ZUXC 2JE5A 1M19C 3H0LC 3WAAA 3P5JB 2FJ7B 2BYKB 5AV8A 3AN2A 5B0YB 1S32D 1P34A 2Y2NA 3EG5B 5AVCC 3W99B 5CPJD 1U35C 4ZUXA 1M19A 1AOIA 3LELD 3X1VC 4H9RB 3LZ1D 1S32B 2NQBC 3KWQD 3KUYC 4UUZA 5AVCA 3LZ0D 5B2IC 3MGQC 3AZGA 1U35A 3MVDD 3X1SB 4H9OA 5FUGB 5JRGD 1EQZC 3H0RC 3NQJB 1M1AC 2CV5D 3X1VA 3LELB 2NQBA 4XUJA 3LZ1B 4WJ3C 4H9PA 4J8VA 2L5AA 3KUYA 3LZ0B 3KFUG 3MVDB 5GT3B 3RELD 5B31G 5JRGB 1ID3C 2CV5B 5JA4A 3MGQD 5KDMB 3A6NA 2PYOD 3TU4C 4NE6A 1P3LC 4KUDC 3W96A 1BH9B 3EPLA 3C1CD 1P3OC 5B31D 5AV5C 3RELB 5B0ZC 3VH6A 3AZND 3MGRA 3R45A 1P3PC 1ID3A 3B6FB 3AZKB 5GXQD 3UTAD 3AYWD 4WU8C 5BS7A 3REID 5B32B 4YM6C 5B33D 3X1TA 2W8SA 4WU9D 3TU4A 1P3LA 4KUDA 5E5AD 3C1CB 1P3OA 5AV5A 5BO0A 5B31B 5B0ZA 5CPKD 3AZNB 3MNNA 3MGSB 4LD9B 3UTAB 4G91B 5DNNC 3AYWB 4KHAB 4WV4B 3REIB 4YM6A 3REHD 5CPIB 4Z5TA 5B33B 3AZED 4G92C 5E5AB 1P3PD 5CP6D 4XZQD 3WA9C 5BT1D 2ZY2A 3LJAC 2XD5A 5CPKB 5B1LB 5BNVB 4WU8D 3AV2D 3W98C 4AWLC 2DQNC 5DNNA 4X23D 1BH8A 4ZBJB 3KXBA 3AZMD 3REHB 3AZEB 5F99A 5GSUA 3AZIC 4J8UC 4XZQB 5CP6B 3W97C 3LJAA 3C1BB 3KSYA 3B0DB 4JJNC 1Q9CA 1W2EA 3AV2B 4WNNA 1F66D 2FJ7C 1P3ID 3AZHD 4X23B 3AZMB 3UT9D 2YFVB 5B0YC 4Z66A 5G49A 5B2JD 2BYMB 2Y2LA 3WA9D 3AZIA 4J8UA 3W99C 5AVBA 4QLCD 2ZY3A 4JJNA 3MGPA 4J8WC 3AZJA 3FDDA 4E45A 4DRAA 1F66B 1P3IB 2ZY4A 3AZHB 1P3FA 5B0YA 3UT9B 1JFIB 1S32C 1P3KD 4H9NB 3VH5W 4EO5C 1M18D 3AZFA 3REKD 3AFAA 4QLCB 5CPJC 4J8WA 3UTBD 1T3UA 2BG1A 2FFFB 3AV1A 3LELC 4H9RA 3LZ1C 1P3FD 3W99D 3B6GD 1P3KB 1M18B 2Y2PA 2XD1A 4R8PB 5B24D 3REKB 3LZ0C 3EPHA 5CPJA 1TAFB 3MVDC 5GT3C 4J8XB 3UTBB 1P3MD 1ULYA 5JRGC 1KX4D 3NQJA 5AV6A 1TZYD 2CV5C 5GT0B 2AROD 4UPKA 1P3GD 3KWQA 3B6GB 2HIOD 2Y2OA 1KX5B 3LZ0A 5B24B 3AZLD 3X1SD 3MVDA 3RELC 1P3MB 5JRGA 3O62B 1KX4B 3REJB 1TZYB 2CV5A 2AROB 1P3BD 5KDMA 1P3GB 2JSSA 2HIOB 2PYOC 5GT3D 3WTPD 3AZLB 3C1CC 3RELA 5B31C 3AZNC 3MGSC 4NFTA 5B32G 5GXQC 3UTAC 4G91C 1H3OB 3NQUB 3AYWC 5B2IA 3MGQA 3REIC 5CPIC 1P3BB 4CAYB 5B33C 2J8PA 1P34D 4WU9C 2PYOA 3WKJD 3V9RA 3WTPB 5E5AC 1EQZA 3B6FD 5B31A 3AZKD 1M1AA 3AZNA 5CPKC 5BNXB 5B1LC 2HUEB 5B32D 5GXQA 3UTAA 3AYWA 4KHAA 1HQ3D 1AOID 3REIA 4ZBJC 5AV8B 3REHC 3AN2B 3AZEC 4WU9A 1P34B 3WKJB 5E5AA 3MGSD 3AZGD 4HGAB 4XZQC 2Y2GA 5CP6C 5BT1C 1ZLAD 4LD9D 3C1BC 1PZRA 3B0DC 1KX3D 3AV2C 4ZUXB 5CPID 1AOIB 1HQ3B 5DNMD 4X23C 3AZMC 3REHA 4XUJD 3AZEA 4J8VD 4UUZB 5B1LD 1P3PA 3AZGB 3X1UD 1ZLAB 4WU8A 1KX3B 4H9OB 1F66C 4NE5A 1P3IC 3AZMA 5DNMB 3AZHC 3UT9C 2NQBB 4XUJB 5B2JC 4KGCD 2BYMA 4J8VB 3C1BD 4QLCC 3X1UB 5B40D 1F66A 1P3IA 3UT9A 5B2JA 5JA4B 4KGCB 1P3KC 3WA9A 1P3AD 1M18C 4R8PC 3A6NB 3REKC 3W98A 4QLCA 3W96B 4J8XC 3UTBC 5B40B 3MGRB 3R45B 3MNND 4H9QA 5AV9D 2G5IC 1P3KA 3B6GC 3W97A 1P3AB 1M18A 3X1TB 2Y2HA 1KX5C 3REKA 5B24C 3TU4B 3UTBA 5BO0B 2FJ7A 2BYKA 1P3MC 5C3IB 4YS3D 1KX4C 2DF4C 3MNNB 3REJC 1TZYC 2AROC 5AV9B 4R8PD 2IO5B 3W99A 2Y2JA 3KXBD 1P3GC 2HIOC 4Z5TB 5B24A 4J8XD 2NZDD 3AZLC 3X1SC 5F99D 5GSUD 3WTPE 5GT0D 1KX4A 4YS3B 1F1EA 1S32A 2AROA 1KX5D 1P3BC 1P3GA 3KXBB 4CSRB 2HIOA 5AY8D 2NZDB 3X1SA 5FUGA 3WTPC 3O62D 5GSUB 5F99B 5AVBD 3REJD 3LELA 3LZ1A 2HUEC 2ZM5A 3VH6W 4AWLB 4NE3A 1H3OA 3NQUA 4DRBA 5AV8C 4Z66B 2YFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G49 B;  1P34 C;  3VH5 T;  5GT3 A;  3WKJ C;  2CWE A;  5AY8 B;  2F8N G;  3AZF D;  3B6F C;  4HGA C;  5AVB B;  1WWI A;  3AFA D;  4M6B A;  5BNX A;  3AZK C;  3MGP B;  3AZJ B;  5B32 C;  1N1J B;  1AOI C;  1HQ3 C;  5B1M D;  1P3F B;  1BH9 A;  4Z2M G;  1A7W A;  3WKJ A;  2F8N D;  2RVQ D;  3AZF B;  3B6F A;  3AZG C;  3AZK A;  3AFA B;  1ZLA C;  4LD9 C;  4J8W B;  3WAA D;  3AV1 B;  1KX3 C;  5B32 A;  5AV8 D;  3AN2 D;  1HQ3 A;  5AV6 D;  5DNM C;  5B1M B;  4XUJ C;  3VH6 T;  3C1C A;  4EO5 B;  4J8V C;  2F8N B;  3MGS A;  4ZUX D;  3X1U C;  5CPJ B;  1M19 D;  1ZLA A;  4LD9 A;  1KX3 A;  3WAA B;  1BFM A;  5CPI A;  5B33 A;  3VH5 A;  5AV6 B;  5DNM A;  4H9S C;  5AVC D;  4KGC C;  3KWQ B;  1U35 D;  5CPK A;  5B1L A;  3A6N C;  5BNV A;  3X1U A;  3W96 C;  1M19 B;  5B40 C;  3X1V D;  2NQB D;  3MGR C;  4H9S A;  3KUY D;  4KGC A;  5AVC B;  5B2I D;  5BS7 C;  4XZQ A;  5CP6 A;  1P3A C;  1U35 B;  3X1T C;  3C1B A;  3AV2 A;  1EQZ D;  4X23 A;  5C3I C;  1M1A D;  5B40 A;  1WWS A;  2YFV A;  3X1V B;  3MNN C;  4H9P B;  5AV9 C;  3KUY B;  2IO5 C;  3A6N D;  5B2I B;  3MGQ B;  1P3A A;  1B6W A;  3W96 D;  4Z5T C;  2PYO B;  3V9R B;  1EQZ B;  3MGR D;  1ID3 D;  3AZH A;  3B0B A;  1M1A B;  1JFI A;  4YS3 C;  4H9N A;  5GXQ B;  5AV9 A;  3X1T D;  1KU5 A;  3TU4 D;  3KXB C;  3B0C W;  1P3L D;  4KUD D;  1P3O D;  4WU9 B;  5AV5 D;  2NZD C;  5B0Z D;  5GSU C;  5F99 C;  1ID3 B;  5GT0 C;  4YS3 A;  4YM6 D;  4R8P A;  4Z5T D;  4CSR A;  1P3L B;  4KUD B;  1TAF A;  4E44 A;  4Z66 C;  1P3O B;  4J8X A;  2NZD A;  5AY8 C;  5AV5 B;  5B0Z B;  3O62 C;  1P3P B;  5AVB C;  5GT0 A;  5DNN D;  3MGP C;  3AZJ C;  4WU8 B;  3B6G A;  4YM6 B;  1KX5 A;  2LY8 A;  5CHL B;  1P3F C;  2YFW A;  5AY8 A;  1P3M A;  3O62 A;  3LJA D;  3AZF C;  3B0C T;  3W98 D;  3REJ A;  1TZY A;  3AFA C;  2F8N H;  5DNN B;  3AV1 C;  1BH8 B;  1N1J A;  4Z66 D;  2F8N K;  5B1M C;  4G92 B;  3AZL A;  5B2J B;  3AZI D;  4J8U D;  2RVQ C;  3W97 D;  3WA9 B;  3LJA B;  4JJN D;  3MGP D;  3AZJ D;  4Z2M H;  3W98 B;  4WNN B;  1B67 A;  2FJ7 D;  3WAA C;  1P3B A;  4CAY A;  5B0Y D;  3AN2 C;  5AV6 C;  4WZS B;  5B1M A;  1HTA A;  4H9Q B;  3WTP A;  3AZI B;  4J8U B;  2F8N A;  3KWQ C;  1R4V A;  3W97 B;  4J8W D;  4JJN B;  3AV1 D;  4ZUX C;  1M19 C;  3WAA A;  2FJ7 B;  2BYK B;  5AV8 A;  3AN2 A;  5B0Y B;  1S32 D;  1P34 A;  5AVC C;  3W99 B;  5CPJ D;  1U35 C;  4ZUX A;  1M19 A;  1AOI A;  3LEL D;  3X1V C;  4H9R B;  3LZ1 D;  1S32 B;  2NQB C;  3KWQ D;  3KUY C;  4UUZ A;  5AVC A;  3LZ0 D;  5B2I C;  3MGQ C;  3AZG A;  1U35 A;  3MVD D;  3X1S B;  4H9O A;  5FUG B;  5JRG D;  1EQZ C;  3NQJ B;  1M1A C;  2CV5 D;  3X1V A;  3LEL B;  2NQB A;  4XUJ A;  3LZ1 B;  4H9P A;  4J8V A;  2L5A A;  3KUY A;  3LZ0 B;  3MVD B;  5GT3 B;  3REL D;  5B31 G;  5JRG B;  1ID3 C;  2CV5 B;  5JA4 A;  3MGQ D;  5KDM B;  3A6N A;  2PYO D;  3TU4 C;  4NE6 A;  1P3L C;  4KUD C;  3W96 A;  1BH9 B;  3C1C D;  1P3O C;  5B31 D;  5AV5 C;  3REL B;  5B0Z C;  3VH6 A;  3AZN D;  3MGR A;  3R45 A;  1P3P C;  1ID3 A;  3B6F B;  3AZK B;  5GXQ D;  3UTA D;  3AYW D;  4WU8 C;  5BS7 A;  3REI D;  5B32 B;  4YM6 C;  5B33 D;  3X1T A;  4WU9 D;  3TU4 A;  1P3L A;  4KUD A;  5E5A D;  3C1C B;  1P3O A;  5AV5 A;  5BO0 A;  5B31 B;  5B0Z A;  5CPK D;  3AZN B;  3MNN A;  3MGS B;  4LD9 B;  3UTA B;  4G91 B;  5DNN C;  3AYW B;  4KHA B;  4WV4 B;  3REI B;  4YM6 A;  3REH D;  5CPI B;  4Z5T A;  5B33 B;  3AZE D;  4G92 C;  5E5A B;  1P3P D;  5CP6 D;  4XZQ D;  3WA9 C;  5BT1 D;  3LJA C;  5CPK B;  5B1L B;  5BNV B;  4WU8 D;  3AV2 D;  3W98 C;  4AWL C;  5DNN A;  4X23 D;  1BH8 A;  4ZBJ B;  3KXB A;  3AZM D;  3REH B;  3AZE B;  5F99 A;  5GSU A;  3AZI C;  4J8U C;  4XZQ B;  5CP6 B;  3W97 C;  3LJA A;  3C1B B;  3KSY A;  3B0D B;  4JJN C;  1Q9C A;  3AV2 B;  4WNN A;  1F66 D;  2FJ7 C;  1P3I D;  3AZH D;  4X23 B;  3AZM B;  3UT9 D;  2YFV B;  5B0Y C;  4Z66 A;  5G49 A;  5B2J D;  2BYM B;  3WA9 D;  3AZI A;  4J8U A;  3W99 C;  5AVB A;  4QLC D;  4JJN A;  3MGP A;  4J8W C;  3AZJ A;  4E45 A;  4DRA A;  1F66 B;  1P3I B;  3AZH B;  1P3F A;  5B0Y A;  3UT9 B;  1JFI B;  1S32 C;  1P3K D;  4H9N B;  3VH5 W;  4EO5 C;  1M18 D;  3AZF A;  3REK D;  3AFA A;  4QLC B;  5CPJ C;  4J8W A;  3UTB D;  3AV1 A;  3LEL C;  4H9R A;  3LZ1 C;  1P3F D;  3W99 D;  3B6G D;  1P3K B;  1M18 B;  4R8P B;  5B24 D;  3REK B;  3LZ0 C;  5CPJ A;  1TAF B;  3MVD C;  5GT3 C;  4J8X B;  3UTB B;  1P3M D;  1ULY A;  5JRG C;  1KX4 D;  3NQJ A;  5AV6 A;  1TZY D;  2CV5 C;  5GT0 B;  2ARO D;  1P3G D;  3KWQ A;  3B6G B;  2HIO D;  1KX5 B;  3LZ0 A;  5B24 B;  3AZL D;  3X1S D;  3MVD A;  3REL C;  1P3M B;  5JRG A;  3O62 B;  1KX4 B;  3REJ B;  1TZY B;  2CV5 A;  2ARO B;  1P3B D;  5KDM A;  1P3G B;  2JSS A;  2HIO B;  2PYO C;  5GT3 D;  3WTP D;  3AZL B;  3C1C C;  3REL A;  5B31 C;  3AZN C;  3MGS C;  4NFT A;  5B32 G;  5GXQ C;  3UTA C;  4G91 C;  1H3O B;  3NQU B;  3AYW C;  5B2I A;  3MGQ A;  3REI C;  5CPI C;  1P3B B;  4CAY B;  5B33 C;  1P34 D;  2PYO A;  4WU9 C;  3WKJ D;  3V9R A;  3WTP B;  5E5A C;  1EQZ A;  3B6F D;  5B31 A;  3AZK D;  1M1A A;  3AZN A;  5CPK C;  5BNX B;  5B1L C;  2HUE B;  5B32 D;  5GXQ A;  3UTA A;  3AYW A;  4KHA A;  1HQ3 D;  1AOI D;  3REI A;  4ZBJ C;  5AV8 B;  3REH C;  3AN2 B;  3AZE C;  4WU9 A;  1P34 B;  3WKJ B;  5E5A A;  3MGS D;  3AZG D;  4HGA B;  4XZQ C;  5CP6 C;  5BT1 C;  1ZLA D;  4LD9 D;  3C1B C;  3B0D C;  1KX3 D;  3AV2 C;  4ZUX B;  5CPI D;  1AOI B;  1HQ3 B;  5DNM D;  4X23 C;  3AZM C;  3REH A;  4XUJ D;  3AZE A;  4J8V D;  4UUZ B;  5B1L D;  1P3P A;  3AZG B;  3X1U D;  1ZLA B;  4WU8 A;  1KX3 B;  4H9O B;  1F66 C;  4NE5 A;  1P3I C;  3AZM A;  5DNM B;  3AZH C;  3UT9 C;  2NQB B;  4XUJ B;  5B2J C;  4KGC D;  2BYM A;  4J8V B;  3C1B D;  4QLC C;  3X1U B;  5B40 D;  1F66 A;  1P3I A;  3UT9 A;  5B2J A;  5JA4 B;  4KGC B;  1P3K C;  3WA9 A;  1P3A D;  1M18 C;  4R8P C;  3A6N B;  3REK C;  3W98 A;  4QLC A;  3W96 B;  4J8X C;  3UTB C;  5B40 B;  3MGR B;  3R45 B;  3MNN D;  4H9Q A;  5AV9 D;  1P3K A;  3B6G C;  3W97 A;  1P3A B;  1M18 A;  3X1T B;  1KX5 C;  3REK A;  5B24 C;  3TU4 B;  3UTB A;  5BO0 B;  2FJ7 A;  2BYK A;  1P3M C;  5C3I B;  4YS3 D;  1KX4 C;  3MNN B;  3REJ C;  1TZY C;  2ARO C;  5AV9 B;  4R8P D;  2IO5 B;  3W99 A;  3KXB D;  1P3G C;  2HIO C;  4Z5T B;  5B24 A;  4J8X D;  2NZD D;  3AZL C;  3X1S C;  5F99 D;  5GSU D;  3WTP E;  5GT0 D;  1KX4 A;  4YS3 B;  1F1E A;  1S32 A;  2ARO A;  1KX5 D;  1P3B C;  1P3G A;  3KXB B;  4CSR B;  2HIO A;  5AY8 D;  2NZD B;  3X1S A;  5FUG A;  3WTP C;  3O62 D;  5GSU B;  5F99 B;  5AVB D;  3REJ D;  3LEL A;  3LZ1 A;  2HUE C;  3VH6 W;  4AWL B;  4NE3 A;  1H3O A;  3NQU A;  4DRB A;  5AV8 C;  4Z66 B;  2YFW B; 
#chains in the Genus database with same CATH topology
 5G49 B;  1P34 C;  3VH5 T;  5GT3 A;  3WKJ C;  2CWE A;  5AY8 B;  2F8N G;  3AZF D;  3B6F C;  4HGA C;  5AVB B;  1WWI A;  3AFA D;  4M6B A;  5BNX A;  3AZK C;  3MGP B;  3AZJ B;  5B32 C;  1N1J B;  1AOI C;  1HQ3 C;  5B1M D;  1P3F B;  1BH9 A;  3AL0 C;  4Z2M G;  1A7W A;  3WKJ A;  3H0M C;  2F8N D;  2RVQ D;  3AZF B;  3B6F A;  3AZG C;  3AZK A;  3EPK A;  3AFA B;  1ZLA C;  4LD9 C;  4J8W B;  3WAA D;  3EPJ A;  3AV1 B;  1KX3 C;  5B32 A;  5AV8 D;  3AN2 D;  1HQ3 A;  5AV6 D;  5DNM C;  5B1M B;  4XUJ C;  3VH6 T;  3C1C A;  4EO5 B;  4J8V C;  2F8N B;  3MGS A;  4ZUX D;  3X1U C;  5CPJ B;  1M19 D;  1ZLA A;  4LD9 A;  1KX3 A;  3WAA B;  1BFM A;  5CPI A;  5B33 A;  3VH5 A;  5AV6 B;  5DNM A;  4H9S C;  2JCH A;  5AVC D;  2UWX A;  4KGC C;  2Y2Q A;  3KWQ B;  1U35 D;  5CPK A;  5B1L A;  3A6N C;  5BNV A;  3X1U A;  3W96 C;  1M19 B;  5B40 C;  3X1V D;  2NQB D;  3MGR C;  4H9S A;  3KUY D;  2Y2M A;  4KGC A;  5AVC B;  5B2I D;  2VQR A;  4XZQ A;  5BS7 C;  5CP6 A;  1P3A C;  1U35 B;  3X1T C;  3C1B A;  3AV2 A;  1EQZ D;  3F6T A;  2F2A C;  4X23 A;  5C3I C;  1M1A D;  5B40 A;  1WWS A;  2YFV A;  3X1V B;  3MNN C;  4H9P B;  5AV9 C;  3KUY B;  2IO5 C;  3A6N D;  5B2I B;  3MGQ B;  1P3A A;  1Z2C B;  1B6W A;  3W96 D;  3A1I A;  4Z5T C;  2PYO B;  3V9R B;  1EQZ B;  3MGR D;  1ID3 D;  2RIQ A;  3AZH A;  3B0B A;  1M1A B;  1JFI A;  4YS3 C;  4H9N A;  5GXQ B;  5AV9 A;  3X1T D;  1KU5 A;  3TU4 D;  3KXB C;  3B0C W;  1P3L D;  4KUD D;  1P3O D;  4WU9 B;  5AV5 D;  2NZD C;  5B0Z D;  5GSU C;  5F99 C;  1ID3 B;  2ZY5 A;  2Y2I A;  5GT0 C;  4YS3 A;  4YM6 D;  4R8P A;  4Z5T D;  4CSR A;  1P3L B;  4KUD B;  1TAF A;  4E44 A;  4Z66 C;  1P3O B;  4J8X A;  2NZD A;  5AY8 C;  5AV5 B;  5B0Z B;  3O62 C;  1P3P B;  5AVB C;  5GT0 A;  5DNN D;  3MGP C;  3AZJ C;  4WU8 B;  3B6G A;  4YM6 B;  1KX5 A;  2LY8 A;  5CHL B;  1P3F C;  2YFW A;  2G5H C;  5AY8 A;  1P3M A;  3O62 A;  3LJA D;  3AZF C;  3B0C T;  3W98 D;  3REJ A;  1TZY A;  3AFA C;  4DQY B;  2F8N H;  5DNN B;  3AV1 C;  1BH8 B;  1N1J A;  4Z66 D;  2F8N K;  3IP4 C;  5B1M C;  4G92 B;  2Y2K A;  3AZL A;  5B2J B;  3AZI D;  4J8U D;  2RVQ C;  3W97 D;  3WA9 B;  3LJA B;  4JJN D;  3MGP D;  3AZJ D;  4Z2M H;  3W98 B;  4WNN B;  1B67 A;  2FJ7 D;  3WAA C;  1P3B A;  4CAY A;  5B0Y D;  3AN2 C;  5AV6 C;  4WZS B;  3A1K A;  1HTA A;  4H9Q B;  5B1M A;  3WTP A;  3AZI B;  4J8U B;  2F8N A;  3KWQ C;  1R4V A;  3W97 B;  4J8W D;  4JJN B;  3AV1 D;  4ZUX C;  2JE5 A;  1M19 C;  3H0L C;  3WAA A;  3P5J B;  2FJ7 B;  2BYK B;  5AV8 A;  3AN2 A;  5B0Y B;  1S32 D;  1P34 A;  2Y2N A;  3EG5 B;  5AVC C;  3W99 B;  5CPJ D;  1U35 C;  4ZUX A;  1M19 A;  1AOI A;  3LEL D;  3X1V C;  4H9R B;  3LZ1 D;  1S32 B;  2NQB C;  3KWQ D;  3KUY C;  4UUZ A;  5AVC A;  3LZ0 D;  5B2I C;  3MGQ C;  3AZG A;  1U35 A;  3MVD D;  3X1S B;  4H9O A;  5FUG B;  5JRG D;  1EQZ C;  3H0R C;  3NQJ B;  1M1A C;  2CV5 D;  3X1V A;  3LEL B;  2NQB A;  4XUJ A;  3LZ1 B;  4WJ3 C;  4H9P A;  4J8V A;  2L5A A;  3KUY A;  3LZ0 B;  3KFU G;  3MVD B;  5GT3 B;  3REL D;  5B31 G;  5JRG B;  1ID3 C;  2CV5 B;  5JA4 A;  3MGQ D;  5KDM B;  3A6N A;  2PYO D;  3TU4 C;  4NE6 A;  1P3L C;  4KUD C;  3W96 A;  1BH9 B;  3EPL A;  3C1C D;  1P3O C;  5B31 D;  5AV5 C;  3REL B;  5B0Z C;  3VH6 A;  3AZN D;  3MGR A;  3R45 A;  1P3P C;  1ID3 A;  3B6F B;  3AZK B;  5GXQ D;  3UTA D;  3AYW D;  4WU8 C;  5BS7 A;  3REI D;  5B32 B;  4YM6 C;  5B33 D;  3X1T A;  2W8S A;  4WU9 D;  3TU4 A;  1P3L A;  4KUD A;  5E5A D;  3C1C B;  1P3O A;  5AV5 A;  5BO0 A;  5B31 B;  5B0Z A;  5CPK D;  3AZN B;  3MNN A;  3MGS B;  4LD9 B;  3UTA B;  4G91 B;  5DNN C;  3AYW B;  4KHA B;  4WV4 B;  3REI B;  4YM6 A;  3REH D;  5CPI B;  4Z5T A;  5B33 B;  3AZE D;  4G92 C;  5E5A B;  1P3P D;  5CP6 D;  4XZQ D;  3WA9 C;  5BT1 D;  2ZY2 A;  3LJA C;  2XD5 A;  5CPK B;  5B1L B;  5BNV B;  4WU8 D;  3AV2 D;  3W98 C;  4AWL C;  2DQN C;  5DNN A;  4X23 D;  1BH8 A;  4ZBJ B;  3KXB A;  3AZM D;  3REH B;  3AZE B;  5F99 A;  5GSU A;  3AZI C;  4J8U C;  4XZQ B;  5CP6 B;  3W97 C;  3LJA A;  3C1B B;  3KSY A;  3B0D B;  4JJN C;  1Q9C A;  1W2E A;  3AV2 B;  4WNN A;  1F66 D;  2FJ7 C;  1P3I D;  3AZH D;  4X23 B;  3AZM B;  3UT9 D;  2YFV B;  5B0Y C;  4Z66 A;  5G49 A;  5B2J D;  2BYM B;  2Y2L A;  3WA9 D;  3AZI A;  4J8U A;  3W99 C;  5AVB A;  4QLC D;  2ZY3 A;  4JJN A;  3MGP A;  4J8W C;  3AZJ A;  3FDD A;  4E45 A;  4DRA A;  1F66 B;  1P3I B;  2ZY4 A;  3AZH B;  1P3F A;  5B0Y A;  3UT9 B;  1JFI B;  1S32 C;  1P3K D;  4H9N B;  3VH5 W;  4EO5 C;  1M18 D;  3AZF A;  3REK D;  3AFA A;  4QLC B;  5CPJ C;  4J8W A;  3UTB D;  1T3U A;  2BG1 A;  2FFF B;  3AV1 A;  3LEL C;  4H9R A;  3LZ1 C;  1P3F D;  3W99 D;  3B6G D;  1P3K B;  1M18 B;  2Y2P A;  2XD1 A;  4R8P B;  5B24 D;  3REK B;  3LZ0 C;  3EPH A;  5CPJ A;  1TAF B;  3MVD C;  5GT3 C;  4J8X B;  3UTB B;  1P3M D;  1ULY A;  5JRG C;  1KX4 D;  3NQJ A;  5AV6 A;  1TZY D;  2CV5 C;  5GT0 B;  2ARO D;  4UPK A;  1P3G D;  3KWQ A;  3B6G B;  2HIO D;  2Y2O A;  1KX5 B;  3LZ0 A;  5B24 B;  3AZL D;  3X1S D;  3MVD A;  3REL C;  1P3M B;  5JRG A;  3O62 B;  1KX4 B;  3REJ B;  1TZY B;  2CV5 A;  2ARO B;  1P3B D;  5KDM A;  1P3G B;  2JSS A;  2HIO B;  2PYO C;  5GT3 D;  3WTP D;  3AZL B;  3C1C C;  3REL A;  5B31 C;  3AZN C;  3MGS C;  4NFT A;  5B32 G;  5GXQ C;  3UTA C;  4G91 C;  1H3O B;  3NQU B;  3AYW C;  5B2I A;  3MGQ A;  3REI C;  5CPI C;  1P3B B;  4CAY B;  5B33 C;  2J8P A;  1P34 D;  4WU9 C;  2PYO A;  3WKJ D;  3V9R A;  3WTP B;  5E5A C;  1EQZ A;  3B6F D;  5B31 A;  3AZK D;  1M1A A;  3AZN A;  5CPK C;  5BNX B;  5B1L C;  2HUE B;  5B32 D;  5GXQ A;  3UTA A;  3AYW A;  4KHA A;  1HQ3 D;  1AOI D;  3REI A;  4ZBJ C;  5AV8 B;  3REH C;  3AN2 B;  3AZE C;  4WU9 A;  1P34 B;  3WKJ B;  5E5A A;  3MGS D;  3AZG D;  4HGA B;  4XZQ C;  2Y2G A;  5CP6 C;  5BT1 C;  1ZLA D;  4LD9 D;  3C1B C;  1PZR A;  3B0D C;  1KX3 D;  3AV2 C;  4ZUX B;  5CPI D;  1AOI B;  1HQ3 B;  5DNM D;  4X23 C;  3AZM C;  3REH A;  4XUJ D;  3AZE A;  4J8V D;  4UUZ B;  5B1L D;  1P3P A;  3AZG B;  3X1U D;  1ZLA B;  4WU8 A;  1KX3 B;  4H9O B;  1F66 C;  4NE5 A;  1P3I C;  3AZM A;  5DNM B;  3AZH C;  3UT9 C;  2NQB B;  4XUJ B;  5B2J C;  4KGC D;  2BYM A;  4J8V B;  3C1B D;  4QLC C;  3X1U B;  5B40 D;  1F66 A;  1P3I A;  3UT9 A;  5B2J A;  5JA4 B;  4KGC B;  1P3K C;  3WA9 A;  1P3A D;  1M18 C;  4R8P C;  3A6N B;  3REK C;  3W98 A;  4QLC A;  3W96 B;  4J8X C;  3UTB C;  5B40 B;  3MGR B;  3R45 B;  3MNN D;  4H9Q A;  5AV9 D;  2G5I C;  1P3K A;  3B6G C;  3W97 A;  1P3A B;  1M18 A;  3X1T B;  2Y2H A;  1KX5 C;  3REK A;  5B24 C;  3TU4 B;  3UTB A;  5BO0 B;  2FJ7 A;  2BYK A;  1P3M C;  5C3I B;  4YS3 D;  1KX4 C;  2DF4 C;  3MNN B;  3REJ C;  1TZY C;  2ARO C;  5AV9 B;  4R8P D;  2IO5 B;  3W99 A;  2Y2J A;  3KXB D;  1P3G C;  2HIO C;  4Z5T B;  5B24 A;  4J8X D;  2NZD D;  3AZL C;  3X1S C;  5F99 D;  5GSU D;  3WTP E;  5GT0 D;  1KX4 A;  4YS3 B;  1F1E A;  1S32 A;  2ARO A;  1KX5 D;  1P3B C;  1P3G A;  3KXB B;  4CSR B;  2HIO A;  5AY8 D;  2NZD B;  3X1S A;  5FUG A;  3WTP C;  3O62 D;  5GSU B;  5F99 B;  5AVB D;  3REJ D;  3LEL A;  3LZ1 A;  2HUE C;  2ZM5 A;  3VH6 W;  4AWL B;  4NE3 A;  1H3O A;  3NQU A;  4DRB A;  5AV8 C;  4Z66 B;  2YFW B; 
#chains in the Genus database with same CATH homology
 5G49 B;  1P34 C;  3VH5 T;  5GT3 A;  3WKJ C;  2CWE A;  5AY8 B;  2F8N G;  3AZF D;  3B6F C;  4HGA C;  5AVB B;  1WWI A;  3AFA D;  4M6B A;  5BNX A;  3AZK C;  3MGP B;  3AZJ B;  5B32 C;  1N1J B;  1AOI C;  1HQ3 C;  5B1M D;  1P3F B;  1BH9 A;  3AL0 C;  4Z2M G;  1A7W A;  3WKJ A;  3H0M C;  2F8N D;  2RVQ D;  3AZF B;  3B6F A;  3AZG C;  3AZK A;  3EPK A;  3AFA B;  1ZLA C;  4LD9 C;  4J8W B;  3WAA D;  3EPJ A;  3AV1 B;  1KX3 C;  5B32 A;  5AV8 D;  3AN2 D;  1HQ3 A;  5AV6 D;  5DNM C;  5B1M B;  4XUJ C;  3VH6 T;  3C1C A;  4EO5 B;  4J8V C;  2F8N B;  3MGS A;  4ZUX D;  3X1U C;  5CPJ B;  1M19 D;  1ZLA A;  4LD9 A;  1KX3 A;  3WAA B;  1BFM A;  5CPI A;  5B33 A;  3VH5 A;  5AV6 B;  5DNM A;  4H9S C;  2JCH A;  5AVC D;  2UWX A;  4KGC C;  2Y2Q A;  3KWQ B;  1U35 D;  5CPK A;  5B1L A;  3A6N C;  5BNV A;  3X1U A;  3W96 C;  1M19 B;  5B40 C;  3X1V D;  2NQB D;  3MGR C;  4H9S A;  3KUY D;  2Y2M A;  4KGC A;  5AVC B;  5B2I D;  2VQR A;  4XZQ A;  5BS7 C;  5CP6 A;  1P3A C;  1U35 B;  3X1T C;  3C1B A;  3AV2 A;  1EQZ D;  3F6T A;  2F2A C;  4X23 A;  5C3I C;  1M1A D;  5B40 A;  1WWS A;  2YFV A;  3X1V B;  3MNN C;  4H9P B;  5AV9 C;  3KUY B;  2IO5 C;  3A6N D;  5B2I B;  3MGQ B;  1P3A A;  1Z2C B;  1B6W A;  3W96 D;  3A1I A;  4Z5T C;  2PYO B;  3V9R B;  1EQZ B;  3MGR D;  1ID3 D;  2RIQ A;  3AZH A;  3B0B A;  1M1A B;  1JFI A;  4YS3 C;  4H9N A;  5GXQ B;  5AV9 A;  3X1T D;  1KU5 A;  3TU4 D;  3KXB C;  3B0C W;  1P3L D;  4KUD D;  1P3O D;  4WU9 B;  5AV5 D;  2NZD C;  5B0Z D;  5GSU C;  5F99 C;  1ID3 B;  2ZY5 A;  2Y2I A;  5GT0 C;  4YS3 A;  4YM6 D;  4R8P A;  4Z5T D;  4CSR A;  1P3L B;  4KUD B;  1TAF A;  4E44 A;  4Z66 C;  1P3O B;  4J8X A;  2NZD A;  5AY8 C;  5AV5 B;  5B0Z B;  3O62 C;  1P3P B;  5AVB C;  5GT0 A;  5DNN D;  3MGP C;  3AZJ C;  4WU8 B;  3B6G A;  4YM6 B;  1KX5 A;  2LY8 A;  5CHL B;  1P3F C;  2YFW A;  2G5H C;  5AY8 A;  1P3M A;  3O62 A;  3LJA D;  3AZF C;  3B0C T;  3W98 D;  3REJ A;  1TZY A;  3AFA C;  4DQY B;  2F8N H;  5DNN B;  3AV1 C;  1BH8 B;  1N1J A;  4Z66 D;  2F8N K;  3IP4 C;  5B1M C;  4G92 B;  2Y2K A;  3AZL A;  5B2J B;  3AZI D;  4J8U D;  2RVQ C;  3W97 D;  3WA9 B;  3LJA B;  4JJN D;  3MGP D;  3AZJ D;  4Z2M H;  3W98 B;  4WNN B;  1B67 A;  2FJ7 D;  3WAA C;  1P3B A;  4CAY A;  5B0Y D;  3AN2 C;  5AV6 C;  4WZS B;  3A1K A;  1HTA A;  4H9Q B;  5B1M A;  3WTP A;  3AZI B;  4J8U B;  2F8N A;  3KWQ C;  1R4V A;  3W97 B;  4J8W D;  4JJN B;  3AV1 D;  4ZUX C;  2JE5 A;  1M19 C;  3H0L C;  3WAA A;  3P5J B;  2FJ7 B;  2BYK B;  5AV8 A;  3AN2 A;  5B0Y B;  1S32 D;  1P34 A;  2Y2N A;  3EG5 B;  5AVC C;  3W99 B;  5CPJ D;  1U35 C;  4ZUX A;  1M19 A;  1AOI A;  3LEL D;  3X1V C;  4H9R B;  3LZ1 D;  1S32 B;  2NQB C;  3KWQ D;  3KUY C;  4UUZ A;  5AVC A;  3LZ0 D;  5B2I C;  3MGQ C;  3AZG A;  1U35 A;  3MVD D;  3X1S B;  4H9O A;  5FUG B;  5JRG D;  1EQZ C;  3H0R C;  3NQJ B;  1M1A C;  2CV5 D;  3X1V A;  3LEL B;  2NQB A;  4XUJ A;  3LZ1 B;  4WJ3 C;  4H9P A;  4J8V A;  2L5A A;  3KUY A;  3LZ0 B;  3KFU G;  3MVD B;  5GT3 B;  3REL D;  5B31 G;  5JRG B;  1ID3 C;  2CV5 B;  5JA4 A;  3MGQ D;  5KDM B;  3A6N A;  2PYO D;  3TU4 C;  4NE6 A;  1P3L C;  4KUD C;  3W96 A;  1BH9 B;  3EPL A;  3C1C D;  1P3O C;  5B31 D;  5AV5 C;  3REL B;  5B0Z C;  3VH6 A;  3AZN D;  3MGR A;  3R45 A;  1P3P C;  1ID3 A;  3B6F B;  3AZK B;  5GXQ D;  3UTA D;  3AYW D;  4WU8 C;  5BS7 A;  3REI D;  5B32 B;  4YM6 C;  5B33 D;  3X1T A;  2W8S A;  4WU9 D;  3TU4 A;  1P3L A;  4KUD A;  5E5A D;  3C1C B;  1P3O A;  5AV5 A;  5BO0 A;  5B31 B;  5B0Z A;  5CPK D;  3AZN B;  3MNN A;  3MGS B;  4LD9 B;  3UTA B;  4G91 B;  5DNN C;  3AYW B;  4KHA B;  4WV4 B;  3REI B;  4YM6 A;  3REH D;  5CPI B;  4Z5T A;  5B33 B;  3AZE D;  4G92 C;  5E5A B;  1P3P D;  5CP6 D;  4XZQ D;  3WA9 C;  5BT1 D;  2ZY2 A;  3LJA C;  2XD5 A;  5CPK B;  5B1L B;  5BNV B;  4WU8 D;  3AV2 D;  3W98 C;  4AWL C;  2DQN C;  5DNN A;  4X23 D;  1BH8 A;  4ZBJ B;  3KXB A;  3AZM D;  3REH B;  3AZE B;  5F99 A;  5GSU A;  3AZI C;  4J8U C;  4XZQ B;  5CP6 B;  3W97 C;  3LJA A;  3C1B B;  3KSY A;  3B0D B;  4JJN C;  1Q9C A;  1W2E A;  3AV2 B;  4WNN A;  1F66 D;  2FJ7 C;  1P3I D;  3AZH D;  4X23 B;  3AZM B;  3UT9 D;  2YFV B;  5B0Y C;  4Z66 A;  5G49 A;  5B2J D;  2BYM B;  2Y2L A;  3WA9 D;  3AZI A;  4J8U A;  3W99 C;  5AVB A;  4QLC D;  2ZY3 A;  4JJN A;  3MGP A;  4J8W C;  3AZJ A;  3FDD A;  4E45 A;  4DRA A;  1F66 B;  1P3I B;  2ZY4 A;  3AZH B;  1P3F A;  5B0Y A;  3UT9 B;  1JFI B;  1S32 C;  1P3K D;  4H9N B;  3VH5 W;  4EO5 C;  1M18 D;  3AZF A;  3REK D;  3AFA A;  4QLC B;  5CPJ C;  4J8W A;  3UTB D;  1T3U A;  2BG1 A;  2FFF B;  3AV1 A;  3LEL C;  4H9R A;  3LZ1 C;  1P3F D;  3W99 D;  3B6G D;  1P3K B;  1M18 B;  2Y2P A;  2XD1 A;  4R8P B;  5B24 D;  3REK B;  3LZ0 C;  3EPH A;  5CPJ A;  1TAF B;  3MVD C;  5GT3 C;  4J8X B;  3UTB B;  1P3M D;  1ULY A;  5JRG C;  1KX4 D;  3NQJ A;  5AV6 A;  1TZY D;  2CV5 C;  5GT0 B;  2ARO D;  4UPK A;  1P3G D;  3KWQ A;  3B6G B;  2HIO D;  2Y2O A;  1KX5 B;  3LZ0 A;  5B24 B;  3AZL D;  3X1S D;  3MVD A;  3REL C;  1P3M B;  5JRG A;  3O62 B;  1KX4 B;  3REJ B;  1TZY B;  2CV5 A;  2ARO B;  1P3B D;  5KDM A;  1P3G B;  2JSS A;  2HIO B;  2PYO C;  5GT3 D;  3WTP D;  3AZL B;  3C1C C;  3REL A;  5B31 C;  3AZN C;  3MGS C;  4NFT A;  5B32 G;  5GXQ C;  3UTA C;  4G91 C;  1H3O B;  3NQU B;  3AYW C;  5B2I A;  3MGQ A;  3REI C;  5CPI C;  1P3B B;  4CAY B;  5B33 C;  2J8P A;  1P34 D;  4WU9 C;  2PYO A;  3WKJ D;  3V9R A;  3WTP B;  5E5A C;  1EQZ A;  3B6F D;  5B31 A;  3AZK D;  1M1A A;  3AZN A;  5CPK C;  5BNX B;  5B1L C;  2HUE B;  5B32 D;  5GXQ A;  3UTA A;  3AYW A;  4KHA A;  1HQ3 D;  1AOI D;  3REI A;  4ZBJ C;  5AV8 B;  3REH C;  3AN2 B;  3AZE C;  4WU9 A;  1P34 B;  3WKJ B;  5E5A A;  3MGS D;  3AZG D;  4HGA B;  4XZQ C;  2Y2G A;  5CP6 C;  5BT1 C;  1ZLA D;  4LD9 D;  3C1B C;  1PZR A;  3B0D C;  1KX3 D;  3AV2 C;  4ZUX B;  5CPI D;  1AOI B;  1HQ3 B;  5DNM D;  4X23 C;  3AZM C;  3REH A;  4XUJ D;  3AZE A;  4J8V D;  4UUZ B;  5B1L D;  1P3P A;  3AZG B;  3X1U D;  1ZLA B;  4WU8 A;  1KX3 B;  4H9O B;  1F66 C;  4NE5 A;  1P3I C;  3AZM A;  5DNM B;  3AZH C;  3UT9 C;  2NQB B;  4XUJ B;  5B2J C;  4KGC D;  2BYM A;  4J8V B;  3C1B D;  4QLC C;  3X1U B;  5B40 D;  1F66 A;  1P3I A;  3UT9 A;  5B2J A;  5JA4 B;  4KGC B;  1P3K C;  3WA9 A;  1P3A D;  1M18 C;  4R8P C;  3A6N B;  3REK C;  3W98 A;  4QLC A;  3W96 B;  4J8X C;  3UTB C;  5B40 B;  3MGR B;  3R45 B;  3MNN D;  4H9Q A;  5AV9 D;  2G5I C;  1P3K A;  3B6G C;  3W97 A;  1P3A B;  1M18 A;  3X1T B;  2Y2H A;  1KX5 C;  3REK A;  5B24 C;  3TU4 B;  3UTB A;  5BO0 B;  2FJ7 A;  2BYK A;  1P3M C;  5C3I B;  4YS3 D;  1KX4 C;  2DF4 C;  3MNN B;  3REJ C;  1TZY C;  2ARO C;  5AV9 B;  4R8P D;  2IO5 B;  3W99 A;  2Y2J A;  3KXB D;  1P3G C;  2HIO C;  4Z5T B;  5B24 A;  4J8X D;  2NZD D;  3AZL C;  3X1S C;  5F99 D;  5GSU D;  3WTP E;  5GT0 D;  1KX4 A;  4YS3 B;  1F1E A;  1S32 A;  2ARO A;  1KX5 D;  1P3B C;  1P3G A;  3KXB B;  4CSR B;  2HIO A;  5AY8 D;  2NZD B;  3X1S A;  5FUG A;  3WTP C;  3O62 D;  5GSU B;  5F99 B;  5AVB D;  3REJ D;  3LEL A;  3LZ1 A;  2HUE C;  2ZM5 A;  3VH6 W;  4AWL B;  4NE3 A;  1H3O A;  3NQU A;  4DRB A;  5AV8 C;  4Z66 B;  2YFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...