3AZGB

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgB00
3UTBA 4WU8A 3MGSA 1KX4D 1M1AB 4ZUXA 3B0DB 5BNXB 3X1SB 3AZLA 3NQUA 3RELA 1M1AD 1TAFA 4ZBJC 3REIB 5B40C 1KX5B 2F8NB 5BT1D 3KWQD 3X1SD 1M18A 4J8XA 5B2JA 4YM6B 3REID 1KX5D 2F8ND 5B0ZD 5CP6C 5B1LB 2CWEA 4YS3C 3UTAD 5AV6A 3A6NC 4R8PC 4KGCB 5B1LD 5C3IB 3LZ1A 4Z2MH 4J8VC 3AZIC 3UTBB 5F99C 1WWIA 4WU8B 3VH6A 3MGSB 4ZUXB 1P3KA 3MGPC 3UTBD 1HQ3A 3W96A 3AZLB 1P34C 2PYOA 5CHLB 5AVCA 3NQUB 1TAFB 4ZUXD 3AZMC 3WA9A 4DRBA 3UTAC 2HIOA 4J8UC 3AZLD 4J8XB 5GSUA 1P3MA 2L5AA 4H9OA 2NZDA 3REJA 3KUYA 3NQJA 1F1EA 4J8XD 3AYWA 1F66D 2F8NH 4JJNC 3VH6W 5AV6B 5CPIB 1BH8A 4G91C 5B24C 3LZ1B 5AV6D 1HTAA 5CPID 4QLCA 4KUDD 3LZ1D 3X1TC 5AV5B 1P3GC 1P3KB 4XZQA 4G92C 1HQ3B 3W96B 3C1CD 4HGAB 3TU4C 5AVCB 5AV5D 1F66C 3WA9B 3W96D 2HIOB 5AVBD 1KU5A 5GSUB 5AVCD 4H9OB 2NZDB 5B32A 3REJB 3KUYB 5CPJC 3WA9D 3NQJB 2HIOD 5B2IB 3AYWB 2NZDD 3REJD 2YFWA 4KUDC 5B32G 1BH8B 5B2ID 3AYWD 4CAYA 1P3OC 5B40A 5AV9C 2CV5C 4M6BA 3AZJC 5BO0A 5AVBC 4XZQB 3V9RB 5AV8D 3B0CW 3WKJD 4H9SC 3LZ0C 5GXQA 4YS3A 4Z66D 3A6NA 3LELD 4R8PA 1P3FC 5B32B 3AZIA 3X1VB 3X1UC 4AWLC 5B32D 2YFWB 5F99A 5JA4B 3KWQA 3UT9C 3X1VD 4CAYB 5B1MC 3MGPA 5GT0C 2IO5C 1P34A 5AV8C 5B0ZA 4ZBJB 3AZMA 5B40B 5E5AC 3O62C 4WU9C 3UTAA 5BO0B 5B40D 2NQBD 3VH5T 5CP6B 1ULYA 3AZGC 3W97D 3AZFC 1P3IC 4YS3B 4E45A 3MNNC 3A6NB 4NE5A 4R8PB 5CP6D 5B33C 4YS3D 4J8VB 3A6ND 3AZIB 1N1JA 4WZSB 4XUJC 4R8PD 1M19C 5F99B 3WTPC 3KWQB 1P3BC 1P3GA 4J8VD 3AZID 3MGPB 5F99D 5G49A 3TU4A 1KX3D 1P34B 2NQBC 3LJAC 5B0ZB 3AZMB 1F66A 3MGPD 3W97C 3UTAB 4J8UB 1P34D 3AZMD 3AZKC 1U35C 3B6FC 4J8UD 2YFVB 5CPIA 4JJNB 4KUDA 5DNNC 4DRAA 2F8NK 4G91B 5B24B 1S32C 4JJND 3C1CA 5AY8C 1KX3C 1N1JB 1P3OA 5AV5A 5B24D 5JRGC 4E44A 4EO5C 5AV9A 2CV5A 1P3GB 3AZJA 5DNMC 5AVBA 3AFAC 4G92B 5G49B 3REHC 3TU4B 4Z5TC 3KXBC 3X1TD 1P3GD 3W98C 1F66B 3TU4D 1P3FA 5B2IA 1B6WA 3X1UA 1TZYC 4NFTA 4KUDB 3B0DC 1EQZC 5CPJD 5CPKC 3MVDC 4X23C 5B1MA 5GT0A 3C1CB 5AV8A 1P3OB 5B0YC 3WKJA 5AV9B 2CV5B 3O62A 4LD9C 4Z66A 3V9RA 3AZJB 5AVBB 3LELA 1P3OD 5AV9D 2BYKB 2LY8A 3AN2C 2CV5D 3AZJD 3LZ0B 4WNNB 3AZFA 1P3IA 5C3IC 2FJ7A 4KGCC 1P3FB 3B6GD 2FJ7C 3X1VA 3LZ0D 3C1BC 5JA4A 3X1UB 4AWLB 1P3FD 3B0BA 3MGRC 1P3BA 3UT9B 3RELC 5B1MB 3X1UD 3MGQC 5GT0B 2IO5B 5AV8B 1M18C 2NQBA 3UT9D 3WKJB 5B2JC 5B1MD 3W97A 3O62B 1AOIC 4Z66B 5GT0D 3LELB 3B6GC 3AZNC 5CP6A 3AZKA 5E5AD 3O62D 4WU9D 3B6FA 3AZGB 3AZFB 1P3IB 5DNNA 3AZEC 4J8VA 3AZGD 3AZFD 1P3ID 3MNND 4KHAB 5AY8A 1KX3A 3REKC 1M19B 3R45A 5B33D 1HQ3C 3WTPB 1P3BB 2PYOC 5DNMA 3AV1C 4H9NA 4XUJD 1Q9CA 3AFAA 1M19D 3WAAC 3REHA 1P3PC 4Z5TA 2NQBB 3WTPD 1P3BD 1P3MC 4J8UA 3W97B 3KUYC 1ZLAC 3LJAD 3AZKB 5GT3C 2YFVA 4JJNA 3B6FB 1TZYA 5B24A 1U35D 5DNNB 3AZKD 3VH6T 1EQZA 3B6FD 4X23A 4QLCC 5B31C 1S32B 5DNND 5AY8B 1KX3B 3X1TA 5B0YA 4CSRB 3R45B 4EO5B 1S32D 4LD9A 5DNMB 5AY8D 4H9NB 1P3AC 1ID3C 3AFAB 3REHB 5JRGD 4Z5TB 3KXBB 1JFIA 3AN2A 4NE3A 4H9RA 5DNMD 3AFAD 3REHD 4Z5TD 3KXBD 5CPJA 4H9QB 3W98D 5BS7C 3C1BA 1WWSA 4J8WD 1TZYB 2HUEC 1EQZB 1R4VA 5CPKB 3MGRA 3MVDB 4X23B 5FUGA 2BYMA 1TZYD 3MGQA 3AV2C 1EQZD 5CPKD 3X1TB 5B0YB 3MVDD 2AROC 4X23D 2RVQD 3AZHC 1AOIA 1P3LC 4LD9B 3W99C 2BYKA 3B6GA 5B0YD 3AZNA 1BFMA 5GXQC 4H9SA 1JFIB 3LZ0A 4WNNA 3AN2B 4LD9D 4H9RB 4YM6D 1KX4C 1H3OA 3B0CT 3VH5A 4J8WC 3AZEA 5CPJB 3AN2D 2FJ7B 1M1AC 4KGCD 3C1BB 5BT1C 3KWQC 3X1SC 3REKA 3UT9A 2FJ7D 2RVQC 3MGRB 3MGSD 3C1BD 4WU8D 2JSSA 3REIC 5FUGB 1KX5C 1BH9A 3AV1A 2BYMB 4NE6A 5B0ZC 3RELB 3MGQB 3WTPE 3WAAA 1P3PA 1M18B 5E5AA 3MGRD 4WU9A 4YM6C 3VH5W 4H9PA 5B2JB 3RELD 1A7WA 1AOIB 5B1LC 3MGQD 1ZLAA 1M18D 3B6GB 3AZNB 5BNVA 5GT3A 5B2JD 3AZGA 1AOID 3MNNA 1H3OB 5KDMA 3AZND 3AZEB 3UTBC 5B33A 3MGSC 4WU8C 5B31A 4KHAA 4ZUXC 4XUJA 1M19A 3AZED 3REKB 3WTPA 3AZLC 4UUZA 5B31G 3KSYA 2PYOB 1BH9B 3AV1B 1P3AA 1ID3A 3REKD 1P3KD 3LJAA 3WAAB 4J8XC 1P3PB 1HQ3D 5E5AB 4WU9B 1P3MB 2PYOD 3AV1D 4H9PB 3WAAD 4WV4B 1U35A 1ZLAB 1P3PD 5AV6C 5BNVB 5GSUD 1P3MD 5CPIC 5GT3B 5BS7A 3MNNB 3KUYD 1ZLAD 3LZ1C 5KDMB 5GT3D 5B33B 3C1CC 1S32A 4QLCB 5B31B 5AV5C 4XUJB 1P3KC 4CSRA 3AV2A 5JRGA 3W96C 4HGAC 2AROA 5AVCC 4UUZB 4QLCD 5B31D 3AZHA 1P3LA 3WA9C 1P3AB 3KXBA 1ID3B 3W99A 3LJAB 2HIOC 5GSUC 3W98A 2NZDC 4XZQD 3REJC 1KX4A 4Z2MG 1P3AD 1ID3D 4J8WA 4H9QA 5B2IC 3AYWC 1U35B 1M1AA 5BNXA 5CPKA 3X1SA 3MVDA 2HUEB 1B67A 3REIA 1KX5A 2F8NA 3WKJC 3AV2B 5JRGB 4XZQC 4Z66C 2AROB 4YM6A 3LELC 3AZHB 2F8NG 5B1LA 3AV2D 1P3LB 3W99B 2AROD 3W98B 5GXQB 5B32C 3AZHD 4KGCA 1P3LD 1KX4B 3W99D 4J8WB 3X1VC 5GXQD
chains in the Genus database with same CATH superfamily
3UTBA 2F2AC 4WU8A 3MGSA 1KX4D 1M1AB 4ZUXA 3B0DB 5BNXB 3X1SB 3AZLA 3NQUA 3RELA 1M1AD 1TAFA 4ZBJC 3REIB 5B40C 1KX5B 2F8NB 5BT1D 3KWQD 3X1SD 1M18A 4J8XA 5B2JA 3KFUG 2ZY5A 4YM6B 3REID 1KX5D 2F8ND 5B0ZD 5CP6C 2RIQA 5B1LB 2UWXA 2J8PA 3A1IA 2CWEA 4YS3C 3UTAD 5AV6A 3A6NC 4R8PC 4KGCB 5B1LD 5C3IB 3LZ1A 4Z2MH 4J8VC 3AZIC 3UTBB 5F99C 1WWIA 4WU8B 3VH6A 3MGSB 4ZUXB 1P3KA 3MGPC 3UTBD 1HQ3A 3W96A 3AZLB 1P34C 2PYOA 5CHLB 5AVCA 3NQUB 4DQYB 1TAFB 4ZUXD 3AZMC 3WA9A 4DRBA 3UTAC 2HIOA 4J8UC 3AZLD 4J8XB 5GSUA 1P3MA 2L5AA 4H9OA 2NZDA 3REJA 3KUYA 3NQJA 1F1EA 4J8XD 3AYWA 3EPLA 1F66D 2F8NH 4JJNC 3VH6W 5AV6B 5CPIB 1BH8A 4G91C 5B24C 3LZ1B 5AV6D 1HTAA 5CPID 4QLCA 4KUDD 3LZ1D 3X1TC 5AV5B 1P3GC 1P3KB 1Z2CB 4XZQA 4G92C 1HQ3B 3W96B 3C1CD 4HGAB 3TU4C 2DQNC 5AVCB 5AV5D 3AL0C 1F66C 3WA9B 3W96D 2HIOB 5AVBD 1KU5A 5GSUB 5AVCD 4H9OB 2NZDB 5B32A 3REJB 3KUYB 5CPJC 3WA9D 3NQJB 2HIOD 5B2IB 3AYWB 2NZDD 3REJD 2YFWA 4KUDC 5B32G 2Y2JA 1BH8B 5B2ID 3AYWD 4CAYA 2Y2MA 2Y2KA 1P3OC 5B40A 5AV9C 2CV5C 4M6BA 3AZJC 5BO0A 5AVBC 4XZQB 3V9RB 5AV8D 3B0CW 3WKJD 4H9SC 3LZ0C 5GXQA 4YS3A 4Z66D 3A6NA 3LELD 4R8PA 1P3FC 5B32B 3A1KA 2DF4C 3AZIA 3X1VB 3X1UC 4AWLC 5B32D 2YFWB 5F99A 5JA4B 3KWQA 3UT9C 3X1VD 4CAYB 5B1MC 3MGPA 2W8SA 5GT0C 2IO5C 1P34A 5AV8C 5B0ZA 4ZBJB 3AZMA 5B40B 5E5AC 3O62C 4WU9C 3UTAA 5BO0B 5B40D 2NQBD 3VH5T 4UPKA 5CP6B 1ULYA 3AZGC 3W97D 3AZFC 1P3IC 4YS3B 4E45A 3MNNC 3A6NB 4NE5A 4R8PB 5CP6D 5B33C 4YS3D 4J8VB 3A6ND 3AZIB 1N1JA 4WZSB 4XUJC 4R8PD 1M19C 5F99B 3WTPC 3KWQB 1P3BC 1P3GA 3FDDA 4J8VD 3AZID 3MGPB 5F99D 5G49A 2Y2PA 3TU4A 1KX3D 1P34B 2NQBC 3LJAC 5B0ZB 3AZMB 1F66A 3MGPD 3W97C 3UTAB 4J8UB 1P34D 3AZMD 3AZKC 1U35C 3B6FC 4J8UD 2YFVB 5CPIA 4JJNB 4KUDA 5DNNC 4DRAA 2F8NK 4G91B 5B24B 1S32C 4JJND 3C1CA 5AY8C 1KX3C 1N1JB 1P3OA 5AV5A 5B24D 5JRGC 4E44A 4EO5C 5AV9A 2CV5A 1P3GB 3AZJA 5DNMC 5AVBA 3AFAC 4G92B 5G49B 3REHC 3TU4B 4Z5TC 3KXBC 3X1TD 1P3GD 3W98C 2Y2QA 1F66B 2JE5A 3TU4D 1P3FA 5B2IA 1B6WA 3X1UA 4WJ3C 1TZYC 4NFTA 4KUDB 3B0DC 1EQZC 5CPJD 3EPKA 5CPKC 3MVDC 4X23C 5B1MA 5GT0A 3C1CB 5AV8A 1P3OB 5B0YC 2ZY3A 3WKJA 5AV9B 2CV5B 3O62A 4LD9C 4Z66A 3V9RA 3AZJB 5AVBB 3LELA 1P3OD 5AV9D 2BYKB 2LY8A 3AN2C 2CV5D 3AZJD 2JCHA 4WNNB 3LZ0B 3AZFA 1P3IA 5C3IC 2FJ7A 4KGCC 3H0LC 1P3FB 3B6GD 2FJ7C 3X1VA 3LZ0D 3C1BC 5JA4A 3H0MC 3X1UB 4AWLB 1P3FD 3B0BA 1PZRA 3MGRC 1P3BA 3UT9B 3RELC 5B1MB 3X1UD 3MGQC 5GT0B 2IO5B 5AV8B 1M18C 2NQBA 3UT9D 3WKJB 2BG1A 5B2JC 5B1MD 3W97A 3O62B 1AOIC 4Z66B 5GT0D 2Y2OA 3LELB 3B6GC 3AZNC 5CP6A 2Y2LA 3AZKA 5E5AD 3O62D 4WU9D 3B6FA 3AZGB 3AZFB 1P3IB 5DNNA 3AZEC 4J8VA 3AZGD 3AZFD 1P3ID 3MNND 4KHAB 5AY8A 1KX3A 3REKC 1M19B 3R45A 5B33D 1HQ3C 3WTPB 1P3BB 2Y2IA 2PYOC 5DNMA 3AV1C 4H9NA 4XUJD 1Q9CA 3AFAA 1M19D 3WAAC 3REHA 1P3PC 4Z5TA 2NQBB 3WTPD 1P3BD 1P3MC 4J8UA 3W97B 3KUYC 1ZLAC 3LJAD 3AZKB 5GT3C 2YFVA 4JJNA 3B6FB 1TZYA 2ZM5A 5B24A 1U35D 5DNNB 3AZKD 3VH6T 1EQZA 3F6TA 3B6FD 4X23A 4QLCC 5B31C 1S32B 5DNND 5AY8B 1KX3B 3X1TA 5B0YA 4CSRB 3R45B 4EO5B 1S32D 4LD9A 5DNMB 5AY8D 1T3UA 4H9NB 2XD5A 1P3AC 1ID3C 3AFAB 3REHB 5JRGD 4Z5TB 3KXBB 1JFIA 3AN2A 4NE3A 4H9RA 5DNMD 3AFAD 3REHD 4Z5TD 3KXBD 5CPJA 4H9QB 3W98D 2G5HC 5BS7C 3C1BA 1WWSA 3P5JB 4J8WD 2ZY2A 1TZYB 2HUEC 1EQZB 1R4VA 5CPKB 3MGRA 3MVDB 4X23B 5FUGA 2BYMA 1TZYD 3MGQA 3AV2C 3EG5B 1EQZD 5CPKD 3X1TB 5B0YB 3MVDD 2AROC 4X23D 2RVQD 3AZHC 1AOIA 1P3LC 4LD9B 3W99C 2BYKA 3B6GA 5B0YD 3AZNA 1BFMA 5GXQC 4H9SA 1JFIB 3LZ0A 4WNNA 3AN2B 4LD9D 4H9RB 4YM6D 1KX4C 1H3OA 3B0CT 3VH5A 4J8WC 3AZEA 5CPJB 3AN2D 2FJ7B 1M1AC 4KGCD 3C1BB 2Y2NA 5BT1C 3KWQC 2XD1A 3REKA 3X1SC 3UT9A 2FJ7D 2RVQC 3MGRB 3MGSD 3C1BD 4WU8D 2JSSA 3REIC 5FUGB 1KX5C 1BH9A 3AV1A 2BYMB 4NE6A 5B0ZC 3RELB 3MGQB 3WTPE 3WAAA 1P3PA 1M18B 5E5AA 3MGRD 4WU9A 4YM6C 3VH5W 2G5IC 4H9PA 5B2JB 3RELD 1A7WA 1AOIB 5B1LC 3MGQD 1ZLAA 1M18D 3B6GB 3AZNB 5BNVA 5GT3A 5B2JD 3AZGA 1AOID 3MNNA 1H3OB 2FFFB 5KDMA 3AZND 3AZEB 3UTBC 5B33A 3MGSC 2ZY4A 4WU8C 5B31A 4KHAA 4ZUXC 4XUJA 1M19A 3AZED 2Y2GA 3REKB 1W2EA 3WTPA 3AZLC 4UUZA 5B31G 3KSYA 2PYOB 1BH9B 3AV1B 1P3AA 1ID3A 3REKD 1P3KD 3LJAA 3WAAB 2Y2HA 4J8XC 1P3PB 1HQ3D 5E5AB 4WU9B 1P3MB 2PYOD 3AV1D 4H9PB 3EPHA 3WAAD 4WV4B 1U35A 1ZLAB 1P3PD 5AV6C 5BNVB 5GSUD 1P3MD 5CPIC 5GT3B 5BS7A 3MNNB 3KUYD 1ZLAD 3LZ1C 5KDMB 5GT3D 5B33B 3C1CC 1S32A 5B31B 4QLCB 5AV5C 4XUJB 1P3KC 4CSRA 3AV2A 5JRGA 3W96C 4HGAC 2AROA 4UUZB 4QLCD 5B31D 5AVCC 3AZHA 1P3LA 3WA9C 1P3AB 3KXBA 1ID3B 3W99A 3LJAB 2HIOC 5GSUC 3W98A 2NZDC 4XZQD 3REJC 1KX4A 4Z2MG 1P3AD 2VQRA 1ID3D 4J8WA 4H9QA 5B2IC 3AYWC 1U35B 1M1AA 5BNXA 5CPKA 3X1SA 3MVDA 2HUEB 1B67A 3REIA 1KX5A 2F8NA 3WKJC 3AV2B 5JRGB 4XZQC 4Z66C 2AROB 3IP4C 4YM6A 3LELC 3EPJA 3AZHB 2F8NG 5B1LA 3AV2D 1P3LB 3W99B 2AROD 3W98B 5GXQB 5B32C 3AZHD 4KGCA 1P3LD 1KX4B 3H0RC 3W99D 4J8WB 3X1VC 5GXQD
chains in the Genus database with same CATH topology
3UTBA 2F2AC 4WU8A 3MGSA 1KX4D 1M1AB 4ZUXA 3B0DB 5BNXB 3X1SB 3AZLA 3NQUA 3RELA 1M1AD 1TAFA 4ZBJC 3REIB 5B40C 1KX5B 2F8NB 5BT1D 3KWQD 3X1SD 1M18A 4J8XA 5B2JA 3KFUG 2ZY5A 4YM6B 3REID 1KX5D 2F8ND 5B0ZD 5CP6C 2RIQA 5B1LB 2UWXA 2J8PA 3A1IA 2CWEA 4YS3C 3UTAD 5AV6A 3A6NC 4R8PC 4KGCB 5B1LD 5C3IB 3LZ1A 4Z2MH 4J8VC 3AZIC 3UTBB 5F99C 1WWIA 4WU8B 3VH6A 3MGSB 4ZUXB 1P3KA 3MGPC 3UTBD 1HQ3A 3W96A 3AZLB 1P34C 2PYOA 5CHLB 5AVCA 3NQUB 4DQYB 1TAFB 4ZUXD 3AZMC 3WA9A 4DRBA 3UTAC 2HIOA 4J8UC 3AZLD 4J8XB 5GSUA 1P3MA 2L5AA 4H9OA 2NZDA 3REJA 3KUYA 3NQJA 1F1EA 4J8XD 3AYWA 3EPLA 1F66D 2F8NH 4JJNC 3VH6W 5AV6B 5CPIB 1BH8A 4G91C 5B24C 3LZ1B 5AV6D 1HTAA 5CPID 4QLCA 4KUDD 3LZ1D 3X1TC 5AV5B 1P3GC 1P3KB 1Z2CB 4XZQA 4G92C 1HQ3B 3W96B 3C1CD 4HGAB 3TU4C 2DQNC 5AVCB 5AV5D 3AL0C 1F66C 3WA9B 3W96D 2HIOB 5AVBD 1KU5A 5GSUB 5AVCD 4H9OB 2NZDB 5B32A 3REJB 3KUYB 5CPJC 3WA9D 3NQJB 2HIOD 5B2IB 3AYWB 2NZDD 3REJD 2YFWA 4KUDC 5B32G 2Y2JA 1BH8B 5B2ID 3AYWD 4CAYA 2Y2MA 2Y2KA 1P3OC 5B40A 5AV9C 2CV5C 4M6BA 3AZJC 5BO0A 5AVBC 4XZQB 3V9RB 5AV8D 3B0CW 3WKJD 4H9SC 3LZ0C 5GXQA 4YS3A 4Z66D 3A6NA 3LELD 4R8PA 1P3FC 5B32B 3A1KA 2DF4C 3AZIA 3X1VB 3X1UC 4AWLC 5B32D 2YFWB 5F99A 5JA4B 3KWQA 3UT9C 3X1VD 4CAYB 5B1MC 3MGPA 2W8SA 5GT0C 2IO5C 1P34A 5AV8C 5B0ZA 4ZBJB 3AZMA 5B40B 5E5AC 3O62C 4WU9C 3UTAA 5BO0B 5B40D 2NQBD 3VH5T 4UPKA 5CP6B 1ULYA 3AZGC 3W97D 3AZFC 1P3IC 4YS3B 4E45A 3MNNC 3A6NB 4NE5A 4R8PB 5CP6D 5B33C 4YS3D 4J8VB 3A6ND 3AZIB 1N1JA 4WZSB 4XUJC 4R8PD 1M19C 5F99B 3WTPC 3KWQB 1P3BC 1P3GA 3FDDA 4J8VD 3AZID 3MGPB 5F99D 5G49A 2Y2PA 3TU4A 1KX3D 1P34B 2NQBC 3LJAC 5B0ZB 3AZMB 1F66A 3MGPD 3W97C 3UTAB 4J8UB 1P34D 3AZMD 3AZKC 1U35C 3B6FC 4J8UD 2YFVB 5CPIA 4JJNB 4KUDA 5DNNC 4DRAA 2F8NK 4G91B 5B24B 1S32C 4JJND 3C1CA 5AY8C 1KX3C 1N1JB 1P3OA 5AV5A 5B24D 5JRGC 4E44A 4EO5C 5AV9A 2CV5A 1P3GB 3AZJA 5DNMC 5AVBA 3AFAC 4G92B 5G49B 3REHC 3TU4B 4Z5TC 3KXBC 3X1TD 1P3GD 3W98C 2Y2QA 1F66B 2JE5A 3TU4D 1P3FA 5B2IA 1B6WA 3X1UA 4WJ3C 1TZYC 4NFTA 4KUDB 3B0DC 1EQZC 5CPJD 3EPKA 5CPKC 3MVDC 4X23C 5B1MA 5GT0A 3C1CB 5AV8A 1P3OB 5B0YC 2ZY3A 3WKJA 5AV9B 2CV5B 3O62A 4LD9C 4Z66A 3V9RA 3AZJB 5AVBB 3LELA 1P3OD 5AV9D 2BYKB 2LY8A 3AN2C 2CV5D 3AZJD 2JCHA 4WNNB 3LZ0B 3AZFA 1P3IA 5C3IC 2FJ7A 4KGCC 3H0LC 1P3FB 3B6GD 2FJ7C 3X1VA 3LZ0D 3C1BC 5JA4A 3H0MC 3X1UB 4AWLB 1P3FD 3B0BA 1PZRA 3MGRC 1P3BA 3UT9B 3RELC 5B1MB 3X1UD 3MGQC 5GT0B 2IO5B 5AV8B 1M18C 2NQBA 3UT9D 3WKJB 2BG1A 5B2JC 5B1MD 3W97A 3O62B 1AOIC 4Z66B 5GT0D 2Y2OA 3LELB 3B6GC 3AZNC 5CP6A 2Y2LA 3AZKA 5E5AD 3O62D 4WU9D 3B6FA 3AZGB 3AZFB 1P3IB 5DNNA 3AZEC 4J8VA 3AZGD 3AZFD 1P3ID 3MNND 4KHAB 5AY8A 1KX3A 3REKC 1M19B 3R45A 5B33D 1HQ3C 3WTPB 1P3BB 2Y2IA 2PYOC 5DNMA 3AV1C 4H9NA 4XUJD 1Q9CA 3AFAA 1M19D 3WAAC 3REHA 1P3PC 4Z5TA 2NQBB 3WTPD 1P3BD 1P3MC 4J8UA 3W97B 3KUYC 1ZLAC 3LJAD 3AZKB 5GT3C 2YFVA 4JJNA 3B6FB 1TZYA 2ZM5A 5B24A 1U35D 5DNNB 3AZKD 3VH6T 1EQZA 3F6TA 3B6FD 4X23A 4QLCC 5B31C 1S32B 5DNND 5AY8B 1KX3B 3X1TA 5B0YA 4CSRB 3R45B 4EO5B 1S32D 4LD9A 5DNMB 5AY8D 1T3UA 4H9NB 2XD5A 1P3AC 1ID3C 3AFAB 3REHB 5JRGD 4Z5TB 3KXBB 1JFIA 3AN2A 4NE3A 4H9RA 5DNMD 3AFAD 3REHD 4Z5TD 3KXBD 5CPJA 4H9QB 3W98D 2G5HC 5BS7C 3C1BA 1WWSA 3P5JB 4J8WD 2ZY2A 1TZYB 2HUEC 1EQZB 1R4VA 5CPKB 3MGRA 3MVDB 4X23B 5FUGA 2BYMA 1TZYD 3MGQA 3AV2C 3EG5B 1EQZD 5CPKD 3X1TB 5B0YB 3MVDD 2AROC 4X23D 2RVQD 3AZHC 1AOIA 1P3LC 4LD9B 3W99C 2BYKA 3B6GA 5B0YD 3AZNA 1BFMA 5GXQC 4H9SA 1JFIB 3LZ0A 4WNNA 3AN2B 4LD9D 4H9RB 4YM6D 1KX4C 1H3OA 3B0CT 3VH5A 4J8WC 3AZEA 5CPJB 3AN2D 2FJ7B 1M1AC 4KGCD 3C1BB 2Y2NA 5BT1C 3KWQC 2XD1A 3REKA 3X1SC 3UT9A 2FJ7D 2RVQC 3MGRB 3MGSD 3C1BD 4WU8D 2JSSA 3REIC 5FUGB 1KX5C 1BH9A 3AV1A 2BYMB 4NE6A 5B0ZC 3RELB 3MGQB 3WTPE 3WAAA 1P3PA 1M18B 5E5AA 3MGRD 4WU9A 4YM6C 3VH5W 2G5IC 4H9PA 5B2JB 3RELD 1A7WA 1AOIB 5B1LC 3MGQD 1ZLAA 1M18D 3B6GB 3AZNB 5BNVA 5GT3A 5B2JD 3AZGA 1AOID 3MNNA 1H3OB 2FFFB 5KDMA 3AZND 3AZEB 3UTBC 5B33A 3MGSC 2ZY4A 4WU8C 5B31A 4KHAA 4ZUXC 4XUJA 1M19A 3AZED 2Y2GA 3REKB 1W2EA 3WTPA 3AZLC 4UUZA 5B31G 3KSYA 2PYOB 1BH9B 3AV1B 1P3AA 1ID3A 3REKD 1P3KD 3LJAA 3WAAB 2Y2HA 4J8XC 1P3PB 1HQ3D 5E5AB 4WU9B 1P3MB 2PYOD 3AV1D 4H9PB 3EPHA 3WAAD 4WV4B 1U35A 1ZLAB 1P3PD 5AV6C 5BNVB 5GSUD 1P3MD 5CPIC 5GT3B 5BS7A 3MNNB 3KUYD 1ZLAD 3LZ1C 5KDMB 5GT3D 5B33B 3C1CC 1S32A 5B31B 4QLCB 5AV5C 4XUJB 1P3KC 4CSRA 3AV2A 5JRGA 3W96C 4HGAC 2AROA 4UUZB 4QLCD 5B31D 5AVCC 3AZHA 1P3LA 3WA9C 1P3AB 3KXBA 1ID3B 3W99A 3LJAB 2HIOC 5GSUC 3W98A 2NZDC 4XZQD 3REJC 1KX4A 4Z2MG 1P3AD 2VQRA 1ID3D 4J8WA 4H9QA 5B2IC 3AYWC 1U35B 1M1AA 5BNXA 5CPKA 3X1SA 3MVDA 2HUEB 1B67A 3REIA 1KX5A 2F8NA 3WKJC 3AV2B 5JRGB 4XZQC 4Z66C 2AROB 3IP4C 4YM6A 3LELC 3EPJA 3AZHB 2F8NG 5B1LA 3AV2D 1P3LB 3W99B 2AROD 3W98B 5GXQB 5B32C 3AZHD 4KGCA 1P3LD 1KX4B 3H0RC 3W99D 4J8WB 3X1VC 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  4WU8 A;  3MGS A;  1KX4 D;  1M1A B;  4ZUX A;  3B0D B;  5BNX B;  3X1S B;  3AZL A;  3NQU A;  3REL A;  1M1A D;  1TAF A;  4ZBJ C;  3REI B;  5B40 C;  1KX5 B;  2F8N B;  5BT1 D;  3KWQ D;  3X1S D;  1M18 A;  4J8X A;  5B2J A;  4YM6 B;  3REI D;  1KX5 D;  2F8N D;  5B0Z D;  5CP6 C;  5B1L B;  2CWE A;  4YS3 C;  3UTA D;  5AV6 A;  3A6N C;  4R8P C;  4KGC B;  5B1L D;  5C3I B;  3LZ1 A;  4Z2M H;  4J8V C;  3AZI C;  3UTB B;  5F99 C;  1WWI A;  4WU8 B;  3VH6 A;  3MGS B;  4ZUX B;  1P3K A;  3MGP C;  3UTB D;  1HQ3 A;  3W96 A;  3AZL B;  1P34 C;  2PYO A;  5CHL B;  5AVC A;  3NQU B;  1TAF B;  4ZUX D;  3AZM C;  3WA9 A;  4DRB A;  3UTA C;  2HIO A;  4J8U C;  3AZL D;  4J8X B;  5GSU A;  1P3M A;  2L5A A;  4H9O A;  2NZD A;  3REJ A;  3KUY A;  3NQJ A;  1F1E A;  4J8X D;  3AYW A;  1F66 D;  2F8N H;  4JJN C;  3VH6 W;  5AV6 B;  5CPI B;  1BH8 A;  4G91 C;  5B24 C;  3LZ1 B;  5AV6 D;  1HTA A;  5CPI D;  4QLC A;  4KUD D;  3LZ1 D;  3X1T C;  5AV5 B;  1P3G C;  1P3K B;  4XZQ A;  4G92 C;  1HQ3 B;  3W96 B;  3C1C D;  4HGA B;  3TU4 C;  5AVC B;  5AV5 D;  1F66 C;  3WA9 B;  3W96 D;  2HIO B;  5AVB D;  1KU5 A;  5GSU B;  5AVC D;  4H9O B;  2NZD B;  5B32 A;  3REJ B;  3KUY B;  5CPJ C;  3WA9 D;  3NQJ B;  2HIO D;  5B2I B;  3AYW B;  2NZD D;  3REJ D;  2YFW A;  4KUD C;  5B32 G;  1BH8 B;  5B2I D;  3AYW D;  4CAY A;  1P3O C;  5B40 A;  5AV9 C;  2CV5 C;  4M6B A;  3AZJ C;  5BO0 A;  5AVB C;  4XZQ B;  3V9R B;  5AV8 D;  3B0C W;  3WKJ D;  4H9S C;  3LZ0 C;  5GXQ A;  4YS3 A;  4Z66 D;  3A6N A;  3LEL D;  4R8P A;  1P3F C;  5B32 B;  3AZI A;  3X1V B;  3X1U C;  4AWL C;  5B32 D;  2YFW B;  5F99 A;  5JA4 B;  3KWQ A;  3UT9 C;  3X1V D;  4CAY B;  5B1M C;  3MGP A;  5GT0 C;  2IO5 C;  1P34 A;  5AV8 C;  5B0Z A;  4ZBJ B;  3AZM A;  5B40 B;  5E5A C;  3O62 C;  4WU9 C;  3UTA A;  5BO0 B;  5B40 D;  2NQB D;  3VH5 T;  5CP6 B;  1ULY A;  3AZG C;  3W97 D;  3AZF C;  1P3I C;  4YS3 B;  4E45 A;  3MNN C;  3A6N B;  4NE5 A;  4R8P B;  5CP6 D;  5B33 C;  4YS3 D;  4J8V B;  3A6N D;  3AZI B;  1N1J A;  4WZS B;  4XUJ C;  4R8P D;  1M19 C;  5F99 B;  3WTP C;  3KWQ B;  1P3B C;  1P3G A;  4J8V D;  3AZI D;  3MGP B;  5F99 D;  5G49 A;  3TU4 A;  1KX3 D;  1P34 B;  2NQB C;  3LJA C;  5B0Z B;  3AZM B;  1F66 A;  3MGP D;  3W97 C;  3UTA B;  4J8U B;  1P34 D;  3AZM D;  3AZK C;  1U35 C;  3B6F C;  4J8U D;  2YFV B;  5CPI A;  4JJN B;  4KUD A;  5DNN C;  4DRA A;  2F8N K;  4G91 B;  5B24 B;  1S32 C;  4JJN D;  3C1C A;  5AY8 C;  1KX3 C;  1N1J B;  1P3O A;  5AV5 A;  5B24 D;  5JRG C;  4E44 A;  4EO5 C;  5AV9 A;  2CV5 A;  1P3G B;  3AZJ A;  5DNM C;  5AVB A;  3AFA C;  4G92 B;  5G49 B;  3REH C;  3TU4 B;  4Z5T C;  3KXB C;  3X1T D;  1P3G D;  3W98 C;  1F66 B;  3TU4 D;  1P3F A;  5B2I A;  1B6W A;  3X1U A;  1TZY C;  4NFT A;  4KUD B;  3B0D C;  1EQZ C;  5CPJ D;  5CPK C;  3MVD C;  4X23 C;  5B1M A;  5GT0 A;  3C1C B;  5AV8 A;  1P3O B;  5B0Y C;  3WKJ A;  5AV9 B;  2CV5 B;  3O62 A;  4LD9 C;  4Z66 A;  3V9R A;  3AZJ B;  5AVB B;  3LEL A;  1P3O D;  5AV9 D;  2BYK B;  2LY8 A;  3AN2 C;  2CV5 D;  3AZJ D;  3LZ0 B;  4WNN B;  3AZF A;  1P3I A;  5C3I C;  2FJ7 A;  4KGC C;  1P3F B;  3B6G D;  2FJ7 C;  3X1V A;  3LZ0 D;  3C1B C;  5JA4 A;  3X1U B;  4AWL B;  1P3F D;  3B0B A;  3MGR C;  1P3B A;  3UT9 B;  3REL C;  5B1M B;  3X1U D;  3MGQ C;  5GT0 B;  2IO5 B;  5AV8 B;  1M18 C;  2NQB A;  3UT9 D;  3WKJ B;  5B2J C;  5B1M D;  3W97 A;  3O62 B;  1AOI C;  4Z66 B;  5GT0 D;  3LEL B;  3B6G C;  3AZN C;  5CP6 A;  3AZK A;  5E5A D;  3O62 D;  4WU9 D;  3B6F A;  3AZG B;  3AZF B;  1P3I B;  5DNN A;  3AZE C;  4J8V A;  3AZG D;  3AZF D;  1P3I D;  3MNN D;  4KHA B;  5AY8 A;  1KX3 A;  3REK C;  1M19 B;  3R45 A;  5B33 D;  1HQ3 C;  3WTP B;  1P3B B;  2PYO C;  5DNM A;  3AV1 C;  4H9N A;  4XUJ D;  1Q9C A;  3AFA A;  1M19 D;  3WAA C;  3REH A;  1P3P C;  4Z5T A;  2NQB B;  3WTP D;  1P3B D;  1P3M C;  4J8U A;  3W97 B;  3KUY C;  1ZLA C;  3LJA D;  3AZK B;  5GT3 C;  2YFV A;  4JJN A;  3B6F B;  1TZY A;  5B24 A;  1U35 D;  5DNN B;  3AZK D;  3VH6 T;  1EQZ A;  3B6F D;  4X23 A;  4QLC C;  5B31 C;  1S32 B;  5DNN D;  5AY8 B;  1KX3 B;  3X1T A;  5B0Y A;  4CSR B;  3R45 B;  4EO5 B;  1S32 D;  4LD9 A;  5DNM B;  5AY8 D;  4H9N B;  1P3A C;  1ID3 C;  3AFA B;  3REH B;  5JRG D;  4Z5T B;  3KXB B;  1JFI A;  3AN2 A;  4NE3 A;  4H9R A;  5DNM D;  3AFA D;  3REH D;  4Z5T D;  3KXB D;  5CPJ A;  4H9Q B;  3W98 D;  5BS7 C;  3C1B A;  1WWS A;  4J8W D;  1TZY B;  2HUE C;  1EQZ B;  1R4V A;  5CPK B;  3MGR A;  3MVD B;  4X23 B;  5FUG A;  2BYM A;  1TZY D;  3MGQ A;  3AV2 C;  1EQZ D;  5CPK D;  3X1T B;  5B0Y B;  3MVD D;  2ARO C;  4X23 D;  2RVQ D;  3AZH C;  1AOI A;  1P3L C;  4LD9 B;  3W99 C;  2BYK A;  3B6G A;  5B0Y D;  3AZN A;  1BFM A;  5GXQ C;  4H9S A;  1JFI B;  3LZ0 A;  4WNN A;  3AN2 B;  4LD9 D;  4H9R B;  4YM6 D;  1KX4 C;  1H3O A;  3B0C T;  3VH5 A;  4J8W C;  3AZE A;  5CPJ B;  3AN2 D;  2FJ7 B;  1M1A C;  4KGC D;  3C1B B;  5BT1 C;  3KWQ C;  3X1S C;  3REK A;  3UT9 A;  2FJ7 D;  2RVQ C;  3MGR B;  3MGS D;  3C1B D;  4WU8 D;  2JSS A;  3REI C;  5FUG B;  1KX5 C;  1BH9 A;  3AV1 A;  2BYM B;  4NE6 A;  5B0Z C;  3REL B;  3MGQ B;  3WTP E;  3WAA A;  1P3P A;  1M18 B;  5E5A A;  3MGR D;  4WU9 A;  4YM6 C;  3VH5 W;  4H9P A;  5B2J B;  3REL D;  1A7W A;  1AOI B;  5B1L C;  3MGQ D;  1ZLA A;  1M18 D;  3B6G B;  3AZN B;  5BNV A;  5GT3 A;  5B2J D;  3AZG A;  1AOI D;  3MNN A;  1H3O B;  5KDM A;  3AZN D;  3AZE B;  3UTB C;  5B33 A;  3MGS C;  4WU8 C;  5B31 A;  4KHA A;  4ZUX C;  4XUJ A;  1M19 A;  3AZE D;  3REK B;  3WTP A;  3AZL C;  4UUZ A;  5B31 G;  3KSY A;  2PYO B;  1BH9 B;  3AV1 B;  1P3A A;  1ID3 A;  3REK D;  1P3K D;  3LJA A;  3WAA B;  4J8X C;  1P3P B;  1HQ3 D;  5E5A B;  4WU9 B;  1P3M B;  2PYO D;  3AV1 D;  4H9P B;  3WAA D;  4WV4 B;  1U35 A;  1ZLA B;  1P3P D;  5AV6 C;  5BNV B;  5GSU D;  1P3M D;  5CPI C;  5GT3 B;  5BS7 A;  3MNN B;  3KUY D;  1ZLA D;  3LZ1 C;  5KDM B;  5GT3 D;  5B33 B;  3C1C C;  1S32 A;  4QLC B;  5B31 B;  5AV5 C;  4XUJ B;  1P3K C;  4CSR A;  3AV2 A;  5JRG A;  3W96 C;  4HGA C;  2ARO A;  5AVC C;  4UUZ B;  4QLC D;  5B31 D;  3AZH A;  1P3L A;  3WA9 C;  1P3A B;  3KXB A;  1ID3 B;  3W99 A;  3LJA B;  2HIO C;  5GSU C;  3W98 A;  2NZD C;  4XZQ D;  3REJ C;  1KX4 A;  4Z2M G;  1P3A D;  1ID3 D;  4J8W A;  4H9Q A;  5B2I C;  3AYW C;  1U35 B;  1M1A A;  5BNX A;  5CPK A;  3X1S A;  3MVD A;  2HUE B;  1B67 A;  3REI A;  1KX5 A;  2F8N A;  3WKJ C;  3AV2 B;  5JRG B;  4XZQ C;  4Z66 C;  2ARO B;  4YM6 A;  3LEL C;  3AZH B;  2F8N G;  5B1L A;  3AV2 D;  1P3L B;  3W99 B;  2ARO D;  3W98 B;  5GXQ B;  5B32 C;  3AZH D;  4KGC A;  1P3L D;  1KX4 B;  3W99 D;  4J8W B;  3X1V C;  5GXQ D; 
#chains in the Genus database with same CATH topology
 3UTB A;  2F2A C;  4WU8 A;  3MGS A;  1KX4 D;  1M1A B;  4ZUX A;  3B0D B;  5BNX B;  3X1S B;  3AZL A;  3NQU A;  3REL A;  1M1A D;  1TAF A;  4ZBJ C;  3REI B;  5B40 C;  1KX5 B;  2F8N B;  5BT1 D;  3KWQ D;  3X1S D;  1M18 A;  4J8X A;  5B2J A;  3KFU G;  2ZY5 A;  4YM6 B;  3REI D;  1KX5 D;  2F8N D;  5B0Z D;  5CP6 C;  2RIQ A;  5B1L B;  2UWX A;  2J8P A;  3A1I A;  2CWE A;  4YS3 C;  3UTA D;  5AV6 A;  3A6N C;  4R8P C;  4KGC B;  5B1L D;  5C3I B;  3LZ1 A;  4Z2M H;  4J8V C;  3AZI C;  3UTB B;  5F99 C;  1WWI A;  4WU8 B;  3VH6 A;  3MGS B;  4ZUX B;  1P3K A;  3MGP C;  3UTB D;  1HQ3 A;  3W96 A;  3AZL B;  1P34 C;  2PYO A;  5CHL B;  5AVC A;  3NQU B;  4DQY B;  1TAF B;  4ZUX D;  3AZM C;  3WA9 A;  4DRB A;  3UTA C;  2HIO A;  4J8U C;  3AZL D;  4J8X B;  5GSU A;  1P3M A;  2L5A A;  4H9O A;  2NZD A;  3REJ A;  3KUY A;  3NQJ A;  1F1E A;  4J8X D;  3AYW A;  3EPL A;  1F66 D;  2F8N H;  4JJN C;  3VH6 W;  5AV6 B;  5CPI B;  1BH8 A;  4G91 C;  5B24 C;  3LZ1 B;  5AV6 D;  1HTA A;  5CPI D;  4QLC A;  4KUD D;  3LZ1 D;  3X1T C;  5AV5 B;  1P3G C;  1P3K B;  1Z2C B;  4XZQ A;  4G92 C;  1HQ3 B;  3W96 B;  3C1C D;  4HGA B;  3TU4 C;  2DQN C;  5AVC B;  5AV5 D;  3AL0 C;  1F66 C;  3WA9 B;  3W96 D;  2HIO B;  5AVB D;  1KU5 A;  5GSU B;  5AVC D;  4H9O B;  2NZD B;  5B32 A;  3REJ B;  3KUY B;  5CPJ C;  3WA9 D;  3NQJ B;  2HIO D;  5B2I B;  3AYW B;  2NZD D;  3REJ D;  2YFW A;  4KUD C;  5B32 G;  2Y2J A;  1BH8 B;  5B2I D;  3AYW D;  4CAY A;  2Y2M A;  2Y2K A;  1P3O C;  5B40 A;  5AV9 C;  2CV5 C;  4M6B A;  3AZJ C;  5BO0 A;  5AVB C;  4XZQ B;  3V9R B;  5AV8 D;  3B0C W;  3WKJ D;  4H9S C;  3LZ0 C;  5GXQ A;  4YS3 A;  4Z66 D;  3A6N A;  3LEL D;  4R8P A;  1P3F C;  5B32 B;  3A1K A;  2DF4 C;  3AZI A;  3X1V B;  3X1U C;  4AWL C;  5B32 D;  2YFW B;  5F99 A;  5JA4 B;  3KWQ A;  3UT9 C;  3X1V D;  4CAY B;  5B1M C;  3MGP A;  2W8S A;  5GT0 C;  2IO5 C;  1P34 A;  5AV8 C;  5B0Z A;  4ZBJ B;  3AZM A;  5B40 B;  5E5A C;  3O62 C;  4WU9 C;  3UTA A;  5BO0 B;  5B40 D;  2NQB D;  3VH5 T;  4UPK A;  5CP6 B;  1ULY A;  3AZG C;  3W97 D;  3AZF C;  1P3I C;  4YS3 B;  4E45 A;  3MNN C;  3A6N B;  4NE5 A;  4R8P B;  5CP6 D;  5B33 C;  4YS3 D;  4J8V B;  3A6N D;  3AZI B;  1N1J A;  4WZS B;  4XUJ C;  4R8P D;  1M19 C;  5F99 B;  3WTP C;  3KWQ B;  1P3B C;  1P3G A;  3FDD A;  4J8V D;  3AZI D;  3MGP B;  5F99 D;  5G49 A;  2Y2P A;  3TU4 A;  1KX3 D;  1P34 B;  2NQB C;  3LJA C;  5B0Z B;  3AZM B;  1F66 A;  3MGP D;  3W97 C;  3UTA B;  4J8U B;  1P34 D;  3AZM D;  3AZK C;  1U35 C;  3B6F C;  4J8U D;  2YFV B;  5CPI A;  4JJN B;  4KUD A;  5DNN C;  4DRA A;  2F8N K;  4G91 B;  5B24 B;  1S32 C;  4JJN D;  3C1C A;  5AY8 C;  1KX3 C;  1N1J B;  1P3O A;  5AV5 A;  5B24 D;  5JRG C;  4E44 A;  4EO5 C;  5AV9 A;  2CV5 A;  1P3G B;  3AZJ A;  5DNM C;  5AVB A;  3AFA C;  4G92 B;  5G49 B;  3REH C;  3TU4 B;  4Z5T C;  3KXB C;  3X1T D;  1P3G D;  3W98 C;  2Y2Q A;  1F66 B;  2JE5 A;  3TU4 D;  1P3F A;  5B2I A;  1B6W A;  3X1U A;  4WJ3 C;  1TZY C;  4NFT A;  4KUD B;  3B0D C;  1EQZ C;  5CPJ D;  3EPK A;  5CPK C;  3MVD C;  4X23 C;  5B1M A;  5GT0 A;  3C1C B;  5AV8 A;  1P3O B;  5B0Y C;  2ZY3 A;  3WKJ A;  5AV9 B;  2CV5 B;  3O62 A;  4LD9 C;  4Z66 A;  3V9R A;  3AZJ B;  5AVB B;  3LEL A;  1P3O D;  5AV9 D;  2BYK B;  2LY8 A;  3AN2 C;  2CV5 D;  3AZJ D;  2JCH A;  4WNN B;  3LZ0 B;  3AZF A;  1P3I A;  5C3I C;  2FJ7 A;  4KGC C;  3H0L C;  1P3F B;  3B6G D;  2FJ7 C;  3X1V A;  3LZ0 D;  3C1B C;  5JA4 A;  3H0M C;  3X1U B;  4AWL B;  1P3F D;  3B0B A;  1PZR A;  3MGR C;  1P3B A;  3UT9 B;  3REL C;  5B1M B;  3X1U D;  3MGQ C;  5GT0 B;  2IO5 B;  5AV8 B;  1M18 C;  2NQB A;  3UT9 D;  3WKJ B;  2BG1 A;  5B2J C;  5B1M D;  3W97 A;  3O62 B;  1AOI C;  4Z66 B;  5GT0 D;  2Y2O A;  3LEL B;  3B6G C;  3AZN C;  5CP6 A;  2Y2L A;  3AZK A;  5E5A D;  3O62 D;  4WU9 D;  3B6F A;  3AZG B;  3AZF B;  1P3I B;  5DNN A;  3AZE C;  4J8V A;  3AZG D;  3AZF D;  1P3I D;  3MNN D;  4KHA B;  5AY8 A;  1KX3 A;  3REK C;  1M19 B;  3R45 A;  5B33 D;  1HQ3 C;  3WTP B;  1P3B B;  2Y2I A;  2PYO C;  5DNM A;  3AV1 C;  4H9N A;  4XUJ D;  1Q9C A;  3AFA A;  1M19 D;  3WAA C;  3REH A;  1P3P C;  4Z5T A;  2NQB B;  3WTP D;  1P3B D;  1P3M C;  4J8U A;  3W97 B;  3KUY C;  1ZLA C;  3LJA D;  3AZK B;  5GT3 C;  2YFV A;  4JJN A;  3B6F B;  1TZY A;  2ZM5 A;  5B24 A;  1U35 D;  5DNN B;  3AZK D;  3VH6 T;  1EQZ A;  3F6T A;  3B6F D;  4X23 A;  4QLC C;  5B31 C;  1S32 B;  5DNN D;  5AY8 B;  1KX3 B;  3X1T A;  5B0Y A;  4CSR B;  3R45 B;  4EO5 B;  1S32 D;  4LD9 A;  5DNM B;  5AY8 D;  1T3U A;  4H9N B;  2XD5 A;  1P3A C;  1ID3 C;  3AFA B;  3REH B;  5JRG D;  4Z5T B;  3KXB B;  1JFI A;  3AN2 A;  4NE3 A;  4H9R A;  5DNM D;  3AFA D;  3REH D;  4Z5T D;  3KXB D;  5CPJ A;  4H9Q B;  3W98 D;  2G5H C;  5BS7 C;  3C1B A;  1WWS A;  3P5J B;  4J8W D;  2ZY2 A;  1TZY B;  2HUE C;  1EQZ B;  1R4V A;  5CPK B;  3MGR A;  3MVD B;  4X23 B;  5FUG A;  2BYM A;  1TZY D;  3MGQ A;  3AV2 C;  3EG5 B;  1EQZ D;  5CPK D;  3X1T B;  5B0Y B;  3MVD D;  2ARO C;  4X23 D;  2RVQ D;  3AZH C;  1AOI A;  1P3L C;  4LD9 B;  3W99 C;  2BYK A;  3B6G A;  5B0Y D;  3AZN A;  1BFM A;  5GXQ C;  4H9S A;  1JFI B;  3LZ0 A;  4WNN A;  3AN2 B;  4LD9 D;  4H9R B;  4YM6 D;  1KX4 C;  1H3O A;  3B0C T;  3VH5 A;  4J8W C;  3AZE A;  5CPJ B;  3AN2 D;  2FJ7 B;  1M1A C;  4KGC D;  3C1B B;  2Y2N A;  5BT1 C;  3KWQ C;  2XD1 A;  3REK A;  3X1S C;  3UT9 A;  2FJ7 D;  2RVQ C;  3MGR B;  3MGS D;  3C1B D;  4WU8 D;  2JSS A;  3REI C;  5FUG B;  1KX5 C;  1BH9 A;  3AV1 A;  2BYM B;  4NE6 A;  5B0Z C;  3REL B;  3MGQ B;  3WTP E;  3WAA A;  1P3P A;  1M18 B;  5E5A A;  3MGR D;  4WU9 A;  4YM6 C;  3VH5 W;  2G5I C;  4H9P A;  5B2J B;  3REL D;  1A7W A;  1AOI B;  5B1L C;  3MGQ D;  1ZLA A;  1M18 D;  3B6G B;  3AZN B;  5BNV A;  5GT3 A;  5B2J D;  3AZG A;  1AOI D;  3MNN A;  1H3O B;  2FFF B;  5KDM A;  3AZN D;  3AZE B;  3UTB C;  5B33 A;  3MGS C;  2ZY4 A;  4WU8 C;  5B31 A;  4KHA A;  4ZUX C;  4XUJ A;  1M19 A;  3AZE D;  2Y2G A;  3REK B;  1W2E A;  3WTP A;  3AZL C;  4UUZ A;  5B31 G;  3KSY A;  2PYO B;  1BH9 B;  3AV1 B;  1P3A A;  1ID3 A;  3REK D;  1P3K D;  3LJA A;  3WAA B;  2Y2H A;  4J8X C;  1P3P B;  1HQ3 D;  5E5A B;  4WU9 B;  1P3M B;  2PYO D;  3AV1 D;  4H9P B;  3EPH A;  3WAA D;  4WV4 B;  1U35 A;  1ZLA B;  1P3P D;  5AV6 C;  5BNV B;  5GSU D;  1P3M D;  5CPI C;  5GT3 B;  5BS7 A;  3MNN B;  3KUY D;  1ZLA D;  3LZ1 C;  5KDM B;  5GT3 D;  5B33 B;  3C1C C;  1S32 A;  5B31 B;  4QLC B;  5AV5 C;  4XUJ B;  1P3K C;  4CSR A;  3AV2 A;  5JRG A;  3W96 C;  4HGA C;  2ARO A;  4UUZ B;  4QLC D;  5B31 D;  5AVC C;  3AZH A;  1P3L A;  3WA9 C;  1P3A B;  3KXB A;  1ID3 B;  3W99 A;  3LJA B;  2HIO C;  5GSU C;  3W98 A;  2NZD C;  4XZQ D;  3REJ C;  1KX4 A;  4Z2M G;  1P3A D;  2VQR A;  1ID3 D;  4J8W A;  4H9Q A;  5B2I C;  3AYW C;  1U35 B;  1M1A A;  5BNX A;  5CPK A;  3X1S A;  3MVD A;  2HUE B;  1B67 A;  3REI A;  1KX5 A;  2F8N A;  3WKJ C;  3AV2 B;  5JRG B;  4XZQ C;  4Z66 C;  2ARO B;  3IP4 C;  4YM6 A;  3LEL C;  3EPJ A;  3AZH B;  2F8N G;  5B1L A;  3AV2 D;  1P3L B;  3W99 B;  2ARO D;  3W98 B;  5GXQ B;  5B32 C;  3AZH D;  4KGC A;  1P3L D;  1KX4 B;  3H0R C;  3W99 D;  4J8W B;  3X1V C;  5GXQ D; 
#chains in the Genus database with same CATH homology
 3UTB A;  2F2A C;  4WU8 A;  3MGS A;  1KX4 D;  1M1A B;  4ZUX A;  3B0D B;  5BNX B;  3X1S B;  3AZL A;  3NQU A;  3REL A;  1M1A D;  1TAF A;  4ZBJ C;  3REI B;  5B40 C;  1KX5 B;  2F8N B;  5BT1 D;  3KWQ D;  3X1S D;  1M18 A;  4J8X A;  5B2J A;  3KFU G;  2ZY5 A;  4YM6 B;  3REI D;  1KX5 D;  2F8N D;  5B0Z D;  5CP6 C;  2RIQ A;  5B1L B;  2UWX A;  2J8P A;  3A1I A;  2CWE A;  4YS3 C;  3UTA D;  5AV6 A;  3A6N C;  4R8P C;  4KGC B;  5B1L D;  5C3I B;  3LZ1 A;  4Z2M H;  4J8V C;  3AZI C;  3UTB B;  5F99 C;  1WWI A;  4WU8 B;  3VH6 A;  3MGS B;  4ZUX B;  1P3K A;  3MGP C;  3UTB D;  1HQ3 A;  3W96 A;  3AZL B;  1P34 C;  2PYO A;  5CHL B;  5AVC A;  3NQU B;  4DQY B;  1TAF B;  4ZUX D;  3AZM C;  3WA9 A;  4DRB A;  3UTA C;  2HIO A;  4J8U C;  3AZL D;  4J8X B;  5GSU A;  1P3M A;  2L5A A;  4H9O A;  2NZD A;  3REJ A;  3KUY A;  3NQJ A;  1F1E A;  4J8X D;  3AYW A;  3EPL A;  1F66 D;  2F8N H;  4JJN C;  3VH6 W;  5AV6 B;  5CPI B;  1BH8 A;  4G91 C;  5B24 C;  3LZ1 B;  5AV6 D;  1HTA A;  5CPI D;  4QLC A;  4KUD D;  3LZ1 D;  3X1T C;  5AV5 B;  1P3G C;  1P3K B;  1Z2C B;  4XZQ A;  4G92 C;  1HQ3 B;  3W96 B;  3C1C D;  4HGA B;  3TU4 C;  2DQN C;  5AVC B;  5AV5 D;  3AL0 C;  1F66 C;  3WA9 B;  3W96 D;  2HIO B;  5AVB D;  1KU5 A;  5GSU B;  5AVC D;  4H9O B;  2NZD B;  5B32 A;  3REJ B;  3KUY B;  5CPJ C;  3WA9 D;  3NQJ B;  2HIO D;  5B2I B;  3AYW B;  2NZD D;  3REJ D;  2YFW A;  4KUD C;  5B32 G;  2Y2J A;  1BH8 B;  5B2I D;  3AYW D;  4CAY A;  2Y2M A;  2Y2K A;  1P3O C;  5B40 A;  5AV9 C;  2CV5 C;  4M6B A;  3AZJ C;  5BO0 A;  5AVB C;  4XZQ B;  3V9R B;  5AV8 D;  3B0C W;  3WKJ D;  4H9S C;  3LZ0 C;  5GXQ A;  4YS3 A;  4Z66 D;  3A6N A;  3LEL D;  4R8P A;  1P3F C;  5B32 B;  3A1K A;  2DF4 C;  3AZI A;  3X1V B;  3X1U C;  4AWL C;  5B32 D;  2YFW B;  5F99 A;  5JA4 B;  3KWQ A;  3UT9 C;  3X1V D;  4CAY B;  5B1M C;  3MGP A;  2W8S A;  5GT0 C;  2IO5 C;  1P34 A;  5AV8 C;  5B0Z A;  4ZBJ B;  3AZM A;  5B40 B;  5E5A C;  3O62 C;  4WU9 C;  3UTA A;  5BO0 B;  5B40 D;  2NQB D;  3VH5 T;  4UPK A;  5CP6 B;  1ULY A;  3AZG C;  3W97 D;  3AZF C;  1P3I C;  4YS3 B;  4E45 A;  3MNN C;  3A6N B;  4NE5 A;  4R8P B;  5CP6 D;  5B33 C;  4YS3 D;  4J8V B;  3A6N D;  3AZI B;  1N1J A;  4WZS B;  4XUJ C;  4R8P D;  1M19 C;  5F99 B;  3WTP C;  3KWQ B;  1P3B C;  1P3G A;  3FDD A;  4J8V D;  3AZI D;  3MGP B;  5F99 D;  5G49 A;  2Y2P A;  3TU4 A;  1KX3 D;  1P34 B;  2NQB C;  3LJA C;  5B0Z B;  3AZM B;  1F66 A;  3MGP D;  3W97 C;  3UTA B;  4J8U B;  1P34 D;  3AZM D;  3AZK C;  1U35 C;  3B6F C;  4J8U D;  2YFV B;  5CPI A;  4JJN B;  4KUD A;  5DNN C;  4DRA A;  2F8N K;  4G91 B;  5B24 B;  1S32 C;  4JJN D;  3C1C A;  5AY8 C;  1KX3 C;  1N1J B;  1P3O A;  5AV5 A;  5B24 D;  5JRG C;  4E44 A;  4EO5 C;  5AV9 A;  2CV5 A;  1P3G B;  3AZJ A;  5DNM C;  5AVB A;  3AFA C;  4G92 B;  5G49 B;  3REH C;  3TU4 B;  4Z5T C;  3KXB C;  3X1T D;  1P3G D;  3W98 C;  2Y2Q A;  1F66 B;  2JE5 A;  3TU4 D;  1P3F A;  5B2I A;  1B6W A;  3X1U A;  4WJ3 C;  1TZY C;  4NFT A;  4KUD B;  3B0D C;  1EQZ C;  5CPJ D;  3EPK A;  5CPK C;  3MVD C;  4X23 C;  5B1M A;  5GT0 A;  3C1C B;  5AV8 A;  1P3O B;  5B0Y C;  2ZY3 A;  3WKJ A;  5AV9 B;  2CV5 B;  3O62 A;  4LD9 C;  4Z66 A;  3V9R A;  3AZJ B;  5AVB B;  3LEL A;  1P3O D;  5AV9 D;  2BYK B;  2LY8 A;  3AN2 C;  2CV5 D;  3AZJ D;  2JCH A;  4WNN B;  3LZ0 B;  3AZF A;  1P3I A;  5C3I C;  2FJ7 A;  4KGC C;  3H0L C;  1P3F B;  3B6G D;  2FJ7 C;  3X1V A;  3LZ0 D;  3C1B C;  5JA4 A;  3H0M C;  3X1U B;  4AWL B;  1P3F D;  3B0B A;  1PZR A;  3MGR C;  1P3B A;  3UT9 B;  3REL C;  5B1M B;  3X1U D;  3MGQ C;  5GT0 B;  2IO5 B;  5AV8 B;  1M18 C;  2NQB A;  3UT9 D;  3WKJ B;  2BG1 A;  5B2J C;  5B1M D;  3W97 A;  3O62 B;  1AOI C;  4Z66 B;  5GT0 D;  2Y2O A;  3LEL B;  3B6G C;  3AZN C;  5CP6 A;  2Y2L A;  3AZK A;  5E5A D;  3O62 D;  4WU9 D;  3B6F A;  3AZG B;  3AZF B;  1P3I B;  5DNN A;  3AZE C;  4J8V A;  3AZG D;  3AZF D;  1P3I D;  3MNN D;  4KHA B;  5AY8 A;  1KX3 A;  3REK C;  1M19 B;  3R45 A;  5B33 D;  1HQ3 C;  3WTP B;  1P3B B;  2Y2I A;  2PYO C;  5DNM A;  3AV1 C;  4H9N A;  4XUJ D;  1Q9C A;  3AFA A;  1M19 D;  3WAA C;  3REH A;  1P3P C;  4Z5T A;  2NQB B;  3WTP D;  1P3B D;  1P3M C;  4J8U A;  3W97 B;  3KUY C;  1ZLA C;  3LJA D;  3AZK B;  5GT3 C;  2YFV A;  4JJN A;  3B6F B;  1TZY A;  2ZM5 A;  5B24 A;  1U35 D;  5DNN B;  3AZK D;  3VH6 T;  1EQZ A;  3F6T A;  3B6F D;  4X23 A;  4QLC C;  5B31 C;  1S32 B;  5DNN D;  5AY8 B;  1KX3 B;  3X1T A;  5B0Y A;  4CSR B;  3R45 B;  4EO5 B;  1S32 D;  4LD9 A;  5DNM B;  5AY8 D;  1T3U A;  4H9N B;  2XD5 A;  1P3A C;  1ID3 C;  3AFA B;  3REH B;  5JRG D;  4Z5T B;  3KXB B;  1JFI A;  3AN2 A;  4NE3 A;  4H9R A;  5DNM D;  3AFA D;  3REH D;  4Z5T D;  3KXB D;  5CPJ A;  4H9Q B;  3W98 D;  2G5H C;  5BS7 C;  3C1B A;  1WWS A;  3P5J B;  4J8W D;  2ZY2 A;  1TZY B;  2HUE C;  1EQZ B;  1R4V A;  5CPK B;  3MGR A;  3MVD B;  4X23 B;  5FUG A;  2BYM A;  1TZY D;  3MGQ A;  3AV2 C;  3EG5 B;  1EQZ D;  5CPK D;  3X1T B;  5B0Y B;  3MVD D;  2ARO C;  4X23 D;  2RVQ D;  3AZH C;  1AOI A;  1P3L C;  4LD9 B;  3W99 C;  2BYK A;  3B6G A;  5B0Y D;  3AZN A;  1BFM A;  5GXQ C;  4H9S A;  1JFI B;  3LZ0 A;  4WNN A;  3AN2 B;  4LD9 D;  4H9R B;  4YM6 D;  1KX4 C;  1H3O A;  3B0C T;  3VH5 A;  4J8W C;  3AZE A;  5CPJ B;  3AN2 D;  2FJ7 B;  1M1A C;  4KGC D;  3C1B B;  2Y2N A;  5BT1 C;  3KWQ C;  2XD1 A;  3REK A;  3X1S C;  3UT9 A;  2FJ7 D;  2RVQ C;  3MGR B;  3MGS D;  3C1B D;  4WU8 D;  2JSS A;  3REI C;  5FUG B;  1KX5 C;  1BH9 A;  3AV1 A;  2BYM B;  4NE6 A;  5B0Z C;  3REL B;  3MGQ B;  3WTP E;  3WAA A;  1P3P A;  1M18 B;  5E5A A;  3MGR D;  4WU9 A;  4YM6 C;  3VH5 W;  2G5I C;  4H9P A;  5B2J B;  3REL D;  1A7W A;  1AOI B;  5B1L C;  3MGQ D;  1ZLA A;  1M18 D;  3B6G B;  3AZN B;  5BNV A;  5GT3 A;  5B2J D;  3AZG A;  1AOI D;  3MNN A;  1H3O B;  2FFF B;  5KDM A;  3AZN D;  3AZE B;  3UTB C;  5B33 A;  3MGS C;  2ZY4 A;  4WU8 C;  5B31 A;  4KHA A;  4ZUX C;  4XUJ A;  1M19 A;  3AZE D;  2Y2G A;  3REK B;  1W2E A;  3WTP A;  3AZL C;  4UUZ A;  5B31 G;  3KSY A;  2PYO B;  1BH9 B;  3AV1 B;  1P3A A;  1ID3 A;  3REK D;  1P3K D;  3LJA A;  3WAA B;  2Y2H A;  4J8X C;  1P3P B;  1HQ3 D;  5E5A B;  4WU9 B;  1P3M B;  2PYO D;  3AV1 D;  4H9P B;  3EPH A;  3WAA D;  4WV4 B;  1U35 A;  1ZLA B;  1P3P D;  5AV6 C;  5BNV B;  5GSU D;  1P3M D;  5CPI C;  5GT3 B;  5BS7 A;  3MNN B;  3KUY D;  1ZLA D;  3LZ1 C;  5KDM B;  5GT3 D;  5B33 B;  3C1C C;  1S32 A;  5B31 B;  4QLC B;  5AV5 C;  4XUJ B;  1P3K C;  4CSR A;  3AV2 A;  5JRG A;  3W96 C;  4HGA C;  2ARO A;  4UUZ B;  4QLC D;  5B31 D;  5AVC C;  3AZH A;  1P3L A;  3WA9 C;  1P3A B;  3KXB A;  1ID3 B;  3W99 A;  3LJA B;  2HIO C;  5GSU C;  3W98 A;  2NZD C;  4XZQ D;  3REJ C;  1KX4 A;  4Z2M G;  1P3A D;  2VQR A;  1ID3 D;  4J8W A;  4H9Q A;  5B2I C;  3AYW C;  1U35 B;  1M1A A;  5BNX A;  5CPK A;  3X1S A;  3MVD A;  2HUE B;  1B67 A;  3REI A;  1KX5 A;  2F8N A;  3WKJ C;  3AV2 B;  5JRG B;  4XZQ C;  4Z66 C;  2ARO B;  3IP4 C;  4YM6 A;  3LEL C;  3EPJ A;  3AZH B;  2F8N G;  5B1L A;  3AV2 D;  1P3L B;  3W99 B;  2ARO D;  3W98 B;  5GXQ B;  5B32 C;  3AZH D;  4KGC A;  1P3L D;  1KX4 B;  3H0R C;  3W99 D;  4J8W B;  3X1V C;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...