3AZGB

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgB00
5B1MD 4CAYB 3LJAA 4J8XD 5JA4B 3AZHC 4J8UB 3MGPD 5GSUD 3A6NB 3X1TA 3WAAA 1BH9B 4J8UC 5AV8D 4J8VD 3WA9D 3AFAD 4XUJB 3A6NC 4R8PD 1P3LA 5B32G 3C1BD 3TU4A 5B32D 1TAFA 4Z2MH 5G49B 4WV4B 4XUJC 5F99A 3REKA 1M1AA 5E5AB 3AZHD 3AZNA 4H9QB 5E5AC 2F8NK 4J8UD 3A6ND 5AY8D 5CP6D 1M18A 3WKJA 2F8NA 1HQ3B 4XUJD 4NE3A 1M19B 3AZGA 3UTBB 2LY8A 1N1JB 3V9RA 1HQ3C 3AZKB 5JRGA 5BNXB 1H3OB 1M19C 3AZJA 3RELA 3C1CA 5E5AD 3UTBC 3B6FA 3AZKC 1KX4A 5B1MA 1P3MB 3WTPA 5DNND 3UTAB 4ZUXB 5BT1C 5GSUA 4WU9A 1P3MC 4WZSB 3KXBB 3MNNA 5AV8A 4J8VA 3UTAC 3WA9A 3R45B 4ZUXC 5B31G 3AFAA 1HQ3D 2NQBA 3W97B 1M19D 3KXBC 5B32A 3UTBD 4Z66A 3AZMA 1WWSA 3VH6T 3AZKD 3NQJB 3X1UD 3W97C 5CHLB 5AVBA 5B33A 3W98B 5BT1D 4JJNA 5C3IB 5JA4A 1WWIA 3LZ1A 4AWLB 3W98C 1P3AB 3UTAD 1AOIB 4ZUXD 3AZEB 1KX5A 5AY8A 1P3GB 5CP6A 1JFIA 1BH9A 5C3IC 3KXBD 1R4VA 4AWLC 1P3AC 1AOIC 4WU8B 3B0CW 3AZEC 1P3GC 3LZ0B 3X1VD 1ID3B 4WU8C 3REIB 3LZ0C 3AZIA 5GT3B 5AV9B 3UT9B 3W98D 1ID3C 1P3KB 5AV5B 5B0YD 3REIC 5B1LA 1Q9CA 2L5AA 3VH6A 4H9QA 5GT3C 5AV9C 5DNNA 3UT9C 1P3KC 5AV5C 1AOID 5AV6B 3AZED 4DRAA 1P3GD 2F8NH 4NE5A 5GXQD 1HQ3A 5AV6C 4YM6B 4WU8D 1F66B 1P3BB 1M19A 5B31A 1BH8B 3UTBA 5BO0A 3KUYB 4KUDA 1N1JA 1ID3D 4YM6C 1F66C 5BNXA 3X1UA 3REID 1P3BC 2BYMB 4WNNB 3REJB 3AYWB 5AV9D 4EO5B 3KUYC 2HIOB 1P3KD 5AV5D 2CV5B 3AV1A 3REJC 3AYWC 4EO5C 3UTAA 2HIOC 4ZUXA 5AV6D 2CV5C 3WTPE 3REHD 3KXBA 3B6GB 2BYKA 2NZDD 3B0DB 1F66D 1P3BD 1P34D 3X1VA 3B6GC 3KUYD 4Z5TA 3B0DC 1TZYA 1ZLAB 3REJD 3AYWD 3W98A 5B0YA 4QLCB 4UUZB 2CV5D 1KX3B 4X23A 1ZLAC 3AZFB 1ULYA 1P3IB 1AOIA 4QLCC 1KX3C 4H9SA 3LELB 1P3FB 3AZFC 3AV2B 3B6GD 2AROB 4J8WB 4H9NA 2FJ7B 5GXQA 5B24B 1P3IC 4H9RB 3LELC 1P3FC 3AV2C 2AROC 4J8WC 2FJ7C 5B24C 3NQUB 1ZLAD 3O62A 4E45A 3AZLB 1P3KA 5AV5A 4QLCD 1KX3D 5B2IB 5KDMB 5CPJB 4CSRB 4J8XA 3AZFD 3X1SB 3MGPA 3AZLC 4YS3B 5AV6A 1P3ID 5B2IC 2JSSA 3REHA 5CPJC 3LELD 3KWQB 3AV2D 2NZDA 2AROD 4J8WD 5FUGB 3X1SC 4YS3C 5BNVB 5CPKB 2YFWB 5B24D 5CPIB 1F66A 4R8PA 1P34A 3C1BA 3KWQC 5CPKC 4H9PB 2PYOB 5CPIC 5BS7A 1P3OB 4KGCB 4H9OB 2BYMA 2YFVA 3AZHA 2PYOC 3VH5W 3AZLD 1P3OC 4KGCC 5B2ID 5AVCB 4CAYA 5CPJD 1P3MD 5B0ZB 4J8UA 3X1SD 4YS3D 3WAAB 3A6NA 5AVCC 3B6GA 3KWQD 3MGRB 3MVDB 5B0ZC 5CPKD 3KSYA 1P3LB 3WAAC 4XUJA 3B0CT 5B40B 3W97D 1TAFB 3MGRC 3MVDC 2PYOD 1P3LC 5G49A 1M1AB 1P3OD 4KGCD 5B40C 5E5AA 4QLCA 4UUZA 1M1AC 1KX3A 1U35B 5AVCD 5B0ZD 1P3IA 1P3AD 3WAAD 1U35C 1M18B 3WKJB 3LELA 3AV2A 4J8WA 3MGRD 3MVDD 5B24A 1P3LD 1M18C 3WKJC 5B40D 3V9RB 3LZ0D 3AZJB 3AZKA 1M1AD 1H3OA 5GT3D 3AZLA 3UT9D 3AZJC 3WTPB 1U35D 5B2IA 5CPJA 4WU9B 5GSUB 1P3MA 1F1EA 4DRBA 3WTPC 3MNNB 1M18D 3WA9B 3KWQA 5GSUC 4WU9C 2NQBB 5CPKA 5BNVA 3R45A 4YM6D 4KHAB 3MNNC 3W97A 3WA9C 4Z66B 3AZMB 2NQBC 4H9PA 2PYOA 3AZJD 1P3OA 5AVBB 4KGCA 5B33B 4H9OA 3NQJA 1B6WA 4Z66C 3AZMC 1EQZB 4XZQB 1S32B 2HIOD 4JJNB 5AVBC 5B33C 3WTPD 3LZ1B 5AVCA 1EQZC 4WU9D 4XZQC 5B0ZA 1KX5B 5AY8B 1P3AA 5CP6B 1S32C 4JJNC 1JFIB 4LD9B 4HGAB 3AZEA 3LZ1C 3MNND 1P3GA 3MGRA 3MVDA 2NQBD 1KX5C 5AY8C 1HTAA 5CP6C 4LD9C 4HGAC 5GT0B 4WU8A 5B40A 4Z66D 3LZ0A 3AZMD 1P3PB 4Z2MG 1ID3A 3AZIB 5GT0C 5AVBD 3REIA 5B33D 3W99B 3W96B 4G92B 3AN2B 1EQZD 1P3PC 4XZQD 5GT3A 5B1LB 5AV9A 3UT9A 1S32D 4JJND 3AZIC 3W99C 3W96C 1U35A 5DNNB 3LZ1D 4G92C 3AN2C 5B1LC 1KX5D 5DNMB 1KU5A 4LD9D 5DNNC 1P3FD 5B31B 5DNMC 2FJ7D 4YM6A 5GT0D 4M6BA 3MGSB 5BO0B 1P3BA 5B2JB 4KUDB 2RVQC 1P3PD 1BH8A 3X1UB 3MGQB 5B31C 3KUYA 3AZID 3W99D 3W96D 3MGSC 5B2JC 4KUDC 4WNNA 3REJA 4G91B 3AN2D 3X1UC 3AYWA 5B1LD 3AV1B 3MGQC 2HIOA 3VH5T 1A7WA 2CV5A 3LJAB 4G91C 3AV1C 4NFTA 1B67A 5DNMD 3X1TB 3LJAC 2BYKB 2RVQD 5B31D 3X1VB 3X1TC 4KHAA 5CPID 3MGSD 3TU4B 4NE6A 5B2JD 4KUDD 3VH6W 4Z5TB 1TZYB 5F99B 3MGQD 3REKB 3B0BA 3X1VC 1ZLAA 3TU4C 3AZNB 1EQZA 4XZQA 5B0YB 4Z5TC 1TZYC 4X23B 5F99C 3AV1D 3REKC 4E44A 1S32A 3LJAD 3AZNC 5B0YC 3AZFA 4X23C 4LD9A 3X1TD 4H9NB 3VH5A 5GXQB 1P3FA 2F8NB 2AROA 2FJ7A 3AZGB 4H9SC 5GT0A 4H9RA 1BFMA 3TU4D 5GXQC 1P3PA 2CWEA 4Z5TD 5JRGB 1TZYD 5F99D 3REKD 3AZGC 3W99A 3W96A 3O62B 3C1CB 3NQUA 3RELB 3AZND 3AN2A 3B6FB 1KX4B 5JRGC 4X23D 4ZBJB 5B1MB 4J8XB 3O62C 3C1CC 3RELC 3MGPB 3B6FC 5KDMA 4CSRA 1KX4C 3X1SA 4ZBJC 3REHB 5DNMA 4YS3A 5B1MC 4J8XC 2HUEB 2F8NG 2NZDB 3MGPC 5AV8B 4J8VB 3WKJD 3AFAB 2F8ND 4R8PB 1P34B 5FUGA 3REHC 2YFWA 2IO5B 3C1BB 3AZGD 5CPIA 2HUEC 3MGSA 2NZDC 5B2JA 5B32B 5AV8C 4J8VC 3AFAC 4R8PC 1P34C 5JRGD 3MGQA 2IO5C 3C1BC 3O62D 2YFVB 3C1CD 3RELD 5B32C 3AZHB 3B6FD 5BS7C 1KX4D
chains in the Genus database with same CATH superfamily
5B1MD 4CAYB 3LJAA 4J8XD 3H0RC 5JA4B 3AZHC 4J8UB 3MGPD 2Y2GA 5GSUD 3A6NB 3X1TA 3WAAA 1BH9B 4J8UC 5AV8D 4J8VD 3WA9D 3AFAD 4XUJB 3A6NC 4R8PD 3IP4C 1P3LA 5B32G 3C1BD 3TU4A 5B32D 1TAFA 4Z2MH 5G49B 4WV4B 4XUJC 5F99A 3REKA 1M1AA 5E5AB 3AZHD 3AZNA 4H9QB 2VQRA 5E5AC 2F8NK 4J8UD 2ZY5A 3A6ND 5AY8D 5CP6D 1M18A 3WKJA 2F8NA 1HQ3B 4XUJD 4NE3A 1M19B 3AZGA 3UTBB 3A1IA 2LY8A 1N1JB 3V9RA 1HQ3C 3AZKB 5JRGA 5BNXB 1H3OB 1M19C 3AZJA 3RELA 3C1CA 2W8SA 5E5AD 3UTBC 3B6FA 3AZKC 1KX4A 4UPKA 5B1MA 1P3MB 3WTPA 5DNND 3UTAB 4ZUXB 5BT1C 5GSUA 4WU9A 1P3MC 4WZSB 3KXBB 3MNNA 2Y2MA 5AV8A 4J8VA 3UTAC 3WA9A 3R45B 4ZUXC 5B31G 3AFAA 1HQ3D 2NQBA 3W97B 1M19D 3KXBC 5B32A 3UTBD 4Z66A 2Y2PA 3AZMA 1WWSA 3VH6T 3AZKD 3NQJB 3X1UD 3EPHA 3W97C 5CHLB 5AVBA 5B33A 2ZY4A 3W98B 5BT1D 4JJNA 5C3IB 5JA4A 1WWIA 3LZ1A 2J8PA 4AWLB 3W98C 1P3AB 3UTAD 1AOIB 4ZUXD 3AZEB 1KX5A 5AY8A 1P3GB 5CP6A 1JFIA 1BH9A 5C3IC 3KXBD 1R4VA 4AWLC 1P3AC 1AOIC 2JE5A 4WU8B 3B0CW 3AZEC 1P3GC 3LZ0B 3X1VD 1ID3B 4WU8C 3REIB 3LZ0C 3AZIA 5GT3B 5AV9B 3UT9B 3W98D 1ID3C 1P3KB 2UWXA 5AV5B 5B0YD 3REIC 5B1LA 1Q9CA 2L5AA 3VH6A 4H9QA 5GT3C 5AV9C 5DNNA 3UT9C 1P3KC 5AV5C 1AOID 5AV6B 3AZED 4DRAA 3P5JB 1P3GD 2F8NH 2F2AC 4NE5A 5GXQD 1HQ3A 2Y2IA 5AV6C 2G5HC 4YM6B 4WU8D 1P3BB 1M19A 1F66B 3EPLA 5B31A 2JCHA 1BH8B 3UTBA 5BO0A 3KUYB 4KUDA 1N1JA 1ID3D 4YM6C 2Y2JA 5BNXA 3X1UA 3REID 1P3BC 1F66C 2BYMB 4WNNB 3REJB 3AYWB 5AV9D 4EO5B 3KUYC 2HIOB 1P3KD 5AV5D 3FDDA 2CV5B 3AV1A 3REJC 3AYWC 4EO5C 3UTAA 2HIOC 4ZUXA 5AV6D 2CV5C 3WTPE 3REHD 3KXBA 3B6GB 2BYKA 2NZDD 2BG1A 3B0DB 1F66D 1P3BD 1P34D 2Y2QA 3X1VA 3B6GC 3KUYD 4Z5TA 3B0DC 1TZYA 1ZLAB 3REJD 3AYWD 3W98A 5B0YA 4QLCB 4UUZB 2CV5D 1KX3B 4X23A 1ZLAC 2Y2HA 3AZFB 1ULYA 1P3IB 1AOIA 4QLCC 1KX3C 4H9SA 3LELB 1P3FB 4DQYB 3AZFC 3AV2B 2AROB 4J8WB 3B6GD 4H9NA 2FJ7B 5GXQA 5B24B 1P3IC 4H9RB 3LELC 1P3FC 3AV2C 2AROC 4J8WC 2FJ7C 5B24C 3NQUB 1ZLAD 3O62A 4E45A 3AZLB 1P3KA 5AV5A 3AL0C 1T3UA 4QLCD 1KX3D 5B2IB 5KDMB 5CPJB 4CSRB 4J8XA 3AZFD 3X1SB 3MGPA 3AZLC 4YS3B 5AV6A 1P3ID 5B2IC 2JSSA 4WJ3C 3REHA 5CPJC 3LELD 3KWQB 3AV2D 2NZDA 2AROD 3H0MC 5FUGB 4J8WD 4YS3C 5BNVB 3X1SC 2YFWB 3F6TA 5B24D 5CPIB 5CPKB 1F66A 4R8PA 1P34A 2ZY2A 3C1BA 3KWQC 5CPKC 4H9PB 2PYOB 5CPIC 5BS7A 1P3OB 4KGCB 4H9OB 2BYMA 2YFVA 2Y2OA 3AZHA 2PYOC 3VH5W 3AZLD 1P3OC 4KGCC 2G5IC 5B2ID 5AVCB 4CAYA 5CPJD 1P3MD 5B0ZB 4J8UA 3X1SD 4YS3D 3WAAB 3A6NA 5AVCC 3B6GA 3EG5B 3KWQD 3MVDB 5B0ZC 3MGRB 5CPKD 3KSYA 1P3LB 3WAAC 4XUJA 3B0CT 5B40B 3W97D 1TAFB 3MGRC 3MVDC 2PYOD 1P3LC 5G49A 1M1AB 1P3OD 4KGCD 2DF4C 5B40C 2ZM5A 5E5AA 4QLCA 4UUZA 1M1AC 1KX3A 1U35B 5AVCD 5B0ZD 1P3IA 1P3AD 3WAAD 2FFFB 1U35C 1M18B 3WKJB 3LELA 3AV2A 4J8WA 3MGRD 3MVDD 5B24A 1P3LD 3EPJA 3EPKA 1M18C 3WKJC 5B40D 3V9RB 3LZ0D 3AZJB 3AZKA 1M1AD 1H3OA 5GT3D 2RIQA 3AZLA 3UT9D 3AZJC 3WTPB 1U35D 5B2IA 3A1KA 5CPJA 4WU9B 5GSUB 1P3MA 1F1EA 4DRBA 3WTPC 3MNNB 1M18D 3WA9B 3KWQA 5GSUC 4WU9C 2NQBB 5CPKA 5BNVA 3R45A 4YM6D 4KHAB 3MNNC 3W97A 3WA9C 4Z66B 3AZMB 2NQBC 4H9PA 2PYOA 3AZJD 1P3OA 5AVBB 4KGCA 5B33B 4H9OA 3NQJA 1B6WA 4Z66C 3AZMC 1EQZB 4XZQB 1S32B 2HIOD 4JJNB 5AVBC 5B33C 3WTPD 3LZ1B 5AVCA 1EQZC 4WU9D 4XZQC 5B0ZA 1KX5B 5AY8B 1P3AA 5CP6B 1S32C 4JJNC 1JFIB 4LD9B 4HGAB 3AZEA 3LZ1C 3MNND 1P3GA 3MGRA 3MVDA 2NQBD 1KX5C 5AY8C 1HTAA 5CP6C 4LD9C 4HGAC 5GT0B 4WU8A 5B40A 4Z66D 3LZ0A 3AZMD 1P3PB 4Z2MG 1ID3A 1Z2CB 3AZIB 5GT0C 5AVBD 3REIA 5B33D 3W99B 3W96B 4G92B 3AN2B 1W2EA 1P3PC 4XZQD 5GT3A 5B1LB 5AV9A 2XD1A 1EQZD 3UT9A 1S32D 4JJND 3AZIC 3W99C 3W96C 1U35A 5DNNB 3LZ1D 4G92C 3AN2C 5B1LC 1KX5D 5DNMB 1KU5A 4LD9D 5DNNC 1P3FD 5B31B 5DNMC 2FJ7D 4YM6A 5GT0D 4M6BA 3MGSB 5BO0B 1P3BA 5B2JB 4KUDB 2RVQC 1P3PD 1BH8A 3X1UB 3MGQB 5B31C 3KUYA 3AZID 3W99D 2DQNC 3MGSC 3W96D 5B2JC 4KUDC 4WNNA 3REJA 4G91B 3AN2D 3X1UC 3AYWA 5B1LD 3AV1B 3MGQC 2HIOA 3VH5T 1A7WA 2CV5A 3LJAB 4G91C 3AV1C 4NFTA 1B67A 5DNMD 3X1TB 3LJAC 2BYKB 2RVQD 5B31D 3X1VB 3X1TC 4KHAA 5CPID 3MGSD 3TU4B 4NE6A 5B2JD 4KUDD 3VH6W 4Z5TB 1TZYB 5F99B 3MGQD 3REKB 3B0BA 3X1VC 2ZY3A 1ZLAA 3TU4C 3AZNB 1EQZA 4XZQA 5B0YB 2Y2LA 4Z5TC 1TZYC 4X23B 5F99C 3AV1D 3REKC 4E44A 1S32A 3LJAD 3AZNC 5B0YC 3AZFA 4X23C 4LD9A 3X1TD 4H9NB 3VH5A 5GXQB 1P3FA 2F8NB 2XD5A 2AROA 2FJ7A 3AZGB 4H9SC 5GT0A 4H9RA 1BFMA 3TU4D 5GXQC 1P3PA 2CWEA 4Z5TD 5JRGB 1TZYD 5F99D 3REKD 3AZGC 3W99A 3W96A 3O62B 3C1CB 3NQUA 3RELB 3AZND 3AN2A 3B6FB 1KX4B 5JRGC 4X23D 4ZBJB 5B1MB 4J8XB 3O62C 3C1CC 3RELC 3H0LC 3MGPB 3B6FC 1PZRA 5KDMA 4CSRA 1KX4C 3X1SA 4ZBJC 3REHB 2Y2KA 5DNMA 4YS3A 5B1MC 4J8XC 2HUEB 2F8NG 2NZDB 2Y2NA 3MGPC 5AV8B 4J8VB 3WKJD 3AFAB 2F8ND 4R8PB 1P34B 5FUGA 3REHC 3KFUG 2YFWA 2IO5B 3C1BB 3AZGD 5CPIA 2HUEC 3MGSA 2NZDC 5B2JA 5B32B 5AV8C 4J8VC 3AFAC 4R8PC 1P34C 5JRGD 3MGQA 2IO5C 3C1BC 3O62D 2YFVB 3C1CD 3RELD 5B32C 3AZHB 3B6FD 5BS7C 1KX4D
chains in the Genus database with same CATH topology
5B1MD 4CAYB 3LJAA 4J8XD 3H0RC 5JA4B 3AZHC 4J8UB 3MGPD 2Y2GA 5GSUD 3A6NB 3X1TA 3WAAA 1BH9B 4J8UC 5AV8D 4J8VD 3WA9D 3AFAD 4XUJB 3A6NC 4R8PD 3IP4C 1P3LA 5B32G 3C1BD 3TU4A 5B32D 1TAFA 4Z2MH 5G49B 4WV4B 4XUJC 5F99A 3REKA 1M1AA 5E5AB 3AZHD 3AZNA 4H9QB 2VQRA 5E5AC 2F8NK 4J8UD 2ZY5A 3A6ND 5AY8D 5CP6D 1M18A 3WKJA 2F8NA 1HQ3B 4XUJD 4NE3A 1M19B 3AZGA 3UTBB 3A1IA 2LY8A 1N1JB 3V9RA 1HQ3C 3AZKB 5JRGA 5BNXB 1H3OB 1M19C 3AZJA 3RELA 3C1CA 2W8SA 5E5AD 3UTBC 3B6FA 3AZKC 1KX4A 4UPKA 5B1MA 1P3MB 3WTPA 5DNND 3UTAB 4ZUXB 5BT1C 5GSUA 4WU9A 1P3MC 4WZSB 3KXBB 3MNNA 2Y2MA 5AV8A 4J8VA 3UTAC 3WA9A 3R45B 4ZUXC 5B31G 3AFAA 1HQ3D 2NQBA 3W97B 1M19D 3KXBC 5B32A 3UTBD 4Z66A 2Y2PA 3AZMA 1WWSA 3VH6T 3AZKD 3NQJB 3X1UD 3EPHA 3W97C 5CHLB 5AVBA 5B33A 2ZY4A 3W98B 5BT1D 4JJNA 5C3IB 5JA4A 1WWIA 3LZ1A 2J8PA 4AWLB 3W98C 1P3AB 3UTAD 1AOIB 4ZUXD 3AZEB 1KX5A 5AY8A 1P3GB 5CP6A 1JFIA 1BH9A 5C3IC 3KXBD 1R4VA 4AWLC 1P3AC 1AOIC 2JE5A 4WU8B 3B0CW 3AZEC 1P3GC 3LZ0B 3X1VD 1ID3B 4WU8C 3REIB 3LZ0C 3AZIA 5GT3B 5AV9B 3UT9B 3W98D 1ID3C 1P3KB 2UWXA 5AV5B 5B0YD 3REIC 5B1LA 1Q9CA 2L5AA 3VH6A 4H9QA 5GT3C 5AV9C 5DNNA 3UT9C 1P3KC 5AV5C 1AOID 5AV6B 3AZED 4DRAA 3P5JB 1P3GD 2F8NH 2F2AC 4NE5A 5GXQD 1HQ3A 2Y2IA 5AV6C 2G5HC 4YM6B 4WU8D 1P3BB 1M19A 1F66B 3EPLA 5B31A 2JCHA 1BH8B 3UTBA 5BO0A 3KUYB 4KUDA 1N1JA 1ID3D 4YM6C 2Y2JA 5BNXA 3X1UA 3REID 1P3BC 1F66C 2BYMB 4WNNB 3REJB 3AYWB 5AV9D 4EO5B 3KUYC 2HIOB 1P3KD 5AV5D 3FDDA 2CV5B 3AV1A 3REJC 3AYWC 4EO5C 3UTAA 2HIOC 4ZUXA 5AV6D 2CV5C 3WTPE 3REHD 3KXBA 3B6GB 2BYKA 2NZDD 2BG1A 3B0DB 1F66D 1P3BD 1P34D 2Y2QA 3X1VA 3B6GC 3KUYD 4Z5TA 3B0DC 1TZYA 1ZLAB 3REJD 3AYWD 3W98A 5B0YA 4QLCB 4UUZB 2CV5D 1KX3B 4X23A 1ZLAC 2Y2HA 3AZFB 1ULYA 1P3IB 1AOIA 4QLCC 1KX3C 4H9SA 3LELB 1P3FB 4DQYB 3AZFC 3AV2B 2AROB 4J8WB 3B6GD 4H9NA 2FJ7B 5GXQA 5B24B 1P3IC 4H9RB 3LELC 1P3FC 3AV2C 2AROC 4J8WC 2FJ7C 5B24C 3NQUB 1ZLAD 3O62A 4E45A 3AZLB 1P3KA 5AV5A 3AL0C 1T3UA 4QLCD 1KX3D 5B2IB 5KDMB 5CPJB 4CSRB 4J8XA 3AZFD 3X1SB 3MGPA 3AZLC 4YS3B 5AV6A 1P3ID 5B2IC 2JSSA 4WJ3C 3REHA 5CPJC 3LELD 3KWQB 3AV2D 2NZDA 2AROD 3H0MC 5FUGB 4J8WD 4YS3C 5BNVB 3X1SC 2YFWB 3F6TA 5B24D 5CPIB 5CPKB 1F66A 4R8PA 1P34A 2ZY2A 3C1BA 3KWQC 5CPKC 4H9PB 2PYOB 5CPIC 5BS7A 1P3OB 4KGCB 4H9OB 2BYMA 2YFVA 2Y2OA 3AZHA 2PYOC 3VH5W 3AZLD 1P3OC 4KGCC 2G5IC 5B2ID 5AVCB 4CAYA 5CPJD 1P3MD 5B0ZB 4J8UA 3X1SD 4YS3D 3WAAB 3A6NA 5AVCC 3B6GA 3EG5B 3KWQD 3MVDB 5B0ZC 3MGRB 5CPKD 3KSYA 1P3LB 3WAAC 4XUJA 3B0CT 5B40B 3W97D 1TAFB 3MGRC 3MVDC 2PYOD 1P3LC 5G49A 1M1AB 1P3OD 4KGCD 2DF4C 5B40C 2ZM5A 5E5AA 4QLCA 4UUZA 1M1AC 1KX3A 1U35B 5AVCD 5B0ZD 1P3IA 1P3AD 3WAAD 2FFFB 1U35C 1M18B 3WKJB 3LELA 3AV2A 4J8WA 3MGRD 3MVDD 5B24A 1P3LD 3EPJA 3EPKA 1M18C 3WKJC 5B40D 3V9RB 3LZ0D 3AZJB 3AZKA 1M1AD 1H3OA 5GT3D 2RIQA 3AZLA 3UT9D 3AZJC 3WTPB 1U35D 5B2IA 3A1KA 5CPJA 4WU9B 5GSUB 1P3MA 1F1EA 4DRBA 3WTPC 3MNNB 1M18D 3WA9B 3KWQA 5GSUC 4WU9C 2NQBB 5CPKA 5BNVA 3R45A 4YM6D 4KHAB 3MNNC 3W97A 3WA9C 4Z66B 3AZMB 2NQBC 4H9PA 2PYOA 3AZJD 1P3OA 5AVBB 4KGCA 5B33B 4H9OA 3NQJA 1B6WA 4Z66C 3AZMC 1EQZB 4XZQB 1S32B 2HIOD 4JJNB 5AVBC 5B33C 3WTPD 3LZ1B 5AVCA 1EQZC 4WU9D 4XZQC 5B0ZA 1KX5B 5AY8B 1P3AA 5CP6B 1S32C 4JJNC 1JFIB 4LD9B 4HGAB 3AZEA 3LZ1C 3MNND 1P3GA 3MGRA 3MVDA 2NQBD 1KX5C 5AY8C 1HTAA 5CP6C 4LD9C 4HGAC 5GT0B 4WU8A 5B40A 4Z66D 3LZ0A 3AZMD 1P3PB 4Z2MG 1ID3A 1Z2CB 3AZIB 5GT0C 5AVBD 3REIA 5B33D 3W99B 3W96B 4G92B 3AN2B 1W2EA 1P3PC 4XZQD 5GT3A 5B1LB 5AV9A 2XD1A 1EQZD 3UT9A 1S32D 4JJND 3AZIC 3W99C 3W96C 1U35A 5DNNB 3LZ1D 4G92C 3AN2C 5B1LC 1KX5D 5DNMB 1KU5A 4LD9D 5DNNC 1P3FD 5B31B 5DNMC 2FJ7D 4YM6A 5GT0D 4M6BA 3MGSB 5BO0B 1P3BA 5B2JB 4KUDB 2RVQC 1P3PD 1BH8A 3X1UB 3MGQB 5B31C 3KUYA 3AZID 3W99D 2DQNC 3MGSC 3W96D 5B2JC 4KUDC 4WNNA 3REJA 4G91B 3AN2D 3X1UC 3AYWA 5B1LD 3AV1B 3MGQC 2HIOA 3VH5T 1A7WA 2CV5A 3LJAB 4G91C 3AV1C 4NFTA 1B67A 5DNMD 3X1TB 3LJAC 2BYKB 2RVQD 5B31D 3X1VB 3X1TC 4KHAA 5CPID 3MGSD 3TU4B 4NE6A 5B2JD 4KUDD 3VH6W 4Z5TB 1TZYB 5F99B 3MGQD 3REKB 3B0BA 3X1VC 2ZY3A 1ZLAA 3TU4C 3AZNB 1EQZA 4XZQA 5B0YB 2Y2LA 4Z5TC 1TZYC 4X23B 5F99C 3AV1D 3REKC 4E44A 1S32A 3LJAD 3AZNC 5B0YC 3AZFA 4X23C 4LD9A 3X1TD 4H9NB 3VH5A 5GXQB 1P3FA 2F8NB 2XD5A 2AROA 2FJ7A 3AZGB 4H9SC 5GT0A 4H9RA 1BFMA 3TU4D 5GXQC 1P3PA 2CWEA 4Z5TD 5JRGB 1TZYD 5F99D 3REKD 3AZGC 3W99A 3W96A 3O62B 3C1CB 3NQUA 3RELB 3AZND 3AN2A 3B6FB 1KX4B 5JRGC 4X23D 4ZBJB 5B1MB 4J8XB 3O62C 3C1CC 3RELC 3H0LC 3MGPB 3B6FC 1PZRA 5KDMA 4CSRA 1KX4C 3X1SA 4ZBJC 3REHB 2Y2KA 5DNMA 4YS3A 5B1MC 4J8XC 2HUEB 2F8NG 2NZDB 2Y2NA 3MGPC 5AV8B 4J8VB 3WKJD 3AFAB 2F8ND 4R8PB 1P34B 5FUGA 3REHC 3KFUG 2YFWA 2IO5B 3C1BB 3AZGD 5CPIA 2HUEC 3MGSA 2NZDC 5B2JA 5B32B 5AV8C 4J8VC 3AFAC 4R8PC 1P34C 5JRGD 3MGQA 2IO5C 3C1BC 3O62D 2YFVB 3C1CD 3RELD 5B32C 3AZHB 3B6FD 5BS7C 1KX4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M D;  4CAY B;  3LJA A;  4J8X D;  5JA4 B;  3AZH C;  4J8U B;  3MGP D;  5GSU D;  3A6N B;  3X1T A;  3WAA A;  1BH9 B;  4J8U C;  5AV8 D;  4J8V D;  3WA9 D;  3AFA D;  4XUJ B;  3A6N C;  4R8P D;  1P3L A;  5B32 G;  3C1B D;  3TU4 A;  5B32 D;  1TAF A;  4Z2M H;  5G49 B;  4WV4 B;  4XUJ C;  5F99 A;  3REK A;  1M1A A;  5E5A B;  3AZH D;  3AZN A;  4H9Q B;  5E5A C;  2F8N K;  4J8U D;  3A6N D;  5AY8 D;  5CP6 D;  1M18 A;  3WKJ A;  2F8N A;  1HQ3 B;  4XUJ D;  4NE3 A;  1M19 B;  3AZG A;  3UTB B;  2LY8 A;  1N1J B;  3V9R A;  1HQ3 C;  3AZK B;  5JRG A;  5BNX B;  1H3O B;  1M19 C;  3AZJ A;  3REL A;  3C1C A;  5E5A D;  3UTB C;  3B6F A;  3AZK C;  1KX4 A;  5B1M A;  1P3M B;  3WTP A;  5DNN D;  3UTA B;  4ZUX B;  5BT1 C;  5GSU A;  4WU9 A;  1P3M C;  4WZS B;  3KXB B;  3MNN A;  5AV8 A;  4J8V A;  3UTA C;  3WA9 A;  3R45 B;  4ZUX C;  5B31 G;  3AFA A;  1HQ3 D;  2NQB A;  3W97 B;  1M19 D;  3KXB C;  5B32 A;  3UTB D;  4Z66 A;  3AZM A;  1WWS A;  3VH6 T;  3AZK D;  3NQJ B;  3X1U D;  3W97 C;  5CHL B;  5AVB A;  5B33 A;  3W98 B;  5BT1 D;  4JJN A;  5C3I B;  5JA4 A;  1WWI A;  3LZ1 A;  4AWL B;  3W98 C;  1P3A B;  3UTA D;  1AOI B;  4ZUX D;  3AZE B;  1KX5 A;  5AY8 A;  1P3G B;  5CP6 A;  1JFI A;  1BH9 A;  5C3I C;  3KXB D;  1R4V A;  4AWL C;  1P3A C;  1AOI C;  4WU8 B;  3B0C W;  3AZE C;  1P3G C;  3LZ0 B;  3X1V D;  1ID3 B;  4WU8 C;  3REI B;  3LZ0 C;  3AZI A;  5GT3 B;  5AV9 B;  3UT9 B;  3W98 D;  1ID3 C;  1P3K B;  5AV5 B;  5B0Y D;  3REI C;  5B1L A;  1Q9C A;  2L5A A;  3VH6 A;  4H9Q A;  5GT3 C;  5AV9 C;  5DNN A;  3UT9 C;  1P3K C;  5AV5 C;  1AOI D;  5AV6 B;  3AZE D;  4DRA A;  1P3G D;  2F8N H;  4NE5 A;  5GXQ D;  1HQ3 A;  5AV6 C;  4YM6 B;  4WU8 D;  1F66 B;  1P3B B;  1M19 A;  5B31 A;  1BH8 B;  3UTB A;  5BO0 A;  3KUY B;  4KUD A;  1N1J A;  1ID3 D;  4YM6 C;  1F66 C;  5BNX A;  3X1U A;  3REI D;  1P3B C;  2BYM B;  4WNN B;  3REJ B;  3AYW B;  5AV9 D;  4EO5 B;  3KUY C;  2HIO B;  1P3K D;  5AV5 D;  2CV5 B;  3AV1 A;  3REJ C;  3AYW C;  4EO5 C;  3UTA A;  2HIO C;  4ZUX A;  5AV6 D;  2CV5 C;  3WTP E;  3REH D;  3KXB A;  3B6G B;  2BYK A;  2NZD D;  3B0D B;  1F66 D;  1P3B D;  1P34 D;  3X1V A;  3B6G C;  3KUY D;  4Z5T A;  3B0D C;  1TZY A;  1ZLA B;  3REJ D;  3AYW D;  3W98 A;  5B0Y A;  4QLC B;  4UUZ B;  2CV5 D;  1KX3 B;  4X23 A;  1ZLA C;  3AZF B;  1ULY A;  1P3I B;  1AOI A;  4QLC C;  1KX3 C;  4H9S A;  3LEL B;  1P3F B;  3AZF C;  3AV2 B;  3B6G D;  2ARO B;  4J8W B;  4H9N A;  2FJ7 B;  5GXQ A;  5B24 B;  1P3I C;  4H9R B;  3LEL C;  1P3F C;  3AV2 C;  2ARO C;  4J8W C;  2FJ7 C;  5B24 C;  3NQU B;  1ZLA D;  3O62 A;  4E45 A;  3AZL B;  1P3K A;  5AV5 A;  4QLC D;  1KX3 D;  5B2I B;  5KDM B;  5CPJ B;  4CSR B;  4J8X A;  3AZF D;  3X1S B;  3MGP A;  3AZL C;  4YS3 B;  5AV6 A;  1P3I D;  5B2I C;  2JSS A;  3REH A;  5CPJ C;  3LEL D;  3KWQ B;  3AV2 D;  2NZD A;  2ARO D;  4J8W D;  5FUG B;  3X1S C;  4YS3 C;  5BNV B;  5CPK B;  2YFW B;  5B24 D;  5CPI B;  1F66 A;  4R8P A;  1P34 A;  3C1B A;  3KWQ C;  5CPK C;  4H9P B;  2PYO B;  5CPI C;  5BS7 A;  1P3O B;  4KGC B;  4H9O B;  2BYM A;  2YFV A;  3AZH A;  2PYO C;  3VH5 W;  3AZL D;  1P3O C;  4KGC C;  5B2I D;  5AVC B;  4CAY A;  5CPJ D;  1P3M D;  5B0Z B;  4J8U A;  3X1S D;  4YS3 D;  3WAA B;  3A6N A;  5AVC C;  3B6G A;  3KWQ D;  3MGR B;  3MVD B;  5B0Z C;  5CPK D;  3KSY A;  1P3L B;  3WAA C;  4XUJ A;  3B0C T;  5B40 B;  3W97 D;  1TAF B;  3MGR C;  3MVD C;  2PYO D;  1P3L C;  5G49 A;  1M1A B;  1P3O D;  4KGC D;  5B40 C;  5E5A A;  4QLC A;  4UUZ A;  1M1A C;  1KX3 A;  1U35 B;  5AVC D;  5B0Z D;  1P3I A;  1P3A D;  3WAA D;  1U35 C;  1M18 B;  3WKJ B;  3LEL A;  3AV2 A;  4J8W A;  3MGR D;  3MVD D;  5B24 A;  1P3L D;  1M18 C;  3WKJ C;  5B40 D;  3V9R B;  3LZ0 D;  3AZJ B;  3AZK A;  1M1A D;  1H3O A;  5GT3 D;  3AZL A;  3UT9 D;  3AZJ C;  3WTP B;  1U35 D;  5B2I A;  5CPJ A;  4WU9 B;  5GSU B;  1P3M A;  1F1E A;  4DRB A;  3WTP C;  3MNN B;  1M18 D;  3WA9 B;  3KWQ A;  5GSU C;  4WU9 C;  2NQB B;  5CPK A;  5BNV A;  3R45 A;  4YM6 D;  4KHA B;  3MNN C;  3W97 A;  3WA9 C;  4Z66 B;  3AZM B;  2NQB C;  4H9P A;  2PYO A;  3AZJ D;  1P3O A;  5AVB B;  4KGC A;  5B33 B;  4H9O A;  3NQJ A;  1B6W A;  4Z66 C;  3AZM C;  1EQZ B;  4XZQ B;  1S32 B;  2HIO D;  4JJN B;  5AVB C;  5B33 C;  3WTP D;  3LZ1 B;  5AVC A;  1EQZ C;  4WU9 D;  4XZQ C;  5B0Z A;  1KX5 B;  5AY8 B;  1P3A A;  5CP6 B;  1S32 C;  4JJN C;  1JFI B;  4LD9 B;  4HGA B;  3AZE A;  3LZ1 C;  3MNN D;  1P3G A;  3MGR A;  3MVD A;  2NQB D;  1KX5 C;  5AY8 C;  1HTA A;  5CP6 C;  4LD9 C;  4HGA C;  5GT0 B;  4WU8 A;  5B40 A;  4Z66 D;  3LZ0 A;  3AZM D;  1P3P B;  4Z2M G;  1ID3 A;  3AZI B;  5GT0 C;  5AVB D;  3REI A;  5B33 D;  3W99 B;  3W96 B;  4G92 B;  3AN2 B;  1EQZ D;  1P3P C;  4XZQ D;  5GT3 A;  5B1L B;  5AV9 A;  3UT9 A;  1S32 D;  4JJN D;  3AZI C;  3W99 C;  3W96 C;  1U35 A;  5DNN B;  3LZ1 D;  4G92 C;  3AN2 C;  5B1L C;  1KX5 D;  5DNM B;  1KU5 A;  4LD9 D;  5DNN C;  1P3F D;  5B31 B;  5DNM C;  2FJ7 D;  4YM6 A;  5GT0 D;  4M6B A;  3MGS B;  5BO0 B;  1P3B A;  5B2J B;  4KUD B;  2RVQ C;  1P3P D;  1BH8 A;  3X1U B;  3MGQ B;  5B31 C;  3KUY A;  3AZI D;  3W99 D;  3W96 D;  3MGS C;  5B2J C;  4KUD C;  4WNN A;  3REJ A;  4G91 B;  3AN2 D;  3X1U C;  3AYW A;  5B1L D;  3AV1 B;  3MGQ C;  2HIO A;  3VH5 T;  1A7W A;  2CV5 A;  3LJA B;  4G91 C;  3AV1 C;  4NFT A;  1B67 A;  5DNM D;  3X1T B;  3LJA C;  2BYK B;  2RVQ D;  5B31 D;  3X1V B;  3X1T C;  4KHA A;  5CPI D;  3MGS D;  3TU4 B;  4NE6 A;  5B2J D;  4KUD D;  3VH6 W;  4Z5T B;  1TZY B;  5F99 B;  3MGQ D;  3REK B;  3B0B A;  3X1V C;  1ZLA A;  3TU4 C;  3AZN B;  1EQZ A;  4XZQ A;  5B0Y B;  4Z5T C;  1TZY C;  4X23 B;  5F99 C;  3AV1 D;  3REK C;  4E44 A;  1S32 A;  3LJA D;  3AZN C;  5B0Y C;  3AZF A;  4X23 C;  4LD9 A;  3X1T D;  4H9N B;  3VH5 A;  5GXQ B;  1P3F A;  2F8N B;  2ARO A;  2FJ7 A;  3AZG B;  4H9S C;  5GT0 A;  4H9R A;  1BFM A;  3TU4 D;  5GXQ C;  1P3P A;  2CWE A;  4Z5T D;  5JRG B;  1TZY D;  5F99 D;  3REK D;  3AZG C;  3W99 A;  3W96 A;  3O62 B;  3C1C B;  3NQU A;  3REL B;  3AZN D;  3AN2 A;  3B6F B;  1KX4 B;  5JRG C;  4X23 D;  4ZBJ B;  5B1M B;  4J8X B;  3O62 C;  3C1C C;  3REL C;  3MGP B;  3B6F C;  5KDM A;  4CSR A;  1KX4 C;  3X1S A;  4ZBJ C;  3REH B;  5DNM A;  4YS3 A;  5B1M C;  4J8X C;  2HUE B;  2F8N G;  2NZD B;  3MGP C;  5AV8 B;  4J8V B;  3WKJ D;  3AFA B;  2F8N D;  4R8P B;  1P34 B;  5FUG A;  3REH C;  2YFW A;  2IO5 B;  3C1B B;  3AZG D;  5CPI A;  2HUE C;  3MGS A;  2NZD C;  5B2J A;  5B32 B;  5AV8 C;  4J8V C;  3AFA C;  4R8P C;  1P34 C;  5JRG D;  3MGQ A;  2IO5 C;  3C1B C;  3O62 D;  2YFV B;  3C1C D;  3REL D;  5B32 C;  3AZH B;  3B6F D;  5BS7 C;  1KX4 D; 
#chains in the Genus database with same CATH topology
 5B1M D;  4CAY B;  3LJA A;  4J8X D;  3H0R C;  5JA4 B;  3AZH C;  4J8U B;  3MGP D;  2Y2G A;  5GSU D;  3A6N B;  3X1T A;  3WAA A;  1BH9 B;  4J8U C;  5AV8 D;  4J8V D;  3WA9 D;  3AFA D;  4XUJ B;  3A6N C;  4R8P D;  3IP4 C;  1P3L A;  5B32 G;  3C1B D;  3TU4 A;  5B32 D;  1TAF A;  4Z2M H;  5G49 B;  4WV4 B;  4XUJ C;  5F99 A;  3REK A;  1M1A A;  5E5A B;  3AZH D;  3AZN A;  4H9Q B;  2VQR A;  5E5A C;  2F8N K;  4J8U D;  2ZY5 A;  3A6N D;  5AY8 D;  5CP6 D;  1M18 A;  3WKJ A;  2F8N A;  1HQ3 B;  4XUJ D;  4NE3 A;  1M19 B;  3AZG A;  3UTB B;  3A1I A;  2LY8 A;  1N1J B;  3V9R A;  1HQ3 C;  3AZK B;  5JRG A;  5BNX B;  1H3O B;  1M19 C;  3AZJ A;  3REL A;  3C1C A;  2W8S A;  5E5A D;  3UTB C;  3B6F A;  3AZK C;  1KX4 A;  4UPK A;  5B1M A;  1P3M B;  3WTP A;  5DNN D;  3UTA B;  4ZUX B;  5BT1 C;  5GSU A;  4WU9 A;  1P3M C;  4WZS B;  3KXB B;  3MNN A;  2Y2M A;  5AV8 A;  4J8V A;  3UTA C;  3WA9 A;  3R45 B;  4ZUX C;  5B31 G;  3AFA A;  1HQ3 D;  2NQB A;  3W97 B;  1M19 D;  3KXB C;  5B32 A;  3UTB D;  4Z66 A;  2Y2P A;  3AZM A;  1WWS A;  3VH6 T;  3AZK D;  3NQJ B;  3X1U D;  3EPH A;  3W97 C;  5CHL B;  5AVB A;  5B33 A;  2ZY4 A;  3W98 B;  5BT1 D;  4JJN A;  5C3I B;  5JA4 A;  1WWI A;  3LZ1 A;  2J8P A;  4AWL B;  3W98 C;  1P3A B;  3UTA D;  1AOI B;  4ZUX D;  3AZE B;  1KX5 A;  5AY8 A;  1P3G B;  5CP6 A;  1JFI A;  1BH9 A;  5C3I C;  3KXB D;  1R4V A;  4AWL C;  1P3A C;  1AOI C;  2JE5 A;  4WU8 B;  3B0C W;  3AZE C;  1P3G C;  3LZ0 B;  3X1V D;  1ID3 B;  4WU8 C;  3REI B;  3LZ0 C;  3AZI A;  5GT3 B;  5AV9 B;  3UT9 B;  3W98 D;  1ID3 C;  1P3K B;  2UWX A;  5AV5 B;  5B0Y D;  3REI C;  5B1L A;  1Q9C A;  2L5A A;  3VH6 A;  4H9Q A;  5GT3 C;  5AV9 C;  5DNN A;  3UT9 C;  1P3K C;  5AV5 C;  1AOI D;  5AV6 B;  3AZE D;  4DRA A;  3P5J B;  1P3G D;  2F8N H;  2F2A C;  4NE5 A;  5GXQ D;  1HQ3 A;  2Y2I A;  5AV6 C;  2G5H C;  4YM6 B;  4WU8 D;  1P3B B;  1M19 A;  1F66 B;  3EPL A;  5B31 A;  2JCH A;  1BH8 B;  3UTB A;  5BO0 A;  3KUY B;  4KUD A;  1N1J A;  1ID3 D;  4YM6 C;  2Y2J A;  5BNX A;  3X1U A;  3REI D;  1P3B C;  1F66 C;  2BYM B;  4WNN B;  3REJ B;  3AYW B;  5AV9 D;  4EO5 B;  3KUY C;  2HIO B;  1P3K D;  5AV5 D;  3FDD A;  2CV5 B;  3AV1 A;  3REJ C;  3AYW C;  4EO5 C;  3UTA A;  2HIO C;  4ZUX A;  5AV6 D;  2CV5 C;  3WTP E;  3REH D;  3KXB A;  3B6G B;  2BYK A;  2NZD D;  2BG1 A;  3B0D B;  1F66 D;  1P3B D;  1P34 D;  2Y2Q A;  3X1V A;  3B6G C;  3KUY D;  4Z5T A;  3B0D C;  1TZY A;  1ZLA B;  3REJ D;  3AYW D;  3W98 A;  5B0Y A;  4QLC B;  4UUZ B;  2CV5 D;  1KX3 B;  4X23 A;  1ZLA C;  2Y2H A;  3AZF B;  1ULY A;  1P3I B;  1AOI A;  4QLC C;  1KX3 C;  4H9S A;  3LEL B;  1P3F B;  4DQY B;  3AZF C;  3AV2 B;  2ARO B;  4J8W B;  3B6G D;  4H9N A;  2FJ7 B;  5GXQ A;  5B24 B;  1P3I C;  4H9R B;  3LEL C;  1P3F C;  3AV2 C;  2ARO C;  4J8W C;  2FJ7 C;  5B24 C;  3NQU B;  1ZLA D;  3O62 A;  4E45 A;  3AZL B;  1P3K A;  5AV5 A;  3AL0 C;  1T3U A;  4QLC D;  1KX3 D;  5B2I B;  5KDM B;  5CPJ B;  4CSR B;  4J8X A;  3AZF D;  3X1S B;  3MGP A;  3AZL C;  4YS3 B;  5AV6 A;  1P3I D;  5B2I C;  2JSS A;  4WJ3 C;  3REH A;  5CPJ C;  3LEL D;  3KWQ B;  3AV2 D;  2NZD A;  2ARO D;  3H0M C;  5FUG B;  4J8W D;  4YS3 C;  5BNV B;  3X1S C;  2YFW B;  3F6T A;  5B24 D;  5CPI B;  5CPK B;  1F66 A;  4R8P A;  1P34 A;  2ZY2 A;  3C1B A;  3KWQ C;  5CPK C;  4H9P B;  2PYO B;  5CPI C;  5BS7 A;  1P3O B;  4KGC B;  4H9O B;  2BYM A;  2YFV A;  2Y2O A;  3AZH A;  2PYO C;  3VH5 W;  3AZL D;  1P3O C;  4KGC C;  2G5I C;  5B2I D;  5AVC B;  4CAY A;  5CPJ D;  1P3M D;  5B0Z B;  4J8U A;  3X1S D;  4YS3 D;  3WAA B;  3A6N A;  5AVC C;  3B6G A;  3EG5 B;  3KWQ D;  3MVD B;  5B0Z C;  3MGR B;  5CPK D;  3KSY A;  1P3L B;  3WAA C;  4XUJ A;  3B0C T;  5B40 B;  3W97 D;  1TAF B;  3MGR C;  3MVD C;  2PYO D;  1P3L C;  5G49 A;  1M1A B;  1P3O D;  4KGC D;  2DF4 C;  5B40 C;  2ZM5 A;  5E5A A;  4QLC A;  4UUZ A;  1M1A C;  1KX3 A;  1U35 B;  5AVC D;  5B0Z D;  1P3I A;  1P3A D;  3WAA D;  2FFF B;  1U35 C;  1M18 B;  3WKJ B;  3LEL A;  3AV2 A;  4J8W A;  3MGR D;  3MVD D;  5B24 A;  1P3L D;  3EPJ A;  3EPK A;  1M18 C;  3WKJ C;  5B40 D;  3V9R B;  3LZ0 D;  3AZJ B;  3AZK A;  1M1A D;  1H3O A;  5GT3 D;  2RIQ A;  3AZL A;  3UT9 D;  3AZJ C;  3WTP B;  1U35 D;  5B2I A;  3A1K A;  5CPJ A;  4WU9 B;  5GSU B;  1P3M A;  1F1E A;  4DRB A;  3WTP C;  3MNN B;  1M18 D;  3WA9 B;  3KWQ A;  5GSU C;  4WU9 C;  2NQB B;  5CPK A;  5BNV A;  3R45 A;  4YM6 D;  4KHA B;  3MNN C;  3W97 A;  3WA9 C;  4Z66 B;  3AZM B;  2NQB C;  4H9P A;  2PYO A;  3AZJ D;  1P3O A;  5AVB B;  4KGC A;  5B33 B;  4H9O A;  3NQJ A;  1B6W A;  4Z66 C;  3AZM C;  1EQZ B;  4XZQ B;  1S32 B;  2HIO D;  4JJN B;  5AVB C;  5B33 C;  3WTP D;  3LZ1 B;  5AVC A;  1EQZ C;  4WU9 D;  4XZQ C;  5B0Z A;  1KX5 B;  5AY8 B;  1P3A A;  5CP6 B;  1S32 C;  4JJN C;  1JFI B;  4LD9 B;  4HGA B;  3AZE A;  3LZ1 C;  3MNN D;  1P3G A;  3MGR A;  3MVD A;  2NQB D;  1KX5 C;  5AY8 C;  1HTA A;  5CP6 C;  4LD9 C;  4HGA C;  5GT0 B;  4WU8 A;  5B40 A;  4Z66 D;  3LZ0 A;  3AZM D;  1P3P B;  4Z2M G;  1ID3 A;  1Z2C B;  3AZI B;  5GT0 C;  5AVB D;  3REI A;  5B33 D;  3W99 B;  3W96 B;  4G92 B;  3AN2 B;  1W2E A;  1P3P C;  4XZQ D;  5GT3 A;  5B1L B;  5AV9 A;  2XD1 A;  1EQZ D;  3UT9 A;  1S32 D;  4JJN D;  3AZI C;  3W99 C;  3W96 C;  1U35 A;  5DNN B;  3LZ1 D;  4G92 C;  3AN2 C;  5B1L C;  1KX5 D;  5DNM B;  1KU5 A;  4LD9 D;  5DNN C;  1P3F D;  5B31 B;  5DNM C;  2FJ7 D;  4YM6 A;  5GT0 D;  4M6B A;  3MGS B;  5BO0 B;  1P3B A;  5B2J B;  4KUD B;  2RVQ C;  1P3P D;  1BH8 A;  3X1U B;  3MGQ B;  5B31 C;  3KUY A;  3AZI D;  3W99 D;  2DQN C;  3MGS C;  3W96 D;  5B2J C;  4KUD C;  4WNN A;  3REJ A;  4G91 B;  3AN2 D;  3X1U C;  3AYW A;  5B1L D;  3AV1 B;  3MGQ C;  2HIO A;  3VH5 T;  1A7W A;  2CV5 A;  3LJA B;  4G91 C;  3AV1 C;  4NFT A;  1B67 A;  5DNM D;  3X1T B;  3LJA C;  2BYK B;  2RVQ D;  5B31 D;  3X1V B;  3X1T C;  4KHA A;  5CPI D;  3MGS D;  3TU4 B;  4NE6 A;  5B2J D;  4KUD D;  3VH6 W;  4Z5T B;  1TZY B;  5F99 B;  3MGQ D;  3REK B;  3B0B A;  3X1V C;  2ZY3 A;  1ZLA A;  3TU4 C;  3AZN B;  1EQZ A;  4XZQ A;  5B0Y B;  2Y2L A;  4Z5T C;  1TZY C;  4X23 B;  5F99 C;  3AV1 D;  3REK C;  4E44 A;  1S32 A;  3LJA D;  3AZN C;  5B0Y C;  3AZF A;  4X23 C;  4LD9 A;  3X1T D;  4H9N B;  3VH5 A;  5GXQ B;  1P3F A;  2F8N B;  2XD5 A;  2ARO A;  2FJ7 A;  3AZG B;  4H9S C;  5GT0 A;  4H9R A;  1BFM A;  3TU4 D;  5GXQ C;  1P3P A;  2CWE A;  4Z5T D;  5JRG B;  1TZY D;  5F99 D;  3REK D;  3AZG C;  3W99 A;  3W96 A;  3O62 B;  3C1C B;  3NQU A;  3REL B;  3AZN D;  3AN2 A;  3B6F B;  1KX4 B;  5JRG C;  4X23 D;  4ZBJ B;  5B1M B;  4J8X B;  3O62 C;  3C1C C;  3REL C;  3H0L C;  3MGP B;  3B6F C;  1PZR A;  5KDM A;  4CSR A;  1KX4 C;  3X1S A;  4ZBJ C;  3REH B;  2Y2K A;  5DNM A;  4YS3 A;  5B1M C;  4J8X C;  2HUE B;  2F8N G;  2NZD B;  2Y2N A;  3MGP C;  5AV8 B;  4J8V B;  3WKJ D;  3AFA B;  2F8N D;  4R8P B;  1P34 B;  5FUG A;  3REH C;  3KFU G;  2YFW A;  2IO5 B;  3C1B B;  3AZG D;  5CPI A;  2HUE C;  3MGS A;  2NZD C;  5B2J A;  5B32 B;  5AV8 C;  4J8V C;  3AFA C;  4R8P C;  1P34 C;  5JRG D;  3MGQ A;  2IO5 C;  3C1B C;  3O62 D;  2YFV B;  3C1C D;  3REL D;  5B32 C;  3AZH B;  3B6F D;  5BS7 C;  1KX4 D; 
#chains in the Genus database with same CATH homology
 5B1M D;  4CAY B;  3LJA A;  4J8X D;  3H0R C;  5JA4 B;  3AZH C;  4J8U B;  3MGP D;  2Y2G A;  5GSU D;  3A6N B;  3X1T A;  3WAA A;  1BH9 B;  4J8U C;  5AV8 D;  4J8V D;  3WA9 D;  3AFA D;  4XUJ B;  3A6N C;  4R8P D;  3IP4 C;  1P3L A;  5B32 G;  3C1B D;  3TU4 A;  5B32 D;  1TAF A;  4Z2M H;  5G49 B;  4WV4 B;  4XUJ C;  5F99 A;  3REK A;  1M1A A;  5E5A B;  3AZH D;  3AZN A;  4H9Q B;  2VQR A;  5E5A C;  2F8N K;  4J8U D;  2ZY5 A;  3A6N D;  5AY8 D;  5CP6 D;  1M18 A;  3WKJ A;  2F8N A;  1HQ3 B;  4XUJ D;  4NE3 A;  1M19 B;  3AZG A;  3UTB B;  3A1I A;  2LY8 A;  1N1J B;  3V9R A;  1HQ3 C;  3AZK B;  5JRG A;  5BNX B;  1H3O B;  1M19 C;  3AZJ A;  3REL A;  3C1C A;  2W8S A;  5E5A D;  3UTB C;  3B6F A;  3AZK C;  1KX4 A;  4UPK A;  5B1M A;  1P3M B;  3WTP A;  5DNN D;  3UTA B;  4ZUX B;  5BT1 C;  5GSU A;  4WU9 A;  1P3M C;  4WZS B;  3KXB B;  3MNN A;  2Y2M A;  5AV8 A;  4J8V A;  3UTA C;  3WA9 A;  3R45 B;  4ZUX C;  5B31 G;  3AFA A;  1HQ3 D;  2NQB A;  3W97 B;  1M19 D;  3KXB C;  5B32 A;  3UTB D;  4Z66 A;  2Y2P A;  3AZM A;  1WWS A;  3VH6 T;  3AZK D;  3NQJ B;  3X1U D;  3EPH A;  3W97 C;  5CHL B;  5AVB A;  5B33 A;  2ZY4 A;  3W98 B;  5BT1 D;  4JJN A;  5C3I B;  5JA4 A;  1WWI A;  3LZ1 A;  2J8P A;  4AWL B;  3W98 C;  1P3A B;  3UTA D;  1AOI B;  4ZUX D;  3AZE B;  1KX5 A;  5AY8 A;  1P3G B;  5CP6 A;  1JFI A;  1BH9 A;  5C3I C;  3KXB D;  1R4V A;  4AWL C;  1P3A C;  1AOI C;  2JE5 A;  4WU8 B;  3B0C W;  3AZE C;  1P3G C;  3LZ0 B;  3X1V D;  1ID3 B;  4WU8 C;  3REI B;  3LZ0 C;  3AZI A;  5GT3 B;  5AV9 B;  3UT9 B;  3W98 D;  1ID3 C;  1P3K B;  2UWX A;  5AV5 B;  5B0Y D;  3REI C;  5B1L A;  1Q9C A;  2L5A A;  3VH6 A;  4H9Q A;  5GT3 C;  5AV9 C;  5DNN A;  3UT9 C;  1P3K C;  5AV5 C;  1AOI D;  5AV6 B;  3AZE D;  4DRA A;  3P5J B;  1P3G D;  2F8N H;  2F2A C;  4NE5 A;  5GXQ D;  1HQ3 A;  2Y2I A;  5AV6 C;  2G5H C;  4YM6 B;  4WU8 D;  1P3B B;  1M19 A;  1F66 B;  3EPL A;  5B31 A;  2JCH A;  1BH8 B;  3UTB A;  5BO0 A;  3KUY B;  4KUD A;  1N1J A;  1ID3 D;  4YM6 C;  2Y2J A;  5BNX A;  3X1U A;  3REI D;  1P3B C;  1F66 C;  2BYM B;  4WNN B;  3REJ B;  3AYW B;  5AV9 D;  4EO5 B;  3KUY C;  2HIO B;  1P3K D;  5AV5 D;  3FDD A;  2CV5 B;  3AV1 A;  3REJ C;  3AYW C;  4EO5 C;  3UTA A;  2HIO C;  4ZUX A;  5AV6 D;  2CV5 C;  3WTP E;  3REH D;  3KXB A;  3B6G B;  2BYK A;  2NZD D;  2BG1 A;  3B0D B;  1F66 D;  1P3B D;  1P34 D;  2Y2Q A;  3X1V A;  3B6G C;  3KUY D;  4Z5T A;  3B0D C;  1TZY A;  1ZLA B;  3REJ D;  3AYW D;  3W98 A;  5B0Y A;  4QLC B;  4UUZ B;  2CV5 D;  1KX3 B;  4X23 A;  1ZLA C;  2Y2H A;  3AZF B;  1ULY A;  1P3I B;  1AOI A;  4QLC C;  1KX3 C;  4H9S A;  3LEL B;  1P3F B;  4DQY B;  3AZF C;  3AV2 B;  2ARO B;  4J8W B;  3B6G D;  4H9N A;  2FJ7 B;  5GXQ A;  5B24 B;  1P3I C;  4H9R B;  3LEL C;  1P3F C;  3AV2 C;  2ARO C;  4J8W C;  2FJ7 C;  5B24 C;  3NQU B;  1ZLA D;  3O62 A;  4E45 A;  3AZL B;  1P3K A;  5AV5 A;  3AL0 C;  1T3U A;  4QLC D;  1KX3 D;  5B2I B;  5KDM B;  5CPJ B;  4CSR B;  4J8X A;  3AZF D;  3X1S B;  3MGP A;  3AZL C;  4YS3 B;  5AV6 A;  1P3I D;  5B2I C;  2JSS A;  4WJ3 C;  3REH A;  5CPJ C;  3LEL D;  3KWQ B;  3AV2 D;  2NZD A;  2ARO D;  3H0M C;  5FUG B;  4J8W D;  4YS3 C;  5BNV B;  3X1S C;  2YFW B;  3F6T A;  5B24 D;  5CPI B;  5CPK B;  1F66 A;  4R8P A;  1P34 A;  2ZY2 A;  3C1B A;  3KWQ C;  5CPK C;  4H9P B;  2PYO B;  5CPI C;  5BS7 A;  1P3O B;  4KGC B;  4H9O B;  2BYM A;  2YFV A;  2Y2O A;  3AZH A;  2PYO C;  3VH5 W;  3AZL D;  1P3O C;  4KGC C;  2G5I C;  5B2I D;  5AVC B;  4CAY A;  5CPJ D;  1P3M D;  5B0Z B;  4J8U A;  3X1S D;  4YS3 D;  3WAA B;  3A6N A;  5AVC C;  3B6G A;  3EG5 B;  3KWQ D;  3MVD B;  5B0Z C;  3MGR B;  5CPK D;  3KSY A;  1P3L B;  3WAA C;  4XUJ A;  3B0C T;  5B40 B;  3W97 D;  1TAF B;  3MGR C;  3MVD C;  2PYO D;  1P3L C;  5G49 A;  1M1A B;  1P3O D;  4KGC D;  2DF4 C;  5B40 C;  2ZM5 A;  5E5A A;  4QLC A;  4UUZ A;  1M1A C;  1KX3 A;  1U35 B;  5AVC D;  5B0Z D;  1P3I A;  1P3A D;  3WAA D;  2FFF B;  1U35 C;  1M18 B;  3WKJ B;  3LEL A;  3AV2 A;  4J8W A;  3MGR D;  3MVD D;  5B24 A;  1P3L D;  3EPJ A;  3EPK A;  1M18 C;  3WKJ C;  5B40 D;  3V9R B;  3LZ0 D;  3AZJ B;  3AZK A;  1M1A D;  1H3O A;  5GT3 D;  2RIQ A;  3AZL A;  3UT9 D;  3AZJ C;  3WTP B;  1U35 D;  5B2I A;  3A1K A;  5CPJ A;  4WU9 B;  5GSU B;  1P3M A;  1F1E A;  4DRB A;  3WTP C;  3MNN B;  1M18 D;  3WA9 B;  3KWQ A;  5GSU C;  4WU9 C;  2NQB B;  5CPK A;  5BNV A;  3R45 A;  4YM6 D;  4KHA B;  3MNN C;  3W97 A;  3WA9 C;  4Z66 B;  3AZM B;  2NQB C;  4H9P A;  2PYO A;  3AZJ D;  1P3O A;  5AVB B;  4KGC A;  5B33 B;  4H9O A;  3NQJ A;  1B6W A;  4Z66 C;  3AZM C;  1EQZ B;  4XZQ B;  1S32 B;  2HIO D;  4JJN B;  5AVB C;  5B33 C;  3WTP D;  3LZ1 B;  5AVC A;  1EQZ C;  4WU9 D;  4XZQ C;  5B0Z A;  1KX5 B;  5AY8 B;  1P3A A;  5CP6 B;  1S32 C;  4JJN C;  1JFI B;  4LD9 B;  4HGA B;  3AZE A;  3LZ1 C;  3MNN D;  1P3G A;  3MGR A;  3MVD A;  2NQB D;  1KX5 C;  5AY8 C;  1HTA A;  5CP6 C;  4LD9 C;  4HGA C;  5GT0 B;  4WU8 A;  5B40 A;  4Z66 D;  3LZ0 A;  3AZM D;  1P3P B;  4Z2M G;  1ID3 A;  1Z2C B;  3AZI B;  5GT0 C;  5AVB D;  3REI A;  5B33 D;  3W99 B;  3W96 B;  4G92 B;  3AN2 B;  1W2E A;  1P3P C;  4XZQ D;  5GT3 A;  5B1L B;  5AV9 A;  2XD1 A;  1EQZ D;  3UT9 A;  1S32 D;  4JJN D;  3AZI C;  3W99 C;  3W96 C;  1U35 A;  5DNN B;  3LZ1 D;  4G92 C;  3AN2 C;  5B1L C;  1KX5 D;  5DNM B;  1KU5 A;  4LD9 D;  5DNN C;  1P3F D;  5B31 B;  5DNM C;  2FJ7 D;  4YM6 A;  5GT0 D;  4M6B A;  3MGS B;  5BO0 B;  1P3B A;  5B2J B;  4KUD B;  2RVQ C;  1P3P D;  1BH8 A;  3X1U B;  3MGQ B;  5B31 C;  3KUY A;  3AZI D;  3W99 D;  2DQN C;  3MGS C;  3W96 D;  5B2J C;  4KUD C;  4WNN A;  3REJ A;  4G91 B;  3AN2 D;  3X1U C;  3AYW A;  5B1L D;  3AV1 B;  3MGQ C;  2HIO A;  3VH5 T;  1A7W A;  2CV5 A;  3LJA B;  4G91 C;  3AV1 C;  4NFT A;  1B67 A;  5DNM D;  3X1T B;  3LJA C;  2BYK B;  2RVQ D;  5B31 D;  3X1V B;  3X1T C;  4KHA A;  5CPI D;  3MGS D;  3TU4 B;  4NE6 A;  5B2J D;  4KUD D;  3VH6 W;  4Z5T B;  1TZY B;  5F99 B;  3MGQ D;  3REK B;  3B0B A;  3X1V C;  2ZY3 A;  1ZLA A;  3TU4 C;  3AZN B;  1EQZ A;  4XZQ A;  5B0Y B;  2Y2L A;  4Z5T C;  1TZY C;  4X23 B;  5F99 C;  3AV1 D;  3REK C;  4E44 A;  1S32 A;  3LJA D;  3AZN C;  5B0Y C;  3AZF A;  4X23 C;  4LD9 A;  3X1T D;  4H9N B;  3VH5 A;  5GXQ B;  1P3F A;  2F8N B;  2XD5 A;  2ARO A;  2FJ7 A;  3AZG B;  4H9S C;  5GT0 A;  4H9R A;  1BFM A;  3TU4 D;  5GXQ C;  1P3P A;  2CWE A;  4Z5T D;  5JRG B;  1TZY D;  5F99 D;  3REK D;  3AZG C;  3W99 A;  3W96 A;  3O62 B;  3C1C B;  3NQU A;  3REL B;  3AZN D;  3AN2 A;  3B6F B;  1KX4 B;  5JRG C;  4X23 D;  4ZBJ B;  5B1M B;  4J8X B;  3O62 C;  3C1C C;  3REL C;  3H0L C;  3MGP B;  3B6F C;  1PZR A;  5KDM A;  4CSR A;  1KX4 C;  3X1S A;  4ZBJ C;  3REH B;  2Y2K A;  5DNM A;  4YS3 A;  5B1M C;  4J8X C;  2HUE B;  2F8N G;  2NZD B;  2Y2N A;  3MGP C;  5AV8 B;  4J8V B;  3WKJ D;  3AFA B;  2F8N D;  4R8P B;  1P34 B;  5FUG A;  3REH C;  3KFU G;  2YFW A;  2IO5 B;  3C1B B;  3AZG D;  5CPI A;  2HUE C;  3MGS A;  2NZD C;  5B2J A;  5B32 B;  5AV8 C;  4J8V C;  3AFA C;  4R8P C;  1P34 C;  5JRG D;  3MGQ A;  2IO5 C;  3C1B C;  3O62 D;  2YFV B;  3C1C D;  3REL D;  5B32 C;  3AZH B;  3B6F D;  5BS7 C;  1KX4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...