3AZGB

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgB00
4H9OB 5AVCB 3C1CA 1ZLAC 3MNNC 5AV8C 2RVQD 2PYOA 3WKJB 3AV2D 4KGCC 3C1CD 4WU8C 4Z2MG 3AZHC 3AZKD 1P3FB 2PYOD 3REIB 5F99B 1P3PA 3X1SC 2NZDA 5B33C 1BH9B 1P3OD 1U35A 1F66D 3LJAC 1P3KC 1P3PD 1M19B 4LD9C 5JA4B 5AV9C 1P3GC 4H9SA 3MGPA 4Z5TB 5FUGB 3AZNC 3AZMC 3WTPB 5BNVB 4HGAB 4YS3A 3VH6A 3MGPD 2AROA 4J8XA 3LZ0B 3AV1B 4XUJC 4J8UB 5CPKB 5B32C 4YS3D 5DNNB 1ID3A 3LZ1C 1TZYC 5AY8C 3B6GB 3V9RA 1N1JA 2AROD 1P3LA 3B0CW 3MGQC 4DRBA 5KDMA 1P3IB 3KXBC 3AZIA 1ID3D 4WU9C 1HQ3B 1H3OB 4H9NB 1P3LD 1M1AB 4JJNB 5GXQA 3AZJC 3REHB 4QLCC 5CP6C 2NQBB 1Q9CA 3MGSB 3AZID 3W99C 3X1UC 4E45A 1S32C 5GXQD 4EO5C 3AZGC 1P3AD 1TAFA 5AVCC 3W96A 5B2IA 5B0ZA 1EQZA 3R45B 5JRGA 4KHAA 3RELB 3W96D 3WA9A 5B2ID 4J8VA 5B0ZD 1EQZD 5JRGD 1P3FC 4Z66B 2YFVB 5F99C 4H9PB 4J8VD 1JFIB 1ZLAB 2YFWA 5DNMB 5GT0C 5AV6B 1KX5C 1KX3B 5E5AB 2F8NH 4H9RB 3AZEA 4Z5TC 3O62B 5C3IB 5AVBA 4HGAC 4KUDA 3C1BA 4XZQA 3AZED 3LELC 3W98B 4YM6A 3LZ0C 3AV1C 5AVBD 4J8UC 1KX4B 3UTBC 4R8PA 2FJ7A 4KUDD 3C1BD 4XZQD 2L5AA 4YM6D 2FJ7D 1P3IC 4R8PD 1HQ3C 5GSUA 5BS7A 5B24B 3X1VB 4J8WA 4JJNC 3AFAB 4CSRB 5GT3B 3WKJA 3MGSC 5GSUD 2RVQC 4J8WD 3AV2C 3REIA 1TZYB 5AY8B 1BH9A 3AZKC 5CPJA 2BYMB 3REID 1AOIB 1P3OC 3RELC 1M19A 1M18C 1F66C 3MVDB 2BYKB 5CPJD 3X1TA 3VH6W 4Z66C 3WTPA 5BO0B 2JSSA 5B0YA 5BNVA 4EO5B 3X1TD 3AZGB 5G49B 5DNMC 5AV5B 5AV6C 3W97B 5B0YD 1KX3C 5CPKA 3KWQA 5E5AC 4CAYB 2F8NK 3MGRB 3NQJB 5DNNA 1HTAA 2CV5A 3B6GA 3O62C 3AZLA 5C3IC 3B6FA 3AYWB 5B2JA 3KWQD 5DNND 2CV5D 3B6GD 3AZLD 1M1AA 3W98C 3AZFB 1P34B 3B6FD 4ZUXB 3REHA 5B2JD 2NQBA 1KX4C 5B31A 5CPIB 5GT0B 2NZDD 1KX5B 3UT9B 3REHD 1U35D 2NQBD 5B31D 1P3BA 4X23A 3X1VC 5B24C 3REKA 3WAAA 1P3AC 3AFAC 5GT3C 4ZBJB 3VH6T 4UUZA 4WV4B 5B1MA 5B40A 3KUYB 3TU4A 1P3BD 4M6BA 4X23D 3WAAD 3LELB 3REKD 3AN2B 2HIOA 3A6NB 3UTBB 3UTAB 3TU4D 5B1MD 5B40D 5B2IC 5B1LA 4J8XD 1B67A 2HIOD 1AOIC 1ZLAA 4H9QA 3MNNA 5B1LD 2LY8A 5AV8A 3MVDC 4KGCA 3REJA 3MNND 4WU8A 5AV8D 5BNXB 3AZHA 3AV2B 3C1CB 4KGCD 3REJD 3X1SA 4WU8D 5B33A 5AV5C 3NQUB 3W97C 3AZKB 2PYOB 3AZHD 2F8NG 3LJAA 3MGRC 1P3OB 1P3KA 3X1SD 5B33D 4LD9A 3B0DB 1M18B 1F66B 4E44A 5AV9A 3AYWC 1P3GA 3LJAD 1KU5A 1P3PB 3AZNA 1P3KD 3AZMA 2F8NB 4LD9D 3WA9D 3AZFC 1P34C 4ZUXC 5AV9D 1P3GD 5BT1D 5CPIC 3AZND 3AZMD 4NFTA 3UT9C 4XUJA 1P3MC 5B32A 3MGPB 4G92B 4WNNA 5GSUC 3LZ1A 1TZYA 5AY8A 4AWLC 3MGQA 4XUJD 4YS3B 5B32D 3B0BA 3KXBA 4ZBJC 4WU9A 3LZ1D 3KUYC 2AROB 2BYKA 3AN2C 3AZJA 3MGQD 1ID3B 3VH5A 4QLCA 5CP6A 3A6NC 3UTAC 3KXBD 3W99A 3V9RB 3X1UA 4WU9D 1N1JB 5KDMB 1S32A 3AZJD 3AZGA 3AZIB 4QLCD 5CP6D 5G49A 3W99D 4H9OA 5AVCA 3X1UD 5GXQB 1S32D 4CAYA 3AZGD 4NE6A 1P3AB 3NQJA 5AVCD 1P3FA 3WKJD 3C1CC 3W96B 5B2IB 5F99A 5B0ZB 1EQZB 5JRGB 2PYOC 1P3FD 5CHLB 2IO5B 5F99D 5GT0A 4J8VB 1KX5A 3B0DC 5JA4A 1B6WA 1P3PC 2NZDC 4Z5TA 5FUGA 5GT0D 1M19D 1KX5D 1U35C 2YFWB 4Z5TD 3WTPD 3LELA 3LZ0A 3AV1A 4H9SC 4J8UA 3UTBA 3MGPC 3AZEB 4G92C 5AVBB 3LZ0D 3AV1D 4YS3C 4J8UD 5CPKD 3C1BB 4XZQB 1P3IA 4KUDB 1HQ3A 1H3OA 2AROC 4J8XC 4YM6B 4H9NA 2FJ7B 4R8PB 4JJNA 1ID3C 1P3ID 3MGSA 1HQ3D 1P3LC 4G91C 5BNXA 1M1AD 4JJND 3AV2A 3AZIC 1P3MB 3MGSD 5GSUB 4J8WB 3NQUA 4AWLB 5GXQC 3AZKA 3R45A 3REJC 1P3OA 3RELA 1M18A 4NE5A 1F66A 3W96C 4Z66A 2YFVA 3RELD 5B0ZC 2F8NA 4H9PA 1M18D 4WZSB 5CPJB 1EQZC 5JRGC 1JFIA 4NE3A 4Z66D 3WA9C 5DNMA 2IO5C 4J8VC 5AV6A 2F8ND 3X1TB 1KX3A 5BT1C 5E5AA 4H9RA 5B0YB 5DNMD 1ZLAD 5AV6D 4Z2MH 3O62A 1BH8B 1KX3D 5E5AD 3VH5W 1WWIA 1R4VA 3O62D 3KWQB 3W98A 1KX4A 2CV5B 3AZEC 5B31G 3AZLB 3B6FB 5B2JB 5AVBC 3W98D 2CWEA 1KX4D 4KUDC 3C1BC 4XZQC 2NZDB 4YM6C 5B24A 3X1VA 1U35B 1P3AA 2FJ7C 4R8PC 5B31B 3AFAA 4CSRA 5GT3A 3X1VD 5B24D 3AFAD 1P3BB 5GT3D 2HUEB 4X23B 5BS7C 3WAAB 3REKB 4J8WC 3WKJC 3TU4B 4UUZB 5B1MB 5B40B 2BYMA 1AOIA 1TZYD 5AY8D 4J8XB 2HIOB 3MVDA 3VH5T 3REIC 1AOID 5B1LB 5BO0A 1F1EA 1P3LB 5CPJC 3MVDD 4G91B 4H9QB 3MNNB 1M19C 3B0CT 3WTPE 5AV5A 3W97A 5AV8B 3X1TC 4KGCB 3MGRA 3REJB 4WU8B 3WTPC 5B0YC 5AV5D 3W97D 3AZHB 3AYWA 1TAFB 3MGRD 3X1SB 5B33B 5CPKC 3KWQC 3LJAB 3AZFA 1P34A 4ZUXA 3AYWD 5DNNC 4KHAB 2CV5C 3B6GC 1P3KB 5CPIA 3AZLC 3WA9B 4LD9B 3B6FC 5AV9B 5B2JC 1P3GB 3AZFD 3UT9A 1P34D 4ZUXD 1P3MA 3KSYA 5B32G 3AZNB 3AZMB 5CPID 1M1AC 3REHC 2NQBC 3UT9D 5B31C 1P3MD 4DRAA 3KUYA 4XUJB 5B32B 3AN2A 4WNNB 3A6NA 3LZ1B 1P3BC 3UTAA 3KUYD 2HUEC 4X23C 1ULYA 3WAAC 3REKC 3MGQB 3LELD 3AN2D 3KXBB 3TU4C 3A6ND 5B1MC 5B40C 3UTAD 3UTBD 4WU9B 1A7WA 3AZJB 1WWSA 2HIOC 4QLCB 5CP6B 3W99B 3X1UB 5B1LC 1S32B 1BH8A 1BFMA
chains in the Genus database with same CATH superfamily
3EPLA 1W2EA 4H9OB 5AVCB 3C1CA 1ZLAC 3MNNC 5AV8C 2RVQD 2PYOA 3WKJB 3AV2D 4KGCC 3C1CD 4WU8C 4Z2MG 3AZHC 3AZKD 1P3FB 2PYOD 3REIB 5F99B 1P3PA 3X1SC 2NZDA 5B33C 1BH9B 1P3OD 2G5IC 1U35A 2Y2NA 3LJAC 1F66D 2ZY5A 1P3KC 1P3PD 1M19B 4LD9C 5JA4B 5AV9C 1P3GC 4H9SA 3MGPA 4Z5TB 5FUGB 3AZNC 3AZMC 3WTPB 5BNVB 4HGAB 1PZRA 3EG5B 4YS3A 3VH6A 3MGPD 2AROA 4J8XA 3LZ0B 3AV1B 4XUJC 4J8UB 5CPKB 5B32C 4YS3D 5DNNB 1ID3A 3LZ1C 1TZYC 5AY8C 3B6GB 3V9RA 1N1JA 3P5JB 2AROD 1P3LA 3B0CW 3MGQC 4DRBA 5KDMA 1P3IB 2ZY4A 3KXBC 3AZIA 4WU9C 1ID3D 1HQ3B 1H3OB 1Z2CB 4H9NB 1P3LD 1M1AB 4JJNB 5GXQA 3AZJC 3REHB 4QLCC 5CP6C 2NQBB 1Q9CA 3MGSB 3AZID 3W99C 3X1UC 2Y2JA 4E45A 2Y2PA 1S32C 5GXQD 4EO5C 3AZGC 1P3AD 1TAFA 5AVCC 3W96A 5B2IA 5B0ZA 1EQZA 2J8PA 3R45B 5JRGA 4KHAA 3RELB 3W96D 3WA9A 5B2ID 4J8VA 5B0ZD 1EQZD 3H0RC 5JRGD 1P3FC 4Z66B 2YFVB 5F99C 4H9PB 4J8VD 1JFIB 1ZLAB 2YFWA 5DNMB 5GT0C 5AV6B 1KX5C 1KX3B 5E5AB 2F8NH 4H9RB 3AZEA 4Z5TC 3A1IA 3O62B 5C3IB 5AVBA 4HGAC 4KUDA 3C1BA 4XZQA 3AZED 3LELC 3W98B 1T3UA 4YM6A 3LZ0C 5AVBD 3AV1C 4J8UC 1KX4B 3UTBC 4R8PA 2FJ7A 4KUDD 3C1BD 4XZQD 2L5AA 4YM6D 2FJ7D 1P3IC 4R8PD 1HQ3C 5GSUA 5BS7A 5B24B 3X1VB 4J8WA 4JJNC 3AFAB 4CSRB 2DF4C 5GT3B 3MGSC 3WKJA 5GSUD 3KFUG 2RVQC 4J8WD 3AV2C 3REIA 2UWXA 1TZYB 5AY8B 1BH9A 3AZKC 5CPJA 2BYMB 3REID 1AOIB 1P3OC 3RELC 1M19A 1M18C 2RIQA 3MVDB 1F66C 2BYKB 5CPJD 3X1TA 3VH6W 4Z66C 3WTPA 5BO0B 2JSSA 5B0YA 5BNVA 4EO5B 3X1TD 3AZGB 5G49B 5DNMC 5AV5B 5AV6C 3W97B 5B0YD 1KX3C 2Y2IA 5CPKA 3KWQA 5E5AC 4CAYB 2F8NK 3MGRB 3NQJB 5DNNA 1HTAA 2CV5A 3B6GA 3O62C 3AZLA 5C3IC 3B6FA 3AYWB 5B2JA 3KWQD 5DNND 2CV5D 3B6GD 2Y2GA 3AZLD 1M1AA 3W98C 3AZFB 1P34B 3B6FD 4ZUXB 3REHA 5B2JD 2NQBA 1KX4C 5B31A 3F6TA 5CPIB 5GT0B 2NZDD 4WJ3C 1KX5B 3UT9B 3REHD 1U35D 2NQBD 5B31D 1P3BA 4X23A 3X1VC 5B24C 3REKA 3WAAA 1P3AC 3AFAC 5GT3C 4ZBJB 3VH6T 4UUZA 4WV4B 5B1MA 5B40A 3KUYB 3TU4A 1P3BD 4M6BA 4X23D 3WAAD 3LELB 3REKD 3AN2B 2HIOA 3A6NB 3UTBB 3UTAB 3TU4D 5B1MD 5B40D 5B2IC 5B1LA 4J8XD 1B67A 2HIOD 1AOIC 1ZLAA 4H9QA 3MNNA 2VQRA 5B1LD 2LY8A 2Y2LA 2FFFB 5AV8A 3MVDC 4KGCA 3REJA 3MNND 4WU8A 4UPKA 5AV8D 5BNXB 3AZHA 3AV2B 3C1CB 4DQYB 2Y2OA 4KGCD 3REJD 2XD5A 3X1SA 4WU8D 5B33A 5AV5C 3NQUB 3W97C 3AZKB 2PYOB 3AZHD 2F8NG 3LJAA 3MGRC 1P3OB 1P3KA 3X1SD 5B33D 4LD9A 3B0DB 1M18B 1F66B 4E44A 2Y2KA 5AV9A 3AYWC 1P3GA 3LJAD 1KU5A 2G5HC 1P3PB 3AZNA 1P3KD 3AZMA 2F8NB 4LD9D 3WA9D 3AZFC 1P34C 4ZUXC 5AV9D 1P3GD 5BT1D 5CPIC 3AZND 3AZMD 4NFTA 3UT9C 4XUJA 1P3MC 5B32A 3MGPB 4G92B 4WNNA 5GSUC 3LZ1A 1TZYA 5AY8A 4AWLC 3MGQA 4XUJD 4YS3B 5B32D 3B0BA 3KXBA 4ZBJC 4WU9A 3LZ1D 3KUYC 2AROB 2BYKA 3IP4C 3AN2C 3AZJA 3MGQD 1ID3B 3VH5A 4QLCA 5CP6A 3A6NC 3UTAC 3KXBD 3W99A 3V9RB 3X1UA 4WU9D 1N1JB 5KDMB 1S32A 3AZJD 3AZGA 3AL0C 3AZIB 4QLCD 5CP6D 5G49A 3W99D 4H9OA 5AVCA 3X1UD 5GXQB 1S32D 4CAYA 3AZGD 4NE6A 1P3AB 3NQJA 5AVCD 1P3FA 3WKJD 3C1CC 3W96B 5B2IB 5F99A 5B0ZB 1EQZB 5JRGB 2PYOC 1P3FD 5CHLB 2IO5B 5F99D 5GT0A 4J8VB 1KX5A 3B0DC 5JA4A 1B6WA 1P3PC 2NZDC 4Z5TA 5FUGA 5GT0D 1M19D 1KX5D 1U35C 2YFWB 4Z5TD 2ZY2A 3WTPD 3LELA 3LZ0A 3AV1A 4H9SC 4J8UA 3UTBA 3MGPC 3AZEB 4G92C 5AVBB 3EPHA 3LZ0D 3AV1D 4YS3C 4J8UD 5CPKD 3C1BB 4XZQB 1P3IA 4KUDB 3EPKA 1HQ3A 1H3OA 2AROC 4J8XC 4YM6B 3H0MC 4H9NA 2FJ7B 4R8PB 4JJNA 1ID3C 1P3ID 3MGSA 1HQ3D 1P3LC 4G91C 5BNXA 1M1AD 4JJND 3AV2A 3AZIC 1P3MB 3MGSD 5GSUB 4J8WB 3NQUA 4AWLB 5GXQC 3AZKA 3R45A 3REJC 1P3OA 3RELA 1M18A 4NE5A 1F66A 3W96C 4Z66A 2YFVA 3RELD 5B0ZC 2F8NA 4H9PA 1M18D 4WZSB 3FDDA 5CPJB 1EQZC 5JRGC 1JFIA 4NE3A 2F2AC 4Z66D 3WA9C 5DNMA 2IO5C 4J8VC 5AV6A 2F8ND 3X1TB 1KX3A 5BT1C 5E5AA 4H9RA 5B0YB 5DNMD 1ZLAD 5AV6D 4Z2MH 3O62A 1BH8B 1KX3D 5E5AD 3VH5W 1WWIA 2DQNC 1R4VA 3O62D 3KWQB 3W98A 1KX4A 2CV5B 3AZEC 5B31G 3AZLB 3B6FB 5B2JB 5AVBC 3W98D 2CWEA 1KX4D 4KUDC 3C1BC 4XZQC 2NZDB 4YM6C 5B24A 3X1VA 1U35B 1P3AA 2FJ7C 4R8PC 5B31B 3AFAA 4CSRA 5GT3A 3X1VD 5B24D 3AFAD 1P3BB 5GT3D 2HUEB 4X23B 5BS7C 3WAAB 3REKB 4J8WC 2ZY3A 2JCHA 3WKJC 3TU4B 4UUZB 5B1MB 5B40B 2BYMA 1AOIA 1TZYD 5AY8D 4J8XB 2HIOB 3MVDA 3VH5T 3REIC 2Y2QA 1AOID 5B1LB 5BO0A 1F1EA 1P3LB 5CPJC 3MVDD 4G91B 2Y2HA 4H9QB 3MNNB 1M19C 3B0CT 3WTPE 5AV5A 3W97A 5AV8B 2JE5A 3X1TC 2W8SA 4KGCB 3MGRA 3REJB 4WU8B 3WTPC 5B0YC 5AV5D 3W97D 3AZHB 3AYWA 1TAFB 3MGRD 3X1SB 5B33B 5CPKC 3KWQC 3LJAB 3AZFA 1P34A 4ZUXA 3AYWD 5DNNC 4KHAB 2CV5C 3B6GC 1P3KB 5CPIA 3AZLC 3WA9B 4LD9B 3B6FC 5AV9B 5B2JC 1P3GB 3AZFD 3UT9A 1P34D 4ZUXD 1P3MA 3KSYA 2XD1A 2Y2MA 5B32G 3AZNB 3AZMB 5CPID 1M1AC 3REHC 2NQBC 3UT9D 5B31C 1P3MD 4DRAA 3KUYA 3H0LC 4XUJB 2BG1A 5B32B 3AN2A 4WNNB 3A6NA 3LZ1B 1P3BC 3UTAA 3KUYD 2ZM5A 2HUEC 3A1KA 1ULYA 3WAAC 4X23C 3REKC 3MGQB 3LELD 3AN2D 3KXBB 3TU4C 3A6ND 5B1MC 5B40C 3UTAD 3UTBD 4WU9B 1A7WA 3AZJB 1WWSA 2HIOC 4QLCB 5CP6B 3EPJA 3W99B 3X1UB 5B1LC 1S32B 1BH8A 1BFMA
chains in the Genus database with same CATH topology
3EPLA 1W2EA 4H9OB 5AVCB 3C1CA 1ZLAC 3MNNC 5AV8C 2RVQD 2PYOA 3WKJB 3AV2D 4KGCC 3C1CD 4WU8C 4Z2MG 3AZHC 3AZKD 1P3FB 2PYOD 3REIB 5F99B 1P3PA 3X1SC 2NZDA 5B33C 1BH9B 1P3OD 2G5IC 1U35A 2Y2NA 3LJAC 1F66D 2ZY5A 1P3KC 1P3PD 1M19B 4LD9C 5JA4B 5AV9C 1P3GC 4H9SA 3MGPA 4Z5TB 5FUGB 3AZNC 3AZMC 3WTPB 5BNVB 4HGAB 1PZRA 3EG5B 4YS3A 3VH6A 3MGPD 2AROA 4J8XA 3LZ0B 3AV1B 4XUJC 4J8UB 5CPKB 5B32C 4YS3D 5DNNB 1ID3A 3LZ1C 1TZYC 5AY8C 3B6GB 3V9RA 1N1JA 3P5JB 2AROD 1P3LA 3B0CW 3MGQC 4DRBA 5KDMA 1P3IB 2ZY4A 3KXBC 3AZIA 4WU9C 1ID3D 1HQ3B 1H3OB 1Z2CB 4H9NB 1P3LD 1M1AB 4JJNB 5GXQA 3AZJC 3REHB 4QLCC 5CP6C 2NQBB 1Q9CA 3MGSB 3AZID 3W99C 3X1UC 2Y2JA 4E45A 2Y2PA 1S32C 5GXQD 4EO5C 3AZGC 1P3AD 1TAFA 5AVCC 3W96A 5B2IA 5B0ZA 1EQZA 2J8PA 3R45B 5JRGA 4KHAA 3RELB 3W96D 3WA9A 5B2ID 4J8VA 5B0ZD 1EQZD 3H0RC 5JRGD 1P3FC 4Z66B 2YFVB 5F99C 4H9PB 4J8VD 1JFIB 1ZLAB 2YFWA 5DNMB 5GT0C 5AV6B 1KX5C 1KX3B 5E5AB 2F8NH 4H9RB 3AZEA 4Z5TC 3A1IA 3O62B 5C3IB 5AVBA 4HGAC 4KUDA 3C1BA 4XZQA 3AZED 3LELC 3W98B 1T3UA 4YM6A 3LZ0C 5AVBD 3AV1C 4J8UC 1KX4B 3UTBC 4R8PA 2FJ7A 4KUDD 3C1BD 4XZQD 2L5AA 4YM6D 2FJ7D 1P3IC 4R8PD 1HQ3C 5GSUA 5BS7A 5B24B 3X1VB 4J8WA 4JJNC 3AFAB 4CSRB 2DF4C 5GT3B 3MGSC 3WKJA 5GSUD 3KFUG 2RVQC 4J8WD 3AV2C 3REIA 2UWXA 1TZYB 5AY8B 1BH9A 3AZKC 5CPJA 2BYMB 3REID 1AOIB 1P3OC 3RELC 1M19A 1M18C 2RIQA 3MVDB 1F66C 2BYKB 5CPJD 3X1TA 3VH6W 4Z66C 3WTPA 5BO0B 2JSSA 5B0YA 5BNVA 4EO5B 3X1TD 3AZGB 5G49B 5DNMC 5AV5B 5AV6C 3W97B 5B0YD 1KX3C 2Y2IA 5CPKA 3KWQA 5E5AC 4CAYB 2F8NK 3MGRB 3NQJB 5DNNA 1HTAA 2CV5A 3B6GA 3O62C 3AZLA 5C3IC 3B6FA 3AYWB 5B2JA 3KWQD 5DNND 2CV5D 3B6GD 2Y2GA 3AZLD 1M1AA 3W98C 3AZFB 1P34B 3B6FD 4ZUXB 3REHA 5B2JD 2NQBA 1KX4C 5B31A 3F6TA 5CPIB 5GT0B 2NZDD 4WJ3C 1KX5B 3UT9B 3REHD 1U35D 2NQBD 5B31D 1P3BA 4X23A 3X1VC 5B24C 3REKA 3WAAA 1P3AC 3AFAC 5GT3C 4ZBJB 3VH6T 4UUZA 4WV4B 5B1MA 5B40A 3KUYB 3TU4A 1P3BD 4M6BA 4X23D 3WAAD 3LELB 3REKD 3AN2B 2HIOA 3A6NB 3UTBB 3UTAB 3TU4D 5B1MD 5B40D 5B2IC 5B1LA 4J8XD 1B67A 2HIOD 1AOIC 1ZLAA 4H9QA 3MNNA 2VQRA 5B1LD 2LY8A 2Y2LA 2FFFB 5AV8A 3MVDC 4KGCA 3REJA 3MNND 4WU8A 4UPKA 5AV8D 5BNXB 3AZHA 3AV2B 3C1CB 4DQYB 2Y2OA 4KGCD 3REJD 2XD5A 3X1SA 4WU8D 5B33A 5AV5C 3NQUB 3W97C 3AZKB 2PYOB 3AZHD 2F8NG 3LJAA 3MGRC 1P3OB 1P3KA 3X1SD 5B33D 4LD9A 3B0DB 1M18B 1F66B 4E44A 2Y2KA 5AV9A 3AYWC 1P3GA 3LJAD 1KU5A 2G5HC 1P3PB 3AZNA 1P3KD 3AZMA 2F8NB 4LD9D 3WA9D 3AZFC 1P34C 4ZUXC 5AV9D 1P3GD 5BT1D 5CPIC 3AZND 3AZMD 4NFTA 3UT9C 4XUJA 1P3MC 5B32A 3MGPB 4G92B 4WNNA 5GSUC 3LZ1A 1TZYA 5AY8A 4AWLC 3MGQA 4XUJD 4YS3B 5B32D 3B0BA 3KXBA 4ZBJC 4WU9A 3LZ1D 3KUYC 2AROB 2BYKA 3IP4C 3AN2C 3AZJA 3MGQD 1ID3B 3VH5A 4QLCA 5CP6A 3A6NC 3UTAC 3KXBD 3W99A 3V9RB 3X1UA 4WU9D 1N1JB 5KDMB 1S32A 3AZJD 3AZGA 3AL0C 3AZIB 4QLCD 5CP6D 5G49A 3W99D 4H9OA 5AVCA 3X1UD 5GXQB 1S32D 4CAYA 3AZGD 4NE6A 1P3AB 3NQJA 5AVCD 1P3FA 3WKJD 3C1CC 3W96B 5B2IB 5F99A 5B0ZB 1EQZB 5JRGB 2PYOC 1P3FD 5CHLB 2IO5B 5F99D 5GT0A 4J8VB 1KX5A 3B0DC 5JA4A 1B6WA 1P3PC 2NZDC 4Z5TA 5FUGA 5GT0D 1M19D 1KX5D 1U35C 2YFWB 4Z5TD 2ZY2A 3WTPD 3LELA 3LZ0A 3AV1A 4H9SC 4J8UA 3UTBA 3MGPC 3AZEB 4G92C 5AVBB 3EPHA 3LZ0D 3AV1D 4YS3C 4J8UD 5CPKD 3C1BB 4XZQB 1P3IA 4KUDB 3EPKA 1HQ3A 1H3OA 2AROC 4J8XC 4YM6B 3H0MC 4H9NA 2FJ7B 4R8PB 4JJNA 1ID3C 1P3ID 3MGSA 1HQ3D 1P3LC 4G91C 5BNXA 1M1AD 4JJND 3AV2A 3AZIC 1P3MB 3MGSD 5GSUB 4J8WB 3NQUA 4AWLB 5GXQC 3AZKA 3R45A 3REJC 1P3OA 3RELA 1M18A 4NE5A 1F66A 3W96C 4Z66A 2YFVA 3RELD 5B0ZC 2F8NA 4H9PA 1M18D 4WZSB 3FDDA 5CPJB 1EQZC 5JRGC 1JFIA 4NE3A 2F2AC 4Z66D 3WA9C 5DNMA 2IO5C 4J8VC 5AV6A 2F8ND 3X1TB 1KX3A 5BT1C 5E5AA 4H9RA 5B0YB 5DNMD 1ZLAD 5AV6D 4Z2MH 3O62A 1BH8B 1KX3D 5E5AD 3VH5W 1WWIA 2DQNC 1R4VA 3O62D 3KWQB 3W98A 1KX4A 2CV5B 3AZEC 5B31G 3AZLB 3B6FB 5B2JB 5AVBC 3W98D 2CWEA 1KX4D 4KUDC 3C1BC 4XZQC 2NZDB 4YM6C 5B24A 3X1VA 1U35B 1P3AA 2FJ7C 4R8PC 5B31B 3AFAA 4CSRA 5GT3A 3X1VD 5B24D 3AFAD 1P3BB 5GT3D 2HUEB 4X23B 5BS7C 3WAAB 3REKB 4J8WC 2ZY3A 2JCHA 3WKJC 3TU4B 4UUZB 5B1MB 5B40B 2BYMA 1AOIA 1TZYD 5AY8D 4J8XB 2HIOB 3MVDA 3VH5T 3REIC 2Y2QA 1AOID 5B1LB 5BO0A 1F1EA 1P3LB 5CPJC 3MVDD 4G91B 2Y2HA 4H9QB 3MNNB 1M19C 3B0CT 3WTPE 5AV5A 3W97A 5AV8B 2JE5A 3X1TC 2W8SA 4KGCB 3MGRA 3REJB 4WU8B 3WTPC 5B0YC 5AV5D 3W97D 3AZHB 3AYWA 1TAFB 3MGRD 3X1SB 5B33B 5CPKC 3KWQC 3LJAB 3AZFA 1P34A 4ZUXA 3AYWD 5DNNC 4KHAB 2CV5C 3B6GC 1P3KB 5CPIA 3AZLC 3WA9B 4LD9B 3B6FC 5AV9B 5B2JC 1P3GB 3AZFD 3UT9A 1P34D 4ZUXD 1P3MA 3KSYA 2XD1A 2Y2MA 5B32G 3AZNB 3AZMB 5CPID 1M1AC 3REHC 2NQBC 3UT9D 5B31C 1P3MD 4DRAA 3KUYA 3H0LC 4XUJB 2BG1A 5B32B 3AN2A 4WNNB 3A6NA 3LZ1B 1P3BC 3UTAA 3KUYD 2ZM5A 2HUEC 3A1KA 1ULYA 3WAAC 4X23C 3REKC 3MGQB 3LELD 3AN2D 3KXBB 3TU4C 3A6ND 5B1MC 5B40C 3UTAD 3UTBD 4WU9B 1A7WA 3AZJB 1WWSA 2HIOC 4QLCB 5CP6B 3EPJA 3W99B 3X1UB 5B1LC 1S32B 1BH8A 1BFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O B;  5AVC B;  3C1C A;  1ZLA C;  3MNN C;  5AV8 C;  2RVQ D;  2PYO A;  3WKJ B;  3AV2 D;  4KGC C;  3C1C D;  4WU8 C;  4Z2M G;  3AZH C;  3AZK D;  1P3F B;  2PYO D;  3REI B;  5F99 B;  1P3P A;  3X1S C;  2NZD A;  5B33 C;  1BH9 B;  1P3O D;  1U35 A;  1F66 D;  3LJA C;  1P3K C;  1P3P D;  1M19 B;  4LD9 C;  5JA4 B;  5AV9 C;  1P3G C;  4H9S A;  3MGP A;  4Z5T B;  5FUG B;  3AZN C;  3AZM C;  3WTP B;  5BNV B;  4HGA B;  4YS3 A;  3VH6 A;  3MGP D;  2ARO A;  4J8X A;  3LZ0 B;  3AV1 B;  4XUJ C;  4J8U B;  5CPK B;  5B32 C;  4YS3 D;  5DNN B;  1ID3 A;  3LZ1 C;  1TZY C;  5AY8 C;  3B6G B;  3V9R A;  1N1J A;  2ARO D;  1P3L A;  3B0C W;  3MGQ C;  4DRB A;  5KDM A;  1P3I B;  3KXB C;  3AZI A;  1ID3 D;  4WU9 C;  1HQ3 B;  1H3O B;  4H9N B;  1P3L D;  1M1A B;  4JJN B;  5GXQ A;  3AZJ C;  3REH B;  4QLC C;  5CP6 C;  2NQB B;  1Q9C A;  3MGS B;  3AZI D;  3W99 C;  3X1U C;  4E45 A;  1S32 C;  5GXQ D;  4EO5 C;  3AZG C;  1P3A D;  1TAF A;  5AVC C;  3W96 A;  5B2I A;  5B0Z A;  1EQZ A;  3R45 B;  5JRG A;  4KHA A;  3REL B;  3W96 D;  3WA9 A;  5B2I D;  4J8V A;  5B0Z D;  1EQZ D;  5JRG D;  1P3F C;  4Z66 B;  2YFV B;  5F99 C;  4H9P B;  4J8V D;  1JFI B;  1ZLA B;  2YFW A;  5DNM B;  5GT0 C;  5AV6 B;  1KX5 C;  1KX3 B;  5E5A B;  2F8N H;  4H9R B;  3AZE A;  4Z5T C;  3O62 B;  5C3I B;  5AVB A;  4HGA C;  4KUD A;  3C1B A;  4XZQ A;  3AZE D;  3LEL C;  3W98 B;  4YM6 A;  3LZ0 C;  3AV1 C;  5AVB D;  4J8U C;  1KX4 B;  3UTB C;  4R8P A;  2FJ7 A;  4KUD D;  3C1B D;  4XZQ D;  2L5A A;  4YM6 D;  2FJ7 D;  1P3I C;  4R8P D;  1HQ3 C;  5GSU A;  5BS7 A;  5B24 B;  3X1V B;  4J8W A;  4JJN C;  3AFA B;  4CSR B;  5GT3 B;  3WKJ A;  3MGS C;  5GSU D;  2RVQ C;  4J8W D;  3AV2 C;  3REI A;  1TZY B;  5AY8 B;  1BH9 A;  3AZK C;  5CPJ A;  2BYM B;  3REI D;  1AOI B;  1P3O C;  3REL C;  1M19 A;  1M18 C;  1F66 C;  3MVD B;  2BYK B;  5CPJ D;  3X1T A;  3VH6 W;  4Z66 C;  3WTP A;  5BO0 B;  2JSS A;  5B0Y A;  5BNV A;  4EO5 B;  3X1T D;  3AZG B;  5G49 B;  5DNM C;  5AV5 B;  5AV6 C;  3W97 B;  5B0Y D;  1KX3 C;  5CPK A;  3KWQ A;  5E5A C;  4CAY B;  2F8N K;  3MGR B;  3NQJ B;  5DNN A;  1HTA A;  2CV5 A;  3B6G A;  3O62 C;  3AZL A;  5C3I C;  3B6F A;  3AYW B;  5B2J A;  3KWQ D;  5DNN D;  2CV5 D;  3B6G D;  3AZL D;  1M1A A;  3W98 C;  3AZF B;  1P34 B;  3B6F D;  4ZUX B;  3REH A;  5B2J D;  2NQB A;  1KX4 C;  5B31 A;  5CPI B;  5GT0 B;  2NZD D;  1KX5 B;  3UT9 B;  3REH D;  1U35 D;  2NQB D;  5B31 D;  1P3B A;  4X23 A;  3X1V C;  5B24 C;  3REK A;  3WAA A;  1P3A C;  3AFA C;  5GT3 C;  4ZBJ B;  3VH6 T;  4UUZ A;  4WV4 B;  5B1M A;  5B40 A;  3KUY B;  3TU4 A;  1P3B D;  4M6B A;  4X23 D;  3WAA D;  3LEL B;  3REK D;  3AN2 B;  2HIO A;  3A6N B;  3UTB B;  3UTA B;  3TU4 D;  5B1M D;  5B40 D;  5B2I C;  5B1L A;  4J8X D;  1B67 A;  2HIO D;  1AOI C;  1ZLA A;  4H9Q A;  3MNN A;  5B1L D;  2LY8 A;  5AV8 A;  3MVD C;  4KGC A;  3REJ A;  3MNN D;  4WU8 A;  5AV8 D;  5BNX B;  3AZH A;  3AV2 B;  3C1C B;  4KGC D;  3REJ D;  3X1S A;  4WU8 D;  5B33 A;  5AV5 C;  3NQU B;  3W97 C;  3AZK B;  2PYO B;  3AZH D;  2F8N G;  3LJA A;  3MGR C;  1P3O B;  1P3K A;  3X1S D;  5B33 D;  4LD9 A;  3B0D B;  1M18 B;  1F66 B;  4E44 A;  5AV9 A;  3AYW C;  1P3G A;  3LJA D;  1KU5 A;  1P3P B;  3AZN A;  1P3K D;  3AZM A;  2F8N B;  4LD9 D;  3WA9 D;  3AZF C;  1P34 C;  4ZUX C;  5AV9 D;  1P3G D;  5BT1 D;  5CPI C;  3AZN D;  3AZM D;  4NFT A;  3UT9 C;  4XUJ A;  1P3M C;  5B32 A;  3MGP B;  4G92 B;  4WNN A;  5GSU C;  3LZ1 A;  1TZY A;  5AY8 A;  4AWL C;  3MGQ A;  4XUJ D;  4YS3 B;  5B32 D;  3B0B A;  3KXB A;  4ZBJ C;  4WU9 A;  3LZ1 D;  3KUY C;  2ARO B;  2BYK A;  3AN2 C;  3AZJ A;  3MGQ D;  1ID3 B;  3VH5 A;  4QLC A;  5CP6 A;  3A6N C;  3UTA C;  3KXB D;  3W99 A;  3V9R B;  3X1U A;  4WU9 D;  1N1J B;  5KDM B;  1S32 A;  3AZJ D;  3AZG A;  3AZI B;  4QLC D;  5CP6 D;  5G49 A;  3W99 D;  4H9O A;  5AVC A;  3X1U D;  5GXQ B;  1S32 D;  4CAY A;  3AZG D;  4NE6 A;  1P3A B;  3NQJ A;  5AVC D;  1P3F A;  3WKJ D;  3C1C C;  3W96 B;  5B2I B;  5F99 A;  5B0Z B;  1EQZ B;  5JRG B;  2PYO C;  1P3F D;  5CHL B;  2IO5 B;  5F99 D;  5GT0 A;  4J8V B;  1KX5 A;  3B0D C;  5JA4 A;  1B6W A;  1P3P C;  2NZD C;  4Z5T A;  5FUG A;  5GT0 D;  1M19 D;  1KX5 D;  1U35 C;  2YFW B;  4Z5T D;  3WTP D;  3LEL A;  3LZ0 A;  3AV1 A;  4H9S C;  4J8U A;  3UTB A;  3MGP C;  3AZE B;  4G92 C;  5AVB B;  3LZ0 D;  3AV1 D;  4YS3 C;  4J8U D;  5CPK D;  3C1B B;  4XZQ B;  1P3I A;  4KUD B;  1HQ3 A;  1H3O A;  2ARO C;  4J8X C;  4YM6 B;  4H9N A;  2FJ7 B;  4R8P B;  4JJN A;  1ID3 C;  1P3I D;  3MGS A;  1HQ3 D;  1P3L C;  4G91 C;  5BNX A;  1M1A D;  4JJN D;  3AV2 A;  3AZI C;  1P3M B;  3MGS D;  5GSU B;  4J8W B;  3NQU A;  4AWL B;  5GXQ C;  3AZK A;  3R45 A;  3REJ C;  1P3O A;  3REL A;  1M18 A;  4NE5 A;  1F66 A;  3W96 C;  4Z66 A;  2YFV A;  3REL D;  5B0Z C;  2F8N A;  4H9P A;  1M18 D;  4WZS B;  5CPJ B;  1EQZ C;  5JRG C;  1JFI A;  4NE3 A;  4Z66 D;  3WA9 C;  5DNM A;  2IO5 C;  4J8V C;  5AV6 A;  2F8N D;  3X1T B;  1KX3 A;  5BT1 C;  5E5A A;  4H9R A;  5B0Y B;  5DNM D;  1ZLA D;  5AV6 D;  4Z2M H;  3O62 A;  1BH8 B;  1KX3 D;  5E5A D;  3VH5 W;  1WWI A;  1R4V A;  3O62 D;  3KWQ B;  3W98 A;  1KX4 A;  2CV5 B;  3AZE C;  5B31 G;  3AZL B;  3B6F B;  5B2J B;  5AVB C;  3W98 D;  2CWE A;  1KX4 D;  4KUD C;  3C1B C;  4XZQ C;  2NZD B;  4YM6 C;  5B24 A;  3X1V A;  1U35 B;  1P3A A;  2FJ7 C;  4R8P C;  5B31 B;  3AFA A;  4CSR A;  5GT3 A;  3X1V D;  5B24 D;  3AFA D;  1P3B B;  5GT3 D;  2HUE B;  4X23 B;  5BS7 C;  3WAA B;  3REK B;  4J8W C;  3WKJ C;  3TU4 B;  4UUZ B;  5B1M B;  5B40 B;  2BYM A;  1AOI A;  1TZY D;  5AY8 D;  4J8X B;  2HIO B;  3MVD A;  3VH5 T;  3REI C;  1AOI D;  5B1L B;  5BO0 A;  1F1E A;  1P3L B;  5CPJ C;  3MVD D;  4G91 B;  4H9Q B;  3MNN B;  1M19 C;  3B0C T;  3WTP E;  5AV5 A;  3W97 A;  5AV8 B;  3X1T C;  4KGC B;  3MGR A;  3REJ B;  4WU8 B;  3WTP C;  5B0Y C;  5AV5 D;  3W97 D;  3AZH B;  3AYW A;  1TAF B;  3MGR D;  3X1S B;  5B33 B;  5CPK C;  3KWQ C;  3LJA B;  3AZF A;  1P34 A;  4ZUX A;  3AYW D;  5DNN C;  4KHA B;  2CV5 C;  3B6G C;  1P3K B;  5CPI A;  3AZL C;  3WA9 B;  4LD9 B;  3B6F C;  5AV9 B;  5B2J C;  1P3G B;  3AZF D;  3UT9 A;  1P34 D;  4ZUX D;  1P3M A;  3KSY A;  5B32 G;  3AZN B;  3AZM B;  5CPI D;  1M1A C;  3REH C;  2NQB C;  3UT9 D;  5B31 C;  1P3M D;  4DRA A;  3KUY A;  4XUJ B;  5B32 B;  3AN2 A;  4WNN B;  3A6N A;  3LZ1 B;  1P3B C;  3UTA A;  3KUY D;  2HUE C;  4X23 C;  1ULY A;  3WAA C;  3REK C;  3MGQ B;  3LEL D;  3AN2 D;  3KXB B;  3TU4 C;  3A6N D;  5B1M C;  5B40 C;  3UTA D;  3UTB D;  4WU9 B;  1A7W A;  3AZJ B;  1WWS A;  2HIO C;  4QLC B;  5CP6 B;  3W99 B;  3X1U B;  5B1L C;  1S32 B;  1BH8 A;  1BFM A; 
#chains in the Genus database with same CATH topology
 3EPL A;  1W2E A;  4H9O B;  5AVC B;  3C1C A;  1ZLA C;  3MNN C;  5AV8 C;  2RVQ D;  2PYO A;  3WKJ B;  3AV2 D;  4KGC C;  3C1C D;  4WU8 C;  4Z2M G;  3AZH C;  3AZK D;  1P3F B;  2PYO D;  3REI B;  5F99 B;  1P3P A;  3X1S C;  2NZD A;  5B33 C;  1BH9 B;  1P3O D;  2G5I C;  1U35 A;  2Y2N A;  3LJA C;  1F66 D;  2ZY5 A;  1P3K C;  1P3P D;  1M19 B;  4LD9 C;  5JA4 B;  5AV9 C;  1P3G C;  4H9S A;  3MGP A;  4Z5T B;  5FUG B;  3AZN C;  3AZM C;  3WTP B;  5BNV B;  4HGA B;  1PZR A;  3EG5 B;  4YS3 A;  3VH6 A;  3MGP D;  2ARO A;  4J8X A;  3LZ0 B;  3AV1 B;  4XUJ C;  4J8U B;  5CPK B;  5B32 C;  4YS3 D;  5DNN B;  1ID3 A;  3LZ1 C;  1TZY C;  5AY8 C;  3B6G B;  3V9R A;  1N1J A;  3P5J B;  2ARO D;  1P3L A;  3B0C W;  3MGQ C;  4DRB A;  5KDM A;  1P3I B;  2ZY4 A;  3KXB C;  3AZI A;  4WU9 C;  1ID3 D;  1HQ3 B;  1H3O B;  1Z2C B;  4H9N B;  1P3L D;  1M1A B;  4JJN B;  5GXQ A;  3AZJ C;  3REH B;  4QLC C;  5CP6 C;  2NQB B;  1Q9C A;  3MGS B;  3AZI D;  3W99 C;  3X1U C;  2Y2J A;  4E45 A;  2Y2P A;  1S32 C;  5GXQ D;  4EO5 C;  3AZG C;  1P3A D;  1TAF A;  5AVC C;  3W96 A;  5B2I A;  5B0Z A;  1EQZ A;  2J8P A;  3R45 B;  5JRG A;  4KHA A;  3REL B;  3W96 D;  3WA9 A;  5B2I D;  4J8V A;  5B0Z D;  1EQZ D;  3H0R C;  5JRG D;  1P3F C;  4Z66 B;  2YFV B;  5F99 C;  4H9P B;  4J8V D;  1JFI B;  1ZLA B;  2YFW A;  5DNM B;  5GT0 C;  5AV6 B;  1KX5 C;  1KX3 B;  5E5A B;  2F8N H;  4H9R B;  3AZE A;  4Z5T C;  3A1I A;  3O62 B;  5C3I B;  5AVB A;  4HGA C;  4KUD A;  3C1B A;  4XZQ A;  3AZE D;  3LEL C;  3W98 B;  1T3U A;  4YM6 A;  3LZ0 C;  5AVB D;  3AV1 C;  4J8U C;  1KX4 B;  3UTB C;  4R8P A;  2FJ7 A;  4KUD D;  3C1B D;  4XZQ D;  2L5A A;  4YM6 D;  2FJ7 D;  1P3I C;  4R8P D;  1HQ3 C;  5GSU A;  5BS7 A;  5B24 B;  3X1V B;  4J8W A;  4JJN C;  3AFA B;  4CSR B;  2DF4 C;  5GT3 B;  3MGS C;  3WKJ A;  5GSU D;  3KFU G;  2RVQ C;  4J8W D;  3AV2 C;  3REI A;  2UWX A;  1TZY B;  5AY8 B;  1BH9 A;  3AZK C;  5CPJ A;  2BYM B;  3REI D;  1AOI B;  1P3O C;  3REL C;  1M19 A;  1M18 C;  2RIQ A;  3MVD B;  1F66 C;  2BYK B;  5CPJ D;  3X1T A;  3VH6 W;  4Z66 C;  3WTP A;  5BO0 B;  2JSS A;  5B0Y A;  5BNV A;  4EO5 B;  3X1T D;  3AZG B;  5G49 B;  5DNM C;  5AV5 B;  5AV6 C;  3W97 B;  5B0Y D;  1KX3 C;  2Y2I A;  5CPK A;  3KWQ A;  5E5A C;  4CAY B;  2F8N K;  3MGR B;  3NQJ B;  5DNN A;  1HTA A;  2CV5 A;  3B6G A;  3O62 C;  3AZL A;  5C3I C;  3B6F A;  3AYW B;  5B2J A;  3KWQ D;  5DNN D;  2CV5 D;  3B6G D;  2Y2G A;  3AZL D;  1M1A A;  3W98 C;  3AZF B;  1P34 B;  3B6F D;  4ZUX B;  3REH A;  5B2J D;  2NQB A;  1KX4 C;  5B31 A;  3F6T A;  5CPI B;  5GT0 B;  2NZD D;  4WJ3 C;  1KX5 B;  3UT9 B;  3REH D;  1U35 D;  2NQB D;  5B31 D;  1P3B A;  4X23 A;  3X1V C;  5B24 C;  3REK A;  3WAA A;  1P3A C;  3AFA C;  5GT3 C;  4ZBJ B;  3VH6 T;  4UUZ A;  4WV4 B;  5B1M A;  5B40 A;  3KUY B;  3TU4 A;  1P3B D;  4M6B A;  4X23 D;  3WAA D;  3LEL B;  3REK D;  3AN2 B;  2HIO A;  3A6N B;  3UTB B;  3UTA B;  3TU4 D;  5B1M D;  5B40 D;  5B2I C;  5B1L A;  4J8X D;  1B67 A;  2HIO D;  1AOI C;  1ZLA A;  4H9Q A;  3MNN A;  2VQR A;  5B1L D;  2LY8 A;  2Y2L A;  2FFF B;  5AV8 A;  3MVD C;  4KGC A;  3REJ A;  3MNN D;  4WU8 A;  4UPK A;  5AV8 D;  5BNX B;  3AZH A;  3AV2 B;  3C1C B;  4DQY B;  2Y2O A;  4KGC D;  3REJ D;  2XD5 A;  3X1S A;  4WU8 D;  5B33 A;  5AV5 C;  3NQU B;  3W97 C;  3AZK B;  2PYO B;  3AZH D;  2F8N G;  3LJA A;  3MGR C;  1P3O B;  1P3K A;  3X1S D;  5B33 D;  4LD9 A;  3B0D B;  1M18 B;  1F66 B;  4E44 A;  2Y2K A;  5AV9 A;  3AYW C;  1P3G A;  3LJA D;  1KU5 A;  2G5H C;  1P3P B;  3AZN A;  1P3K D;  3AZM A;  2F8N B;  4LD9 D;  3WA9 D;  3AZF C;  1P34 C;  4ZUX C;  5AV9 D;  1P3G D;  5BT1 D;  5CPI C;  3AZN D;  3AZM D;  4NFT A;  3UT9 C;  4XUJ A;  1P3M C;  5B32 A;  3MGP B;  4G92 B;  4WNN A;  5GSU C;  3LZ1 A;  1TZY A;  5AY8 A;  4AWL C;  3MGQ A;  4XUJ D;  4YS3 B;  5B32 D;  3B0B A;  3KXB A;  4ZBJ C;  4WU9 A;  3LZ1 D;  3KUY C;  2ARO B;  2BYK A;  3IP4 C;  3AN2 C;  3AZJ A;  3MGQ D;  1ID3 B;  3VH5 A;  4QLC A;  5CP6 A;  3A6N C;  3UTA C;  3KXB D;  3W99 A;  3V9R B;  3X1U A;  4WU9 D;  1N1J B;  5KDM B;  1S32 A;  3AZJ D;  3AZG A;  3AL0 C;  3AZI B;  4QLC D;  5CP6 D;  5G49 A;  3W99 D;  4H9O A;  5AVC A;  3X1U D;  5GXQ B;  1S32 D;  4CAY A;  3AZG D;  4NE6 A;  1P3A B;  3NQJ A;  5AVC D;  1P3F A;  3WKJ D;  3C1C C;  3W96 B;  5B2I B;  5F99 A;  5B0Z B;  1EQZ B;  5JRG B;  2PYO C;  1P3F D;  5CHL B;  2IO5 B;  5F99 D;  5GT0 A;  4J8V B;  1KX5 A;  3B0D C;  5JA4 A;  1B6W A;  1P3P C;  2NZD C;  4Z5T A;  5FUG A;  5GT0 D;  1M19 D;  1KX5 D;  1U35 C;  2YFW B;  4Z5T D;  2ZY2 A;  3WTP D;  3LEL A;  3LZ0 A;  3AV1 A;  4H9S C;  4J8U A;  3UTB A;  3MGP C;  3AZE B;  4G92 C;  5AVB B;  3EPH A;  3LZ0 D;  3AV1 D;  4YS3 C;  4J8U D;  5CPK D;  3C1B B;  4XZQ B;  1P3I A;  4KUD B;  3EPK A;  1HQ3 A;  1H3O A;  2ARO C;  4J8X C;  4YM6 B;  3H0M C;  4H9N A;  2FJ7 B;  4R8P B;  4JJN A;  1ID3 C;  1P3I D;  3MGS A;  1HQ3 D;  1P3L C;  4G91 C;  5BNX A;  1M1A D;  4JJN D;  3AV2 A;  3AZI C;  1P3M B;  3MGS D;  5GSU B;  4J8W B;  3NQU A;  4AWL B;  5GXQ C;  3AZK A;  3R45 A;  3REJ C;  1P3O A;  3REL A;  1M18 A;  4NE5 A;  1F66 A;  3W96 C;  4Z66 A;  2YFV A;  3REL D;  5B0Z C;  2F8N A;  4H9P A;  1M18 D;  4WZS B;  3FDD A;  5CPJ B;  1EQZ C;  5JRG C;  1JFI A;  4NE3 A;  2F2A C;  4Z66 D;  3WA9 C;  5DNM A;  2IO5 C;  4J8V C;  5AV6 A;  2F8N D;  3X1T B;  1KX3 A;  5BT1 C;  5E5A A;  4H9R A;  5B0Y B;  5DNM D;  1ZLA D;  5AV6 D;  4Z2M H;  3O62 A;  1BH8 B;  1KX3 D;  5E5A D;  3VH5 W;  1WWI A;  2DQN C;  1R4V A;  3O62 D;  3KWQ B;  3W98 A;  1KX4 A;  2CV5 B;  3AZE C;  5B31 G;  3AZL B;  3B6F B;  5B2J B;  5AVB C;  3W98 D;  2CWE A;  1KX4 D;  4KUD C;  3C1B C;  4XZQ C;  2NZD B;  4YM6 C;  5B24 A;  3X1V A;  1U35 B;  1P3A A;  2FJ7 C;  4R8P C;  5B31 B;  3AFA A;  4CSR A;  5GT3 A;  3X1V D;  5B24 D;  3AFA D;  1P3B B;  5GT3 D;  2HUE B;  4X23 B;  5BS7 C;  3WAA B;  3REK B;  4J8W C;  2ZY3 A;  2JCH A;  3WKJ C;  3TU4 B;  4UUZ B;  5B1M B;  5B40 B;  2BYM A;  1AOI A;  1TZY D;  5AY8 D;  4J8X B;  2HIO B;  3MVD A;  3VH5 T;  3REI C;  2Y2Q A;  1AOI D;  5B1L B;  5BO0 A;  1F1E A;  1P3L B;  5CPJ C;  3MVD D;  4G91 B;  2Y2H A;  4H9Q B;  3MNN B;  1M19 C;  3B0C T;  3WTP E;  5AV5 A;  3W97 A;  5AV8 B;  2JE5 A;  3X1T C;  2W8S A;  4KGC B;  3MGR A;  3REJ B;  4WU8 B;  3WTP C;  5B0Y C;  5AV5 D;  3W97 D;  3AZH B;  3AYW A;  1TAF B;  3MGR D;  3X1S B;  5B33 B;  5CPK C;  3KWQ C;  3LJA B;  3AZF A;  1P34 A;  4ZUX A;  3AYW D;  5DNN C;  4KHA B;  2CV5 C;  3B6G C;  1P3K B;  5CPI A;  3AZL C;  3WA9 B;  4LD9 B;  3B6F C;  5AV9 B;  5B2J C;  1P3G B;  3AZF D;  3UT9 A;  1P34 D;  4ZUX D;  1P3M A;  3KSY A;  2XD1 A;  2Y2M A;  5B32 G;  3AZN B;  3AZM B;  5CPI D;  1M1A C;  3REH C;  2NQB C;  3UT9 D;  5B31 C;  1P3M D;  4DRA A;  3KUY A;  3H0L C;  4XUJ B;  2BG1 A;  5B32 B;  3AN2 A;  4WNN B;  3A6N A;  3LZ1 B;  1P3B C;  3UTA A;  3KUY D;  2ZM5 A;  2HUE C;  3A1K A;  1ULY A;  3WAA C;  4X23 C;  3REK C;  3MGQ B;  3LEL D;  3AN2 D;  3KXB B;  3TU4 C;  3A6N D;  5B1M C;  5B40 C;  3UTA D;  3UTB D;  4WU9 B;  1A7W A;  3AZJ B;  1WWS A;  2HIO C;  4QLC B;  5CP6 B;  3EPJ A;  3W99 B;  3X1U B;  5B1L C;  1S32 B;  1BH8 A;  1BFM A; 
#chains in the Genus database with same CATH homology
 3EPL A;  1W2E A;  4H9O B;  5AVC B;  3C1C A;  1ZLA C;  3MNN C;  5AV8 C;  2RVQ D;  2PYO A;  3WKJ B;  3AV2 D;  4KGC C;  3C1C D;  4WU8 C;  4Z2M G;  3AZH C;  3AZK D;  1P3F B;  2PYO D;  3REI B;  5F99 B;  1P3P A;  3X1S C;  2NZD A;  5B33 C;  1BH9 B;  1P3O D;  2G5I C;  1U35 A;  2Y2N A;  3LJA C;  1F66 D;  2ZY5 A;  1P3K C;  1P3P D;  1M19 B;  4LD9 C;  5JA4 B;  5AV9 C;  1P3G C;  4H9S A;  3MGP A;  4Z5T B;  5FUG B;  3AZN C;  3AZM C;  3WTP B;  5BNV B;  4HGA B;  1PZR A;  3EG5 B;  4YS3 A;  3VH6 A;  3MGP D;  2ARO A;  4J8X A;  3LZ0 B;  3AV1 B;  4XUJ C;  4J8U B;  5CPK B;  5B32 C;  4YS3 D;  5DNN B;  1ID3 A;  3LZ1 C;  1TZY C;  5AY8 C;  3B6G B;  3V9R A;  1N1J A;  3P5J B;  2ARO D;  1P3L A;  3B0C W;  3MGQ C;  4DRB A;  5KDM A;  1P3I B;  2ZY4 A;  3KXB C;  3AZI A;  4WU9 C;  1ID3 D;  1HQ3 B;  1H3O B;  1Z2C B;  4H9N B;  1P3L D;  1M1A B;  4JJN B;  5GXQ A;  3AZJ C;  3REH B;  4QLC C;  5CP6 C;  2NQB B;  1Q9C A;  3MGS B;  3AZI D;  3W99 C;  3X1U C;  2Y2J A;  4E45 A;  2Y2P A;  1S32 C;  5GXQ D;  4EO5 C;  3AZG C;  1P3A D;  1TAF A;  5AVC C;  3W96 A;  5B2I A;  5B0Z A;  1EQZ A;  2J8P A;  3R45 B;  5JRG A;  4KHA A;  3REL B;  3W96 D;  3WA9 A;  5B2I D;  4J8V A;  5B0Z D;  1EQZ D;  3H0R C;  5JRG D;  1P3F C;  4Z66 B;  2YFV B;  5F99 C;  4H9P B;  4J8V D;  1JFI B;  1ZLA B;  2YFW A;  5DNM B;  5GT0 C;  5AV6 B;  1KX5 C;  1KX3 B;  5E5A B;  2F8N H;  4H9R B;  3AZE A;  4Z5T C;  3A1I A;  3O62 B;  5C3I B;  5AVB A;  4HGA C;  4KUD A;  3C1B A;  4XZQ A;  3AZE D;  3LEL C;  3W98 B;  1T3U A;  4YM6 A;  3LZ0 C;  5AVB D;  3AV1 C;  4J8U C;  1KX4 B;  3UTB C;  4R8P A;  2FJ7 A;  4KUD D;  3C1B D;  4XZQ D;  2L5A A;  4YM6 D;  2FJ7 D;  1P3I C;  4R8P D;  1HQ3 C;  5GSU A;  5BS7 A;  5B24 B;  3X1V B;  4J8W A;  4JJN C;  3AFA B;  4CSR B;  2DF4 C;  5GT3 B;  3MGS C;  3WKJ A;  5GSU D;  3KFU G;  2RVQ C;  4J8W D;  3AV2 C;  3REI A;  2UWX A;  1TZY B;  5AY8 B;  1BH9 A;  3AZK C;  5CPJ A;  2BYM B;  3REI D;  1AOI B;  1P3O C;  3REL C;  1M19 A;  1M18 C;  2RIQ A;  3MVD B;  1F66 C;  2BYK B;  5CPJ D;  3X1T A;  3VH6 W;  4Z66 C;  3WTP A;  5BO0 B;  2JSS A;  5B0Y A;  5BNV A;  4EO5 B;  3X1T D;  3AZG B;  5G49 B;  5DNM C;  5AV5 B;  5AV6 C;  3W97 B;  5B0Y D;  1KX3 C;  2Y2I A;  5CPK A;  3KWQ A;  5E5A C;  4CAY B;  2F8N K;  3MGR B;  3NQJ B;  5DNN A;  1HTA A;  2CV5 A;  3B6G A;  3O62 C;  3AZL A;  5C3I C;  3B6F A;  3AYW B;  5B2J A;  3KWQ D;  5DNN D;  2CV5 D;  3B6G D;  2Y2G A;  3AZL D;  1M1A A;  3W98 C;  3AZF B;  1P34 B;  3B6F D;  4ZUX B;  3REH A;  5B2J D;  2NQB A;  1KX4 C;  5B31 A;  3F6T A;  5CPI B;  5GT0 B;  2NZD D;  4WJ3 C;  1KX5 B;  3UT9 B;  3REH D;  1U35 D;  2NQB D;  5B31 D;  1P3B A;  4X23 A;  3X1V C;  5B24 C;  3REK A;  3WAA A;  1P3A C;  3AFA C;  5GT3 C;  4ZBJ B;  3VH6 T;  4UUZ A;  4WV4 B;  5B1M A;  5B40 A;  3KUY B;  3TU4 A;  1P3B D;  4M6B A;  4X23 D;  3WAA D;  3LEL B;  3REK D;  3AN2 B;  2HIO A;  3A6N B;  3UTB B;  3UTA B;  3TU4 D;  5B1M D;  5B40 D;  5B2I C;  5B1L A;  4J8X D;  1B67 A;  2HIO D;  1AOI C;  1ZLA A;  4H9Q A;  3MNN A;  2VQR A;  5B1L D;  2LY8 A;  2Y2L A;  2FFF B;  5AV8 A;  3MVD C;  4KGC A;  3REJ A;  3MNN D;  4WU8 A;  4UPK A;  5AV8 D;  5BNX B;  3AZH A;  3AV2 B;  3C1C B;  4DQY B;  2Y2O A;  4KGC D;  3REJ D;  2XD5 A;  3X1S A;  4WU8 D;  5B33 A;  5AV5 C;  3NQU B;  3W97 C;  3AZK B;  2PYO B;  3AZH D;  2F8N G;  3LJA A;  3MGR C;  1P3O B;  1P3K A;  3X1S D;  5B33 D;  4LD9 A;  3B0D B;  1M18 B;  1F66 B;  4E44 A;  2Y2K A;  5AV9 A;  3AYW C;  1P3G A;  3LJA D;  1KU5 A;  2G5H C;  1P3P B;  3AZN A;  1P3K D;  3AZM A;  2F8N B;  4LD9 D;  3WA9 D;  3AZF C;  1P34 C;  4ZUX C;  5AV9 D;  1P3G D;  5BT1 D;  5CPI C;  3AZN D;  3AZM D;  4NFT A;  3UT9 C;  4XUJ A;  1P3M C;  5B32 A;  3MGP B;  4G92 B;  4WNN A;  5GSU C;  3LZ1 A;  1TZY A;  5AY8 A;  4AWL C;  3MGQ A;  4XUJ D;  4YS3 B;  5B32 D;  3B0B A;  3KXB A;  4ZBJ C;  4WU9 A;  3LZ1 D;  3KUY C;  2ARO B;  2BYK A;  3IP4 C;  3AN2 C;  3AZJ A;  3MGQ D;  1ID3 B;  3VH5 A;  4QLC A;  5CP6 A;  3A6N C;  3UTA C;  3KXB D;  3W99 A;  3V9R B;  3X1U A;  4WU9 D;  1N1J B;  5KDM B;  1S32 A;  3AZJ D;  3AZG A;  3AL0 C;  3AZI B;  4QLC D;  5CP6 D;  5G49 A;  3W99 D;  4H9O A;  5AVC A;  3X1U D;  5GXQ B;  1S32 D;  4CAY A;  3AZG D;  4NE6 A;  1P3A B;  3NQJ A;  5AVC D;  1P3F A;  3WKJ D;  3C1C C;  3W96 B;  5B2I B;  5F99 A;  5B0Z B;  1EQZ B;  5JRG B;  2PYO C;  1P3F D;  5CHL B;  2IO5 B;  5F99 D;  5GT0 A;  4J8V B;  1KX5 A;  3B0D C;  5JA4 A;  1B6W A;  1P3P C;  2NZD C;  4Z5T A;  5FUG A;  5GT0 D;  1M19 D;  1KX5 D;  1U35 C;  2YFW B;  4Z5T D;  2ZY2 A;  3WTP D;  3LEL A;  3LZ0 A;  3AV1 A;  4H9S C;  4J8U A;  3UTB A;  3MGP C;  3AZE B;  4G92 C;  5AVB B;  3EPH A;  3LZ0 D;  3AV1 D;  4YS3 C;  4J8U D;  5CPK D;  3C1B B;  4XZQ B;  1P3I A;  4KUD B;  3EPK A;  1HQ3 A;  1H3O A;  2ARO C;  4J8X C;  4YM6 B;  3H0M C;  4H9N A;  2FJ7 B;  4R8P B;  4JJN A;  1ID3 C;  1P3I D;  3MGS A;  1HQ3 D;  1P3L C;  4G91 C;  5BNX A;  1M1A D;  4JJN D;  3AV2 A;  3AZI C;  1P3M B;  3MGS D;  5GSU B;  4J8W B;  3NQU A;  4AWL B;  5GXQ C;  3AZK A;  3R45 A;  3REJ C;  1P3O A;  3REL A;  1M18 A;  4NE5 A;  1F66 A;  3W96 C;  4Z66 A;  2YFV A;  3REL D;  5B0Z C;  2F8N A;  4H9P A;  1M18 D;  4WZS B;  3FDD A;  5CPJ B;  1EQZ C;  5JRG C;  1JFI A;  4NE3 A;  2F2A C;  4Z66 D;  3WA9 C;  5DNM A;  2IO5 C;  4J8V C;  5AV6 A;  2F8N D;  3X1T B;  1KX3 A;  5BT1 C;  5E5A A;  4H9R A;  5B0Y B;  5DNM D;  1ZLA D;  5AV6 D;  4Z2M H;  3O62 A;  1BH8 B;  1KX3 D;  5E5A D;  3VH5 W;  1WWI A;  2DQN C;  1R4V A;  3O62 D;  3KWQ B;  3W98 A;  1KX4 A;  2CV5 B;  3AZE C;  5B31 G;  3AZL B;  3B6F B;  5B2J B;  5AVB C;  3W98 D;  2CWE A;  1KX4 D;  4KUD C;  3C1B C;  4XZQ C;  2NZD B;  4YM6 C;  5B24 A;  3X1V A;  1U35 B;  1P3A A;  2FJ7 C;  4R8P C;  5B31 B;  3AFA A;  4CSR A;  5GT3 A;  3X1V D;  5B24 D;  3AFA D;  1P3B B;  5GT3 D;  2HUE B;  4X23 B;  5BS7 C;  3WAA B;  3REK B;  4J8W C;  2ZY3 A;  2JCH A;  3WKJ C;  3TU4 B;  4UUZ B;  5B1M B;  5B40 B;  2BYM A;  1AOI A;  1TZY D;  5AY8 D;  4J8X B;  2HIO B;  3MVD A;  3VH5 T;  3REI C;  2Y2Q A;  1AOI D;  5B1L B;  5BO0 A;  1F1E A;  1P3L B;  5CPJ C;  3MVD D;  4G91 B;  2Y2H A;  4H9Q B;  3MNN B;  1M19 C;  3B0C T;  3WTP E;  5AV5 A;  3W97 A;  5AV8 B;  2JE5 A;  3X1T C;  2W8S A;  4KGC B;  3MGR A;  3REJ B;  4WU8 B;  3WTP C;  5B0Y C;  5AV5 D;  3W97 D;  3AZH B;  3AYW A;  1TAF B;  3MGR D;  3X1S B;  5B33 B;  5CPK C;  3KWQ C;  3LJA B;  3AZF A;  1P34 A;  4ZUX A;  3AYW D;  5DNN C;  4KHA B;  2CV5 C;  3B6G C;  1P3K B;  5CPI A;  3AZL C;  3WA9 B;  4LD9 B;  3B6F C;  5AV9 B;  5B2J C;  1P3G B;  3AZF D;  3UT9 A;  1P34 D;  4ZUX D;  1P3M A;  3KSY A;  2XD1 A;  2Y2M A;  5B32 G;  3AZN B;  3AZM B;  5CPI D;  1M1A C;  3REH C;  2NQB C;  3UT9 D;  5B31 C;  1P3M D;  4DRA A;  3KUY A;  3H0L C;  4XUJ B;  2BG1 A;  5B32 B;  3AN2 A;  4WNN B;  3A6N A;  3LZ1 B;  1P3B C;  3UTA A;  3KUY D;  2ZM5 A;  2HUE C;  3A1K A;  1ULY A;  3WAA C;  4X23 C;  3REK C;  3MGQ B;  3LEL D;  3AN2 D;  3KXB B;  3TU4 C;  3A6N D;  5B1M C;  5B40 C;  3UTA D;  3UTB D;  4WU9 B;  1A7W A;  3AZJ B;  1WWS A;  2HIO C;  4QLC B;  5CP6 B;  3EPJ A;  3W99 B;  3X1U B;  5B1L C;  1S32 B;  1BH8 A;  1BFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...