1P3AA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKHVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aA00
1N1JB 4KUDD 5CP6C 1AOIB 1P3KD 3KSYA 2AROB 1P3IC 1ZLAA 4LD9C 1P3AD 3MGRC 4EO5B 4CAYA 3X1VB 4G91C 4J8WA 4H9SC 3LJAA 3W96D 5B0ZD 5CPIB 3C1BA 1F1EA 3KXBC 3AZFC 3MGPD 1P3OA 3WAAB 3WKJB 4XZQB 4X23A 5AVBD 2HUEC 5C3IB 3AN2C 3X1UB 3REHC 5BT1C 3MVDA 5AVCB 3AYWA 3W99B 3C1CD 3AFAC 3AZJA 5JRGC 5AV5D 4ZUXA 4J8UD 3AZEB 3RELB 1ZLAC 1TZYC 5FUGA 3W98D 3REKC 3LJAC 5B31G 5DNMA 3AZIA 5B1MD 3C1BC 1A7WA 4NE3A 3VH5T 3KWQB 4XUJB 1P3OC 3REJA 4JJNA 1WWIA 3UTBA 1TAFB 3AZLC 3UT9A 3AYWC 5B40D 5CPKB 3REIA 5B2ID 2F8NA 4ZUXC 4YS3B 4H9RA 4QLCA 3AZGD 1KX4D 3KUYB 1HQ3B 4WU8D 1P3LD 1P3GA 3UTAD 3AZNC 3MGSD 4KGCD 4YM6A 1P34D 1KX3C 1P3KB 1P3AB 5B0YA 1P3PD 4CAYB 2CV5A 4WNNA 4J8WB 5AV8C 3REJC 5KDMA 3MGQC 3AFAA 5B0ZB 3O62A 4J8VD 3UT9C 5B32C 3REIC 5AY8D 3VH5A 1P3BD 5BNXA 4X23B 3WTPD 1P3GC 3V9RB 3AZJB 4DRBA 5AV5B 3TU4C 3X1VD 5GT0A 4YM6C 1U35D 1EQZD 3WTPE 4J8UB 2NQBD 5BNVA 3AZKD 5B32G 1M19D 2FJ7A 2JSSA 3NQJB 1BH9A 2YFVA 5B0YC 5CPID 4ZBJB 2CV5C 5DNND 3W98B 3AZHD 2HIOA 3WKJD 3AV1A 5DNMB 3AZIB 5BO0A 5B1MB 4G92C 1P3MD 5AV6A 3W99D 3W97D 4JJNB 4HGAC 3VH6W 3AZED 3LZ0A 5GSUA 5E5AC 2YFWA 5B2IB 4R8PB 5CP6D 4QLCB 2BYMA 1KX4B 3MNNA 1P3LB 2FJ7C 3UTAB 1P3IA 4Z5TA 4LD9D 3MGRD 1WWSA 3MGSB 3B0CW 5B33C 1P34B 4KGCB 3NQUB 3R45B 3B6FA 3AV1C 3AZFA 3KXBA 1ID3B 5AV6C 5CPKD 5JA4B 2IO5B 5KDMB 3B6GA 3AZMC 4WV4B 1KX5A 3AN2A 1JFIB 5GXQA 1HQ3D 3REHA 5BT1D 3LZ0C 4J8VB 5GSUC 3AFAD 1S32C 4H9OA 2L5AA 5BNXB 1P3BB 5B31A 3A6NA 3WTPB 3X1SA 3VH6A 2PYOA 3MNNC 5B1LA 4Z5TC 1ZLAD 1TZYA 3AV2C 1EQZB 4J8WD 1U35B 2NQBB 3AZKB 1M19B 3REKA 4Z2MG 1M1AC 3B6FC 3LJAD 3C1BD 4UUZB 4AWLC 5DNNB 1P3OD 2HIOB 3AZHB 3LZ1A 2BYKB 4X23D 3B6GC 1KX5C 5GXQC 5AY8A 3MVDD 3AZLA 3AYWD 1P3MB 3AZJD 4H9QA 3W97B 1M18A 5B31C 5B2JA 3A6NC 5CPJA 3X1SC 2PYOC 3WA9C 5B1LC 2YFWB 3AZNA 5GT3A 5CP6B 2NZDA 1KX3A 5B24C 4LD9B 5F99A 3MGRB 5DNMD 5AV9A 3AZID 3VH5W 4H9NA 4G91B 5AVBA 3REJD 5AV8A 4JJND 3LZ1C 1F66C 2F8NH 3MGQA 3UTBD 4J8XC 3AZFB 5AY8C 3KXBB 3UT9D 4KUDC 3REID 5B32A 2F8ND 4R8PD 4KHAB 1P3KC 1M18C 5B2JC 2HUEB 4QLCD 5CPJC 3REHB 1P3AC 1P3GD 5G49B 3AFAB 5JRGB 1H3OB 4E44A 5GT3C 2LY8A 4WU9A 2NZDC 3TU4A 4YM6D 3W96C 1ZLAB 5F99C 4WZSB 1TZYB 3X1TA 3MGPC 5AV9C 4NFTA 1ID3D 5AVBC 3REKB 3LELA 3LJAB 3O62D 3C1CC 3C1BB 5AV5C 1P3OB 3AZGA 4J8UC 5E5AA 3MVDB 3AYWB 1P3FA 4ZUXB 4WU9C 5GT0D 2FJ7D 3AZNB 3X1TC 5FUGB 1BFMA 1B6WA 5B33A 4Z66A 2HIOD 1BH8A 3LELC 3AV1D 5B40C 5AV6D 4H9NB 5AV8B 3REJB 3AZGC 1AOIA 1R4VA 4WU8C 4E45A 2AROA 3AZMA 3UTBB 3LZ0D 5GSUD 3UT9B 5B32B 3REIB 1S32A 3X1VA 2F8NB 4KGCC 1HTAA 1P3FC 4H9RB 3MNND 1P3GB 5CPIA 1P3ID 4Z5TD 1P3PC 1KU5A 3AV2A 3WAAA 3B0DC 3TU4B 4XZQA 4YM6B 4Z66C 3X1UA 3B6FD 1M1AA 5AVCA 5B0YB 3W99A 3AZFD 3KXBD 2CV5B 4WNNB 1AOIC 3AZEA 3RELA 1KX5D 2AROC 3AN2D 5GXQD 3O62B 3REHD 4EO5C 4G92B 5JRGD 3X1VC 4HGAB 5B31D 3A6ND 3X1SD 2PYOD 5CPIC 3WA9A 1TZYD 3KWQA 4XUJA 3WAAC 3WKJC 4XZQC 5GT0B 2RVQC 5C3IC 5BNVB 2FJ7B 1TAFA 5B24A 3X1UC 3REKD 5AVCC 1BH9B 2YFVB 3W99C 1ULYA 5B33B 4YS3A 3KUYA 1F66A 3AZEC 3RELC 2F8NK 3AV1B 4J8XA 5BO0B 3AZLD 5AV6B 4KUDA 1M18D 1P3KA 4ZUXD 5B2JD 5CPJD 3AZMB 1P3AA 3LZ0B 5GSUB 3AZND 1S32B 3KWQC 4XUJC 5GT3D 2NZDD 2BYMB 1KX3D 3MNNB 3W96A 5B0ZA 1P3IB 4Z5TB 5F99D 5CPKC 5AV9D 3MGPA 3AV2B 5BS7A 4YS3C 5AV8D 3KUYC 1HQ3C 3B6FB 1M1AB 3V9RA 3MGQD 5CHLB 3C1CA 4AWLB 4H9PA 5AV5A 5B32D 1Q9CA 4J8UA 3B6GB 4CSRA 3AN2B 1KX5B 5GXQB 3NQJA 4H9OB 3W98A 4WU9D 4J8WC 5B31B 3A6NB 3TU4D 4NE5A 3X1SB 2PYOB 5B0ZC 3WA9B 5B1LB 5B1MA 3X1TD 5B0YD 2CV5D 5BS7C 4X23C 5B24B 3MVDC 3LELD 5B40A 3AZJC 5B2IA 4R8PA 1KX4A 3LZ1B 1F66B 4WU8A 1P3LA 3UTAA 2CWEA 4J8XB 5AY8B 3MGSA 5E5AD 3AZLB 4KUDB 4ZBJC 4H9QB 1P3FD 1P34A 4KGCA 1M18B 3W98C 3NQUA 3R45A 5B2JB 5CPJB 5DNMC 3AZIC 1P3PA 5B1MC 1ID3A 5JA4A 5GT3B 4JJNC 2NZDB 5B33D 4Z66D 1KX3B 1JFIA 3UTBC 3W96B 5F99B 4J8VA 3MGPB 5AV9B 5B2IC 4R8PC 1N1JA 1P3BA 5AVBB 3WTPA 4QLCC 1AOID 1KX4C 3AZMD 2AROD 1P3LC 3UTAC 3MGQB 4Z2MH 3C1CB 4H9PB 3MGSC 1S32D 1P34C 1EQZA 1U35A 2NQBA 4CSRB 3AZKA 1M19A 2F8NG 4UUZA 1ID3C 5DNNA 3AV2D 4WU9B 2IO5C 3AZHA 3WAAD 4XZQD 2BYKA 2RVQD 3WKJA 1B67A 3O62C 3X1UD 1M1AD 1P3MA 5AVCD 4J8VC 3X1TB 3W97A 1P3BC 3VH6T 3WTPC 3RELD 3B6GD 3LELB 5B40B 4NE6A 5CP6A 3AZGB 5GT0C 1EQZC 4WU8B 1U35C 2NQBC 3AZKC 1M19C 4LD9A 3MGRA 5E5AB 3WA9D 3B0CT 5B1LD 5DNNC 3KWQD 4XUJD 1P3FB 2HIOC 3AZHC 4H9SA 4DRAA 1P3PB 5B24D 1P3MC 5CPKA 3W97C 3B0BA 3B0DB 4KHAA 4YS3D 4Z66B 3KUYD 1BH8B 3LZ1D 1HQ3A 1F66D 5G49A 4J8XD 4M6BA 5JRGA 1H3OA
chains in the Genus database with same CATH superfamily
1N1JB 4KUDD 5CP6C 1AOIB 1P3KD 3KSYA 2AROB 1P3IC 1ZLAA 4LD9C 1P3AD 3MGRC 4EO5B 4CAYA 3X1VB 4G91C 4J8WA 4H9SC 3LJAA 3W96D 5B0ZD 5CPIB 3C1BA 1F1EA 3KXBC 2J8PA 3AZFC 3MGPD 1P3OA 3WAAB 3WKJB 4XZQB 4X23A 5AVBD 2HUEC 5C3IB 3AN2C 3X1UB 3REHC 5BT1C 3MVDA 5AVCB 3AYWA 3W99B 3C1CD 3AFAC 3AZJA 5JRGC 5AV5D 4ZUXA 4J8UD 3AZEB 3RELB 1ZLAC 1TZYC 5FUGA 3KFUG 3W98D 3REKC 3LJAC 5B31G 5DNMA 3AZIA 5B1MD 2Y2JA 3C1BC 1A7WA 4NE3A 3VH5T 3KWQB 4XUJB 1P3OC 3REJA 4JJNA 1WWIA 2ZM5A 3UTBA 1TAFB 3AZLC 3UT9A 3AYWC 5B40D 5CPKB 3REIA 5B2ID 2F8NA 4ZUXC 4YS3B 4H9RA 4QLCA 3AZGD 1KX4D 3KUYB 1HQ3B 4WU8D 1P3LD 1P3GA 3UTAD 3AZNC 3MGSD 4KGCD 4YM6A 1P34D 1KX3C 1P3KB 1P3AB 5B0YA 1P3PD 4CAYB 2CV5A 4WNNA 4J8WB 5AV8C 3REJC 5KDMA 3MGQC 3AFAA 5B0ZB 3O62A 4J8VD 3UT9C 2Y2LA 5B32C 3REIC 2JCHA 3VH5A 1P3BD 5BNXA 4X23B 3WTPD 2RIQA 1P3GC 3V9RB 3AZJB 4DRBA 5AV5B 3TU4C 3X1VD 5GT0A 2UWXA 4YM6C 1U35D 3WTPE 4J8UB 1EQZD 5BNVA 3AZKD 5B32G 1M19D 2FJ7A 2NQBD 2JSSA 3NQJB 1BH9A 2YFVA 5B0YC 5CPID 4ZBJB 2CV5C 5DNND 3W98B 3AZHD 2HIOA 3WKJD 3AV1A 5DNMB 3AZIB 5BO0A 5B1MB 2Y2PA 4G92C 5AV6A 1P3MD 3W99D 3W97D 4JJNB 4HGAC 3VH6W 3FDDA 3AZED 3LZ0A 5GSUA 5E5AC 2Y2QA 2YFWA 5B2IB 4R8PB 5CP6D 4QLCB 2BYMA 1KX4B 3MNNA 1P3LB 2FJ7C 3UTAB 1P3IA 4Z5TA 4LD9D 3MGRD 1WWSA 3MGSB 3B0CW 5B33C 1P34B 4KGCB 3NQUB 3R45B 3B6FA 2ZY2A 3AV1C 3AZFA 3KXBA 1ID3B 5AV6C 2JE5A 5CPKD 5JA4B 2IO5B 1Z2CB 5KDMB 3B6GA 3AZMC 4WV4B 1KX5A 3AN2A 1JFIB 5GXQA 1HQ3D 3REHA 5BT1D 3LZ0C 4J8VB 5GSUC 3A1IA 3AFAD 1S32C 2BG1A 2L5AA 4H9OA 5BNXB 1P3BB 5B31A 3A6NA 3WTPB 3H0MC 3X1SA 3VH6A 2PYOA 3MNNC 5B1LA 4Z5TC 1ZLAD 2Y2HA 1TZYA 3AV2C 3EPHA 1EQZB 4J8WD 1U35B 2NQBB 1T3UA 3AZKB 1M19B 3REKA 4Z2MG 1M1AC 3B6FC 3LJAD 3C1BD 4UUZB 4AWLC 5DNNB 1P3OD 2HIOB 3AZHB 3LZ1A 2BYKB 4X23D 3B6GC 1KX5C 5GXQC 5AY8A 3MVDD 3AZLA 3AYWD 1P3MB 3AZJD 4H9QA 3W97B 1M18A 5B31C 5B2JA 3A6NC 5CPJA 3X1SC 2PYOC 3WA9C 5B1LC 2YFWB 3AZNA 5GT3A 5CP6B 2NZDA 1KX3A 1W2EA 5B24C 4LD9B 5F99A 3MGRB 5DNMD 5AV9A 3AZID 3VH5W 4H9NA 4G91B 5AVBA 3REJD 5AV8A 4JJND 3LZ1C 1F66C 2F8NH 3MGQA 3UTBD 4J8XC 3AZFB 5AY8C 3KXBB 3UT9D 2W8SA 2Y2NA 4KUDC 3REID 5B32A 2F8ND 4R8PD 4KHAB 1P3KC 1M18C 5B2JC 2HUEB 4QLCD 5CPJC 3REHB 1P3AC 1P3GD 5G49B 3AFAB 5JRGB 1H3OB 4E44A 2G5IC 5GT3C 2LY8A 4WU9A 2NZDC 3TU4A 4YM6D 3W96C 3EPLA 1ZLAB 5F99C 4WZSB 1TZYB 3X1TA 3MGPC 5AV9C 4NFTA 1ID3D 3AL0C 5AVBC 3REKB 3LELA 3LJAB 3O62D 3C1CC 3C1BB 4UPKA 5AV5C 1P3OB 3AZGA 4J8UC 3EG5B 3H0LC 2XD1A 5E5AA 3A1KA 3MVDB 3AYWB 1P3FA 4ZUXB 4WU9C 5GT0D 2XD5A 2FJ7D 3AZNB 3X1TC 5FUGB 1BFMA 1B6WA 5B33A 4Z66A 2HIOD 1BH8A 3LELC 3AV1D 5B40C 5AV6D 4H9NB 5AV8B 3REJB 3AZGC 1AOIA 1R4VA 4WU8C 4E45A 2AROA 3AZMA 3UTBB 3LZ0D 5GSUD 3UT9B 2ZY3A 5B32B 3REIB 1S32A 3X1VA 2F8NB 4KGCC 1HTAA 2ZY4A 1P3FC 4H9RB 3MNND 1P3GB 5CPIA 1P3ID 4Z5TD 1P3PC 1KU5A 2FFFB 3AV2A 3WAAA 3B0DC 3TU4B 4XZQA 4YM6B 4Z66C 3X1UA 3IP4C 3B6FD 1M1AA 5AVCA 5B0YB 3W99A 3AZFD 3KXBD 2CV5B 4WNNB 1AOIC 3EPJA 3RELA 3AZEA 1KX5D 2AROC 3AN2D 5GXQD 3O62B 3REHD 4EO5C 4G92B 5JRGD 3X1VC 4HGAB 5B31D 3A6ND 3X1SD 2PYOD 2G5HC 5CPIC 3WA9A 1TZYD 3KWQA 4XUJA 3WAAC 3WKJC 4XZQC 5GT0B 2RVQC 5C3IC 5BNVB 2FJ7B 1TAFA 5B24A 3X1UC 3REKD 2VQRA 2DQNC 1BH9B 2YFVB 3W99C 5AVCC 1ULYA 5B33B 4WJ3C 4YS3A 3KUYA 1F66A 3AZEC 3RELC 2F8NK 3AV1B 4J8XA 5BO0B 3AZLD 2Y2GA 5AV6B 4KUDA 1M18D 1P3KA 4ZUXD 5B2JD 5CPJD 3AZMB 1P3AA 3LZ0B 5GSUB 3AZND 1S32B 3KWQC 4XUJC 5GT3D 2NZDD 2BYMB 1KX3D 3MNNB 3W96A 5B0ZA 1P3IB 4Z5TB 5F99D 5CPKC 5AV9D 2Y2MA 3MGPA 3AV2B 5BS7A 4YS3C 5AV8D 3KUYC 1HQ3C 3B6FB 1M1AB 3V9RA 3MGQD 5CHLB 3C1CA 4AWLB 4H9PA 5AV5A 5B32D 1Q9CA 4J8UA 3B6GB 4CSRA 3AN2B 1KX5B 5GXQB 3NQJA 4H9OB 2ZY5A 4DQYB 3W98A 4WU9D 4J8WC 5B31B 3A6NB 3TU4D 5JRGA 4NE5A 3X1SB 2PYOB 5B0ZC 3WA9B 5B1LB 5B1MA 3X1TD 5B0YD 3F6TA 2CV5D 5BS7C 4X23C 5B24B 3MVDC 3LELD 5B40A 3AZJC 5B2IA 4R8PA 1KX4A 3LZ1B 2Y2KA 1F66B 4WU8A 1P3LA 3UTAA 2CWEA 4J8XB 5AY8B 3MGSA 5E5AD 3AZLB 4KUDB 4ZBJC 4H9QB 1P3FD 1P34A 4KGCA 1M18B 3W98C 3NQUA 3R45A 5B2JB 5CPJB 5DNMC 3AZIC 1P3PA 5B1MC 1ID3A 5JA4A 5GT3B 4JJNC 2NZDB 5B33D 4Z66D 1KX3B 1JFIA 3UTBC 3W96B 2Y2OA 5F99B 4J8VA 3MGPB 5AV9B 5B2IC 4R8PC 1N1JA 1P3BA 5AVBB 3WTPA 4QLCC 1AOID 1KX4C 3AZMD 2AROD 1P3LC 3UTAC 3MGQB 4Z2MH 3C1CB 4H9PB 3MGSC 1S32D 1P34C 1EQZA 1U35A 2NQBA 4CSRB 3AZKA 1M19A 2F8NG 1PZRA 4UUZA 1ID3C 5DNNA 2DF4C 3AV2D 4WU9B 2IO5C 3AZHA 3WAAD 4XZQD 2BYKA 2RVQD 3WKJA 2F2AC 1B67A 3O62C 3X1UD 1M1AD 1P3MA 5AVCD 2Y2IA 4J8VC 3X1TB 3W97A 1P3BC 3VH6T 3WTPC 3RELD 3B6GD 3LELB 5B40B 4NE6A 5CP6A 3AZGB 5GT0C 1EQZC 4WU8B 1U35C 2NQBC 3AZKC 1M19C 4LD9A 3MGRA 3EPKA 3H0RC 5E5AB 3WA9D 3B0CT 5B1LD 5DNNC 3KWQD 4XUJD 1P3FB 2HIOC 3P5JB 3AZHC 4H9SA 4DRAA 1P3PB 5B24D 1P3MC 5CPKA 3W97C 3B0BA 3B0DB 4KHAA 4YS3D 4Z66B 3KUYD 1BH8B 3LZ1D 1HQ3A 1F66D 5G49A 4J8XD 4M6BA 5AY8D 1H3OA
chains in the Genus database with same CATH topology
1N1JB 4KUDD 5CP6C 1AOIB 1P3KD 3KSYA 2AROB 1P3IC 1ZLAA 4LD9C 1P3AD 3MGRC 4EO5B 4CAYA 3X1VB 4G91C 4J8WA 4H9SC 3LJAA 3W96D 5B0ZD 5CPIB 3C1BA 1F1EA 3KXBC 2J8PA 3AZFC 3MGPD 1P3OA 3WAAB 3WKJB 4XZQB 4X23A 5AVBD 2HUEC 5C3IB 3AN2C 3X1UB 3REHC 5BT1C 3MVDA 5AVCB 3AYWA 3W99B 3C1CD 3AFAC 3AZJA 5JRGC 5AV5D 4ZUXA 4J8UD 3AZEB 3RELB 1ZLAC 1TZYC 5FUGA 3KFUG 3W98D 3REKC 3LJAC 5B31G 5DNMA 3AZIA 5B1MD 2Y2JA 3C1BC 1A7WA 4NE3A 3VH5T 3KWQB 4XUJB 1P3OC 3REJA 4JJNA 1WWIA 2ZM5A 3UTBA 1TAFB 3AZLC 3UT9A 3AYWC 5B40D 5CPKB 3REIA 5B2ID 2F8NA 4ZUXC 4YS3B 4H9RA 4QLCA 3AZGD 1KX4D 3KUYB 1HQ3B 4WU8D 1P3LD 1P3GA 3UTAD 3AZNC 3MGSD 4KGCD 4YM6A 1P34D 1KX3C 1P3KB 1P3AB 5B0YA 1P3PD 4CAYB 2CV5A 4WNNA 4J8WB 5AV8C 3REJC 5KDMA 3MGQC 3AFAA 5B0ZB 3O62A 4J8VD 3UT9C 2Y2LA 5B32C 3REIC 2JCHA 3VH5A 1P3BD 5BNXA 4X23B 3WTPD 2RIQA 1P3GC 3V9RB 3AZJB 4DRBA 5AV5B 3TU4C 3X1VD 5GT0A 2UWXA 4YM6C 1U35D 3WTPE 4J8UB 1EQZD 5BNVA 3AZKD 5B32G 1M19D 2FJ7A 2NQBD 2JSSA 3NQJB 1BH9A 2YFVA 5B0YC 5CPID 4ZBJB 2CV5C 5DNND 3W98B 3AZHD 2HIOA 3WKJD 3AV1A 5DNMB 3AZIB 5BO0A 5B1MB 2Y2PA 4G92C 5AV6A 1P3MD 3W99D 3W97D 4JJNB 4HGAC 3VH6W 3FDDA 3AZED 3LZ0A 5GSUA 5E5AC 2Y2QA 2YFWA 5B2IB 4R8PB 5CP6D 4QLCB 2BYMA 1KX4B 3MNNA 1P3LB 2FJ7C 3UTAB 1P3IA 4Z5TA 4LD9D 3MGRD 1WWSA 3MGSB 3B0CW 5B33C 1P34B 4KGCB 3NQUB 3R45B 3B6FA 2ZY2A 3AV1C 3AZFA 3KXBA 1ID3B 5AV6C 2JE5A 5CPKD 5JA4B 2IO5B 1Z2CB 5KDMB 3B6GA 3AZMC 4WV4B 1KX5A 3AN2A 1JFIB 5GXQA 1HQ3D 3REHA 5BT1D 3LZ0C 4J8VB 5GSUC 3A1IA 3AFAD 1S32C 2BG1A 2L5AA 4H9OA 5BNXB 1P3BB 5B31A 3A6NA 3WTPB 3H0MC 3X1SA 3VH6A 2PYOA 3MNNC 5B1LA 4Z5TC 1ZLAD 2Y2HA 1TZYA 3AV2C 3EPHA 1EQZB 4J8WD 1U35B 2NQBB 1T3UA 3AZKB 1M19B 3REKA 4Z2MG 1M1AC 3B6FC 3LJAD 3C1BD 4UUZB 4AWLC 5DNNB 1P3OD 2HIOB 3AZHB 3LZ1A 2BYKB 4X23D 3B6GC 1KX5C 5GXQC 5AY8A 3MVDD 3AZLA 3AYWD 1P3MB 3AZJD 4H9QA 3W97B 1M18A 5B31C 5B2JA 3A6NC 5CPJA 3X1SC 2PYOC 3WA9C 5B1LC 2YFWB 3AZNA 5GT3A 5CP6B 2NZDA 1KX3A 1W2EA 5B24C 4LD9B 5F99A 3MGRB 5DNMD 5AV9A 3AZID 3VH5W 4H9NA 4G91B 5AVBA 3REJD 5AV8A 4JJND 3LZ1C 1F66C 2F8NH 3MGQA 3UTBD 4J8XC 3AZFB 5AY8C 3KXBB 3UT9D 2W8SA 2Y2NA 4KUDC 3REID 5B32A 2F8ND 4R8PD 4KHAB 1P3KC 1M18C 5B2JC 2HUEB 4QLCD 5CPJC 3REHB 1P3AC 1P3GD 5G49B 3AFAB 5JRGB 1H3OB 4E44A 2G5IC 5GT3C 2LY8A 4WU9A 2NZDC 3TU4A 4YM6D 3W96C 3EPLA 1ZLAB 5F99C 4WZSB 1TZYB 3X1TA 3MGPC 5AV9C 4NFTA 1ID3D 3AL0C 5AVBC 3REKB 3LELA 3LJAB 3O62D 3C1CC 3C1BB 4UPKA 5AV5C 1P3OB 3AZGA 4J8UC 3EG5B 3H0LC 2XD1A 5E5AA 3A1KA 3MVDB 3AYWB 1P3FA 4ZUXB 4WU9C 5GT0D 2XD5A 2FJ7D 3AZNB 3X1TC 5FUGB 1BFMA 1B6WA 5B33A 4Z66A 2HIOD 1BH8A 3LELC 3AV1D 5B40C 5AV6D 4H9NB 5AV8B 3REJB 3AZGC 1AOIA 1R4VA 4WU8C 4E45A 2AROA 3AZMA 3UTBB 3LZ0D 5GSUD 3UT9B 2ZY3A 5B32B 3REIB 1S32A 3X1VA 2F8NB 4KGCC 1HTAA 2ZY4A 1P3FC 4H9RB 3MNND 1P3GB 5CPIA 1P3ID 4Z5TD 1P3PC 1KU5A 2FFFB 3AV2A 3WAAA 3B0DC 3TU4B 4XZQA 4YM6B 4Z66C 3X1UA 3IP4C 3B6FD 1M1AA 5AVCA 5B0YB 3W99A 3AZFD 3KXBD 2CV5B 4WNNB 1AOIC 3EPJA 3RELA 3AZEA 1KX5D 2AROC 3AN2D 5GXQD 3O62B 3REHD 4EO5C 4G92B 5JRGD 3X1VC 4HGAB 5B31D 3A6ND 3X1SD 2PYOD 2G5HC 5CPIC 3WA9A 1TZYD 3KWQA 4XUJA 3WAAC 3WKJC 4XZQC 5GT0B 2RVQC 5C3IC 5BNVB 2FJ7B 1TAFA 5B24A 3X1UC 3REKD 2VQRA 2DQNC 1BH9B 2YFVB 3W99C 5AVCC 1ULYA 5B33B 4WJ3C 4YS3A 3KUYA 1F66A 3AZEC 3RELC 2F8NK 3AV1B 4J8XA 5BO0B 3AZLD 2Y2GA 5AV6B 4KUDA 1M18D 1P3KA 4ZUXD 5B2JD 5CPJD 3AZMB 1P3AA 3LZ0B 5GSUB 3AZND 1S32B 3KWQC 4XUJC 5GT3D 2NZDD 2BYMB 1KX3D 3MNNB 3W96A 5B0ZA 1P3IB 4Z5TB 5F99D 5CPKC 5AV9D 2Y2MA 3MGPA 3AV2B 5BS7A 4YS3C 5AV8D 3KUYC 1HQ3C 3B6FB 1M1AB 3V9RA 3MGQD 5CHLB 3C1CA 4AWLB 4H9PA 5AV5A 5B32D 1Q9CA 4J8UA 3B6GB 4CSRA 3AN2B 1KX5B 5GXQB 3NQJA 4H9OB 2ZY5A 4DQYB 3W98A 4WU9D 4J8WC 5B31B 3A6NB 3TU4D 5JRGA 4NE5A 3X1SB 2PYOB 5B0ZC 3WA9B 5B1LB 5B1MA 3X1TD 5B0YD 3F6TA 2CV5D 5BS7C 4X23C 5B24B 3MVDC 3LELD 5B40A 3AZJC 5B2IA 4R8PA 1KX4A 3LZ1B 2Y2KA 1F66B 4WU8A 1P3LA 3UTAA 2CWEA 4J8XB 5AY8B 3MGSA 5E5AD 3AZLB 4KUDB 4ZBJC 4H9QB 1P3FD 1P34A 4KGCA 1M18B 3W98C 3NQUA 3R45A 5B2JB 5CPJB 5DNMC 3AZIC 1P3PA 5B1MC 1ID3A 5JA4A 5GT3B 4JJNC 2NZDB 5B33D 4Z66D 1KX3B 1JFIA 3UTBC 3W96B 2Y2OA 5F99B 4J8VA 3MGPB 5AV9B 5B2IC 4R8PC 1N1JA 1P3BA 5AVBB 3WTPA 4QLCC 1AOID 1KX4C 3AZMD 2AROD 1P3LC 3UTAC 3MGQB 4Z2MH 3C1CB 4H9PB 3MGSC 1S32D 1P34C 1EQZA 1U35A 2NQBA 4CSRB 3AZKA 1M19A 2F8NG 1PZRA 4UUZA 1ID3C 5DNNA 2DF4C 3AV2D 4WU9B 2IO5C 3AZHA 3WAAD 4XZQD 2BYKA 2RVQD 3WKJA 2F2AC 1B67A 3O62C 3X1UD 1M1AD 1P3MA 5AVCD 2Y2IA 4J8VC 3X1TB 3W97A 1P3BC 3VH6T 3WTPC 3RELD 3B6GD 3LELB 5B40B 4NE6A 5CP6A 3AZGB 5GT0C 1EQZC 4WU8B 1U35C 2NQBC 3AZKC 1M19C 4LD9A 3MGRA 3EPKA 3H0RC 5E5AB 3WA9D 3B0CT 5B1LD 5DNNC 3KWQD 4XUJD 1P3FB 2HIOC 3P5JB 3AZHC 4H9SA 4DRAA 1P3PB 5B24D 1P3MC 5CPKA 3W97C 3B0BA 3B0DB 4KHAA 4YS3D 4Z66B 3KUYD 1BH8B 3LZ1D 1HQ3A 1F66D 5G49A 4J8XD 4M6BA 5AY8D 1H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J B;  4KUD D;  5CP6 C;  1AOI B;  1P3K D;  3KSY A;  2ARO B;  1P3I C;  1ZLA A;  4LD9 C;  1P3A D;  3MGR C;  4EO5 B;  4CAY A;  3X1V B;  4G91 C;  4J8W A;  4H9S C;  3LJA A;  3W96 D;  5B0Z D;  5CPI B;  3C1B A;  1F1E A;  3KXB C;  3AZF C;  3MGP D;  1P3O A;  3WAA B;  3WKJ B;  4XZQ B;  4X23 A;  5AVB D;  2HUE C;  5C3I B;  3AN2 C;  3X1U B;  3REH C;  5BT1 C;  3MVD A;  5AVC B;  3AYW A;  3W99 B;  3C1C D;  3AFA C;  3AZJ A;  5JRG C;  5AV5 D;  4ZUX A;  4J8U D;  3AZE B;  3REL B;  1ZLA C;  1TZY C;  5FUG A;  3W98 D;  3REK C;  3LJA C;  5B31 G;  5DNM A;  3AZI A;  5B1M D;  3C1B C;  1A7W A;  4NE3 A;  3VH5 T;  3KWQ B;  4XUJ B;  1P3O C;  3REJ A;  4JJN A;  1WWI A;  3UTB A;  1TAF B;  3AZL C;  3UT9 A;  3AYW C;  5B40 D;  5CPK B;  3REI A;  5B2I D;  2F8N A;  4ZUX C;  4YS3 B;  4H9R A;  4QLC A;  3AZG D;  1KX4 D;  3KUY B;  1HQ3 B;  4WU8 D;  1P3L D;  1P3G A;  3UTA D;  3AZN C;  3MGS D;  4KGC D;  4YM6 A;  1P34 D;  1KX3 C;  1P3K B;  1P3A B;  5B0Y A;  1P3P D;  4CAY B;  2CV5 A;  4WNN A;  4J8W B;  5AV8 C;  3REJ C;  5KDM A;  3MGQ C;  3AFA A;  5B0Z B;  3O62 A;  4J8V D;  3UT9 C;  5B32 C;  3REI C;  5AY8 D;  3VH5 A;  1P3B D;  5BNX A;  4X23 B;  3WTP D;  1P3G C;  3V9R B;  3AZJ B;  4DRB A;  5AV5 B;  3TU4 C;  3X1V D;  5GT0 A;  4YM6 C;  1U35 D;  1EQZ D;  3WTP E;  4J8U B;  2NQB D;  5BNV A;  3AZK D;  5B32 G;  1M19 D;  2FJ7 A;  2JSS A;  3NQJ B;  1BH9 A;  2YFV A;  5B0Y C;  5CPI D;  4ZBJ B;  2CV5 C;  5DNN D;  3W98 B;  3AZH D;  2HIO A;  3WKJ D;  3AV1 A;  5DNM B;  3AZI B;  5BO0 A;  5B1M B;  4G92 C;  1P3M D;  5AV6 A;  3W99 D;  3W97 D;  4JJN B;  4HGA C;  3VH6 W;  3AZE D;  3LZ0 A;  5GSU A;  5E5A C;  2YFW A;  5B2I B;  4R8P B;  5CP6 D;  4QLC B;  2BYM A;  1KX4 B;  3MNN A;  1P3L B;  2FJ7 C;  3UTA B;  1P3I A;  4Z5T A;  4LD9 D;  3MGR D;  1WWS A;  3MGS B;  3B0C W;  5B33 C;  1P34 B;  4KGC B;  3NQU B;  3R45 B;  3B6F A;  3AV1 C;  3AZF A;  3KXB A;  1ID3 B;  5AV6 C;  5CPK D;  5JA4 B;  2IO5 B;  5KDM B;  3B6G A;  3AZM C;  4WV4 B;  1KX5 A;  3AN2 A;  1JFI B;  5GXQ A;  1HQ3 D;  3REH A;  5BT1 D;  3LZ0 C;  4J8V B;  5GSU C;  3AFA D;  1S32 C;  4H9O A;  2L5A A;  5BNX B;  1P3B B;  5B31 A;  3A6N A;  3WTP B;  3X1S A;  3VH6 A;  2PYO A;  3MNN C;  5B1L A;  4Z5T C;  1ZLA D;  1TZY A;  3AV2 C;  1EQZ B;  4J8W D;  1U35 B;  2NQB B;  3AZK B;  1M19 B;  3REK A;  4Z2M G;  1M1A C;  3B6F C;  3LJA D;  3C1B D;  4UUZ B;  4AWL C;  5DNN B;  1P3O D;  2HIO B;  3AZH B;  3LZ1 A;  2BYK B;  4X23 D;  3B6G C;  1KX5 C;  5GXQ C;  5AY8 A;  3MVD D;  3AZL A;  3AYW D;  1P3M B;  3AZJ D;  4H9Q A;  3W97 B;  1M18 A;  5B31 C;  5B2J A;  3A6N C;  5CPJ A;  3X1S C;  2PYO C;  3WA9 C;  5B1L C;  2YFW B;  3AZN A;  5GT3 A;  5CP6 B;  2NZD A;  1KX3 A;  5B24 C;  4LD9 B;  5F99 A;  3MGR B;  5DNM D;  5AV9 A;  3AZI D;  3VH5 W;  4H9N A;  4G91 B;  5AVB A;  3REJ D;  5AV8 A;  4JJN D;  3LZ1 C;  1F66 C;  2F8N H;  3MGQ A;  3UTB D;  4J8X C;  3AZF B;  5AY8 C;  3KXB B;  3UT9 D;  4KUD C;  3REI D;  5B32 A;  2F8N D;  4R8P D;  4KHA B;  1P3K C;  1M18 C;  5B2J C;  2HUE B;  4QLC D;  5CPJ C;  3REH B;  1P3A C;  1P3G D;  5G49 B;  3AFA B;  5JRG B;  1H3O B;  4E44 A;  5GT3 C;  2LY8 A;  4WU9 A;  2NZD C;  3TU4 A;  4YM6 D;  3W96 C;  1ZLA B;  5F99 C;  4WZS B;  1TZY B;  3X1T A;  3MGP C;  5AV9 C;  4NFT A;  1ID3 D;  5AVB C;  3REK B;  3LEL A;  3LJA B;  3O62 D;  3C1C C;  3C1B B;  5AV5 C;  1P3O B;  3AZG A;  4J8U C;  5E5A A;  3MVD B;  3AYW B;  1P3F A;  4ZUX B;  4WU9 C;  5GT0 D;  2FJ7 D;  3AZN B;  3X1T C;  5FUG B;  1BFM A;  1B6W A;  5B33 A;  4Z66 A;  2HIO D;  1BH8 A;  3LEL C;  3AV1 D;  5B40 C;  5AV6 D;  4H9N B;  5AV8 B;  3REJ B;  3AZG C;  1AOI A;  1R4V A;  4WU8 C;  4E45 A;  2ARO A;  3AZM A;  3UTB B;  3LZ0 D;  5GSU D;  3UT9 B;  5B32 B;  3REI B;  1S32 A;  3X1V A;  2F8N B;  4KGC C;  1HTA A;  1P3F C;  4H9R B;  3MNN D;  1P3G B;  5CPI A;  1P3I D;  4Z5T D;  1P3P C;  1KU5 A;  3AV2 A;  3WAA A;  3B0D C;  3TU4 B;  4XZQ A;  4YM6 B;  4Z66 C;  3X1U A;  3B6F D;  1M1A A;  5AVC A;  5B0Y B;  3W99 A;  3AZF D;  3KXB D;  2CV5 B;  4WNN B;  1AOI C;  3AZE A;  3REL A;  1KX5 D;  2ARO C;  3AN2 D;  5GXQ D;  3O62 B;  3REH D;  4EO5 C;  4G92 B;  5JRG D;  3X1V C;  4HGA B;  5B31 D;  3A6N D;  3X1S D;  2PYO D;  5CPI C;  3WA9 A;  1TZY D;  3KWQ A;  4XUJ A;  3WAA C;  3WKJ C;  4XZQ C;  5GT0 B;  2RVQ C;  5C3I C;  5BNV B;  2FJ7 B;  1TAF A;  5B24 A;  3X1U C;  3REK D;  5AVC C;  1BH9 B;  2YFV B;  3W99 C;  1ULY A;  5B33 B;  4YS3 A;  3KUY A;  1F66 A;  3AZE C;  3REL C;  2F8N K;  3AV1 B;  4J8X A;  5BO0 B;  3AZL D;  5AV6 B;  4KUD A;  1M18 D;  1P3K A;  4ZUX D;  5B2J D;  5CPJ D;  3AZM B;  1P3A A;  3LZ0 B;  5GSU B;  3AZN D;  1S32 B;  3KWQ C;  4XUJ C;  5GT3 D;  2NZD D;  2BYM B;  1KX3 D;  3MNN B;  3W96 A;  5B0Z A;  1P3I B;  4Z5T B;  5F99 D;  5CPK C;  5AV9 D;  3MGP A;  3AV2 B;  5BS7 A;  4YS3 C;  5AV8 D;  3KUY C;  1HQ3 C;  3B6F B;  1M1A B;  3V9R A;  3MGQ D;  5CHL B;  3C1C A;  4AWL B;  4H9P A;  5AV5 A;  5B32 D;  1Q9C A;  4J8U A;  3B6G B;  4CSR A;  3AN2 B;  1KX5 B;  5GXQ B;  3NQJ A;  4H9O B;  3W98 A;  4WU9 D;  4J8W C;  5B31 B;  3A6N B;  3TU4 D;  4NE5 A;  3X1S B;  2PYO B;  5B0Z C;  3WA9 B;  5B1L B;  5B1M A;  3X1T D;  5B0Y D;  2CV5 D;  5BS7 C;  4X23 C;  5B24 B;  3MVD C;  3LEL D;  5B40 A;  3AZJ C;  5B2I A;  4R8P A;  1KX4 A;  3LZ1 B;  1F66 B;  4WU8 A;  1P3L A;  3UTA A;  2CWE A;  4J8X B;  5AY8 B;  3MGS A;  5E5A D;  3AZL B;  4KUD B;  4ZBJ C;  4H9Q B;  1P3F D;  1P34 A;  4KGC A;  1M18 B;  3W98 C;  3NQU A;  3R45 A;  5B2J B;  5CPJ B;  5DNM C;  3AZI C;  1P3P A;  5B1M C;  1ID3 A;  5JA4 A;  5GT3 B;  4JJN C;  2NZD B;  5B33 D;  4Z66 D;  1KX3 B;  1JFI A;  3UTB C;  3W96 B;  5F99 B;  4J8V A;  3MGP B;  5AV9 B;  5B2I C;  4R8P C;  1N1J A;  1P3B A;  5AVB B;  3WTP A;  4QLC C;  1AOI D;  1KX4 C;  3AZM D;  2ARO D;  1P3L C;  3UTA C;  3MGQ B;  4Z2M H;  3C1C B;  4H9P B;  3MGS C;  1S32 D;  1P34 C;  1EQZ A;  1U35 A;  2NQB A;  4CSR B;  3AZK A;  1M19 A;  2F8N G;  4UUZ A;  1ID3 C;  5DNN A;  3AV2 D;  4WU9 B;  2IO5 C;  3AZH A;  3WAA D;  4XZQ D;  2BYK A;  2RVQ D;  3WKJ A;  1B67 A;  3O62 C;  3X1U D;  1M1A D;  1P3M A;  5AVC D;  4J8V C;  3X1T B;  3W97 A;  1P3B C;  3VH6 T;  3WTP C;  3REL D;  3B6G D;  3LEL B;  5B40 B;  4NE6 A;  5CP6 A;  3AZG B;  5GT0 C;  1EQZ C;  4WU8 B;  1U35 C;  2NQB C;  3AZK C;  1M19 C;  4LD9 A;  3MGR A;  5E5A B;  3WA9 D;  3B0C T;  5B1L D;  5DNN C;  3KWQ D;  4XUJ D;  1P3F B;  2HIO C;  3AZH C;  4H9S A;  4DRA A;  1P3P B;  5B24 D;  1P3M C;  5CPK A;  3W97 C;  3B0B A;  3B0D B;  4KHA A;  4YS3 D;  4Z66 B;  3KUY D;  1BH8 B;  3LZ1 D;  1HQ3 A;  1F66 D;  5G49 A;  4J8X D;  4M6B A;  5JRG A;  1H3O A; 
#chains in the Genus database with same CATH topology
 1N1J B;  4KUD D;  5CP6 C;  1AOI B;  1P3K D;  3KSY A;  2ARO B;  1P3I C;  1ZLA A;  4LD9 C;  1P3A D;  3MGR C;  4EO5 B;  4CAY A;  3X1V B;  4G91 C;  4J8W A;  4H9S C;  3LJA A;  3W96 D;  5B0Z D;  5CPI B;  3C1B A;  1F1E A;  3KXB C;  2J8P A;  3AZF C;  3MGP D;  1P3O A;  3WAA B;  3WKJ B;  4XZQ B;  4X23 A;  5AVB D;  2HUE C;  5C3I B;  3AN2 C;  3X1U B;  3REH C;  5BT1 C;  3MVD A;  5AVC B;  3AYW A;  3W99 B;  3C1C D;  3AFA C;  3AZJ A;  5JRG C;  5AV5 D;  4ZUX A;  4J8U D;  3AZE B;  3REL B;  1ZLA C;  1TZY C;  5FUG A;  3KFU G;  3W98 D;  3REK C;  3LJA C;  5B31 G;  5DNM A;  3AZI A;  5B1M D;  2Y2J A;  3C1B C;  1A7W A;  4NE3 A;  3VH5 T;  3KWQ B;  4XUJ B;  1P3O C;  3REJ A;  4JJN A;  1WWI A;  2ZM5 A;  3UTB A;  1TAF B;  3AZL C;  3UT9 A;  3AYW C;  5B40 D;  5CPK B;  3REI A;  5B2I D;  2F8N A;  4ZUX C;  4YS3 B;  4H9R A;  4QLC A;  3AZG D;  1KX4 D;  3KUY B;  1HQ3 B;  4WU8 D;  1P3L D;  1P3G A;  3UTA D;  3AZN C;  3MGS D;  4KGC D;  4YM6 A;  1P34 D;  1KX3 C;  1P3K B;  1P3A B;  5B0Y A;  1P3P D;  4CAY B;  2CV5 A;  4WNN A;  4J8W B;  5AV8 C;  3REJ C;  5KDM A;  3MGQ C;  3AFA A;  5B0Z B;  3O62 A;  4J8V D;  3UT9 C;  2Y2L A;  5B32 C;  3REI C;  2JCH A;  3VH5 A;  1P3B D;  5BNX A;  4X23 B;  3WTP D;  2RIQ A;  1P3G C;  3V9R B;  3AZJ B;  4DRB A;  5AV5 B;  3TU4 C;  3X1V D;  5GT0 A;  2UWX A;  4YM6 C;  1U35 D;  3WTP E;  4J8U B;  1EQZ D;  5BNV A;  3AZK D;  5B32 G;  1M19 D;  2FJ7 A;  2NQB D;  2JSS A;  3NQJ B;  1BH9 A;  2YFV A;  5B0Y C;  5CPI D;  4ZBJ B;  2CV5 C;  5DNN D;  3W98 B;  3AZH D;  2HIO A;  3WKJ D;  3AV1 A;  5DNM B;  3AZI B;  5BO0 A;  5B1M B;  2Y2P A;  4G92 C;  5AV6 A;  1P3M D;  3W99 D;  3W97 D;  4JJN B;  4HGA C;  3VH6 W;  3FDD A;  3AZE D;  3LZ0 A;  5GSU A;  5E5A C;  2Y2Q A;  2YFW A;  5B2I B;  4R8P B;  5CP6 D;  4QLC B;  2BYM A;  1KX4 B;  3MNN A;  1P3L B;  2FJ7 C;  3UTA B;  1P3I A;  4Z5T A;  4LD9 D;  3MGR D;  1WWS A;  3MGS B;  3B0C W;  5B33 C;  1P34 B;  4KGC B;  3NQU B;  3R45 B;  3B6F A;  2ZY2 A;  3AV1 C;  3AZF A;  3KXB A;  1ID3 B;  5AV6 C;  2JE5 A;  5CPK D;  5JA4 B;  2IO5 B;  1Z2C B;  5KDM B;  3B6G A;  3AZM C;  4WV4 B;  1KX5 A;  3AN2 A;  1JFI B;  5GXQ A;  1HQ3 D;  3REH A;  5BT1 D;  3LZ0 C;  4J8V B;  5GSU C;  3A1I A;  3AFA D;  1S32 C;  2BG1 A;  2L5A A;  4H9O A;  5BNX B;  1P3B B;  5B31 A;  3A6N A;  3WTP B;  3H0M C;  3X1S A;  3VH6 A;  2PYO A;  3MNN C;  5B1L A;  4Z5T C;  1ZLA D;  2Y2H A;  1TZY A;  3AV2 C;  3EPH A;  1EQZ B;  4J8W D;  1U35 B;  2NQB B;  1T3U A;  3AZK B;  1M19 B;  3REK A;  4Z2M G;  1M1A C;  3B6F C;  3LJA D;  3C1B D;  4UUZ B;  4AWL C;  5DNN B;  1P3O D;  2HIO B;  3AZH B;  3LZ1 A;  2BYK B;  4X23 D;  3B6G C;  1KX5 C;  5GXQ C;  5AY8 A;  3MVD D;  3AZL A;  3AYW D;  1P3M B;  3AZJ D;  4H9Q A;  3W97 B;  1M18 A;  5B31 C;  5B2J A;  3A6N C;  5CPJ A;  3X1S C;  2PYO C;  3WA9 C;  5B1L C;  2YFW B;  3AZN A;  5GT3 A;  5CP6 B;  2NZD A;  1KX3 A;  1W2E A;  5B24 C;  4LD9 B;  5F99 A;  3MGR B;  5DNM D;  5AV9 A;  3AZI D;  3VH5 W;  4H9N A;  4G91 B;  5AVB A;  3REJ D;  5AV8 A;  4JJN D;  3LZ1 C;  1F66 C;  2F8N H;  3MGQ A;  3UTB D;  4J8X C;  3AZF B;  5AY8 C;  3KXB B;  3UT9 D;  2W8S A;  2Y2N A;  4KUD C;  3REI D;  5B32 A;  2F8N D;  4R8P D;  4KHA B;  1P3K C;  1M18 C;  5B2J C;  2HUE B;  4QLC D;  5CPJ C;  3REH B;  1P3A C;  1P3G D;  5G49 B;  3AFA B;  5JRG B;  1H3O B;  4E44 A;  2G5I C;  5GT3 C;  2LY8 A;  4WU9 A;  2NZD C;  3TU4 A;  4YM6 D;  3W96 C;  3EPL A;  1ZLA B;  5F99 C;  4WZS B;  1TZY B;  3X1T A;  3MGP C;  5AV9 C;  4NFT A;  1ID3 D;  3AL0 C;  5AVB C;  3REK B;  3LEL A;  3LJA B;  3O62 D;  3C1C C;  3C1B B;  4UPK A;  5AV5 C;  1P3O B;  3AZG A;  4J8U C;  3EG5 B;  3H0L C;  2XD1 A;  5E5A A;  3A1K A;  3MVD B;  3AYW B;  1P3F A;  4ZUX B;  4WU9 C;  5GT0 D;  2XD5 A;  2FJ7 D;  3AZN B;  3X1T C;  5FUG B;  1BFM A;  1B6W A;  5B33 A;  4Z66 A;  2HIO D;  1BH8 A;  3LEL C;  3AV1 D;  5B40 C;  5AV6 D;  4H9N B;  5AV8 B;  3REJ B;  3AZG C;  1AOI A;  1R4V A;  4WU8 C;  4E45 A;  2ARO A;  3AZM A;  3UTB B;  3LZ0 D;  5GSU D;  3UT9 B;  2ZY3 A;  5B32 B;  3REI B;  1S32 A;  3X1V A;  2F8N B;  4KGC C;  1HTA A;  2ZY4 A;  1P3F C;  4H9R B;  3MNN D;  1P3G B;  5CPI A;  1P3I D;  4Z5T D;  1P3P C;  1KU5 A;  2FFF B;  3AV2 A;  3WAA A;  3B0D C;  3TU4 B;  4XZQ A;  4YM6 B;  4Z66 C;  3X1U A;  3IP4 C;  3B6F D;  1M1A A;  5AVC A;  5B0Y B;  3W99 A;  3AZF D;  3KXB D;  2CV5 B;  4WNN B;  1AOI C;  3EPJ A;  3REL A;  3AZE A;  1KX5 D;  2ARO C;  3AN2 D;  5GXQ D;  3O62 B;  3REH D;  4EO5 C;  4G92 B;  5JRG D;  3X1V C;  4HGA B;  5B31 D;  3A6N D;  3X1S D;  2PYO D;  2G5H C;  5CPI C;  3WA9 A;  1TZY D;  3KWQ A;  4XUJ A;  3WAA C;  3WKJ C;  4XZQ C;  5GT0 B;  2RVQ C;  5C3I C;  5BNV B;  2FJ7 B;  1TAF A;  5B24 A;  3X1U C;  3REK D;  2VQR A;  2DQN C;  1BH9 B;  2YFV B;  3W99 C;  5AVC C;  1ULY A;  5B33 B;  4WJ3 C;  4YS3 A;  3KUY A;  1F66 A;  3AZE C;  3REL C;  2F8N K;  3AV1 B;  4J8X A;  5BO0 B;  3AZL D;  2Y2G A;  5AV6 B;  4KUD A;  1M18 D;  1P3K A;  4ZUX D;  5B2J D;  5CPJ D;  3AZM B;  1P3A A;  3LZ0 B;  5GSU B;  3AZN D;  1S32 B;  3KWQ C;  4XUJ C;  5GT3 D;  2NZD D;  2BYM B;  1KX3 D;  3MNN B;  3W96 A;  5B0Z A;  1P3I B;  4Z5T B;  5F99 D;  5CPK C;  5AV9 D;  2Y2M A;  3MGP A;  3AV2 B;  5BS7 A;  4YS3 C;  5AV8 D;  3KUY C;  1HQ3 C;  3B6F B;  1M1A B;  3V9R A;  3MGQ D;  5CHL B;  3C1C A;  4AWL B;  4H9P A;  5AV5 A;  5B32 D;  1Q9C A;  4J8U A;  3B6G B;  4CSR A;  3AN2 B;  1KX5 B;  5GXQ B;  3NQJ A;  4H9O B;  2ZY5 A;  4DQY B;  3W98 A;  4WU9 D;  4J8W C;  5B31 B;  3A6N B;  3TU4 D;  5JRG A;  4NE5 A;  3X1S B;  2PYO B;  5B0Z C;  3WA9 B;  5B1L B;  5B1M A;  3X1T D;  5B0Y D;  3F6T A;  2CV5 D;  5BS7 C;  4X23 C;  5B24 B;  3MVD C;  3LEL D;  5B40 A;  3AZJ C;  5B2I A;  4R8P A;  1KX4 A;  3LZ1 B;  2Y2K A;  1F66 B;  4WU8 A;  1P3L A;  3UTA A;  2CWE A;  4J8X B;  5AY8 B;  3MGS A;  5E5A D;  3AZL B;  4KUD B;  4ZBJ C;  4H9Q B;  1P3F D;  1P34 A;  4KGC A;  1M18 B;  3W98 C;  3NQU A;  3R45 A;  5B2J B;  5CPJ B;  5DNM C;  3AZI C;  1P3P A;  5B1M C;  1ID3 A;  5JA4 A;  5GT3 B;  4JJN C;  2NZD B;  5B33 D;  4Z66 D;  1KX3 B;  1JFI A;  3UTB C;  3W96 B;  2Y2O A;  5F99 B;  4J8V A;  3MGP B;  5AV9 B;  5B2I C;  4R8P C;  1N1J A;  1P3B A;  5AVB B;  3WTP A;  4QLC C;  1AOI D;  1KX4 C;  3AZM D;  2ARO D;  1P3L C;  3UTA C;  3MGQ B;  4Z2M H;  3C1C B;  4H9P B;  3MGS C;  1S32 D;  1P34 C;  1EQZ A;  1U35 A;  2NQB A;  4CSR B;  3AZK A;  1M19 A;  2F8N G;  1PZR A;  4UUZ A;  1ID3 C;  5DNN A;  2DF4 C;  3AV2 D;  4WU9 B;  2IO5 C;  3AZH A;  3WAA D;  4XZQ D;  2BYK A;  2RVQ D;  3WKJ A;  2F2A C;  1B67 A;  3O62 C;  3X1U D;  1M1A D;  1P3M A;  5AVC D;  2Y2I A;  4J8V C;  3X1T B;  3W97 A;  1P3B C;  3VH6 T;  3WTP C;  3REL D;  3B6G D;  3LEL B;  5B40 B;  4NE6 A;  5CP6 A;  3AZG B;  5GT0 C;  1EQZ C;  4WU8 B;  1U35 C;  2NQB C;  3AZK C;  1M19 C;  4LD9 A;  3MGR A;  3EPK A;  3H0R C;  5E5A B;  3WA9 D;  3B0C T;  5B1L D;  5DNN C;  3KWQ D;  4XUJ D;  1P3F B;  2HIO C;  3P5J B;  3AZH C;  4H9S A;  4DRA A;  1P3P B;  5B24 D;  1P3M C;  5CPK A;  3W97 C;  3B0B A;  3B0D B;  4KHA A;  4YS3 D;  4Z66 B;  3KUY D;  1BH8 B;  3LZ1 D;  1HQ3 A;  1F66 D;  5G49 A;  4J8X D;  4M6B A;  5AY8 D;  1H3O A; 
#chains in the Genus database with same CATH homology
 1N1J B;  4KUD D;  5CP6 C;  1AOI B;  1P3K D;  3KSY A;  2ARO B;  1P3I C;  1ZLA A;  4LD9 C;  1P3A D;  3MGR C;  4EO5 B;  4CAY A;  3X1V B;  4G91 C;  4J8W A;  4H9S C;  3LJA A;  3W96 D;  5B0Z D;  5CPI B;  3C1B A;  1F1E A;  3KXB C;  2J8P A;  3AZF C;  3MGP D;  1P3O A;  3WAA B;  3WKJ B;  4XZQ B;  4X23 A;  5AVB D;  2HUE C;  5C3I B;  3AN2 C;  3X1U B;  3REH C;  5BT1 C;  3MVD A;  5AVC B;  3AYW A;  3W99 B;  3C1C D;  3AFA C;  3AZJ A;  5JRG C;  5AV5 D;  4ZUX A;  4J8U D;  3AZE B;  3REL B;  1ZLA C;  1TZY C;  5FUG A;  3KFU G;  3W98 D;  3REK C;  3LJA C;  5B31 G;  5DNM A;  3AZI A;  5B1M D;  2Y2J A;  3C1B C;  1A7W A;  4NE3 A;  3VH5 T;  3KWQ B;  4XUJ B;  1P3O C;  3REJ A;  4JJN A;  1WWI A;  2ZM5 A;  3UTB A;  1TAF B;  3AZL C;  3UT9 A;  3AYW C;  5B40 D;  5CPK B;  3REI A;  5B2I D;  2F8N A;  4ZUX C;  4YS3 B;  4H9R A;  4QLC A;  3AZG D;  1KX4 D;  3KUY B;  1HQ3 B;  4WU8 D;  1P3L D;  1P3G A;  3UTA D;  3AZN C;  3MGS D;  4KGC D;  4YM6 A;  1P34 D;  1KX3 C;  1P3K B;  1P3A B;  5B0Y A;  1P3P D;  4CAY B;  2CV5 A;  4WNN A;  4J8W B;  5AV8 C;  3REJ C;  5KDM A;  3MGQ C;  3AFA A;  5B0Z B;  3O62 A;  4J8V D;  3UT9 C;  2Y2L A;  5B32 C;  3REI C;  2JCH A;  3VH5 A;  1P3B D;  5BNX A;  4X23 B;  3WTP D;  2RIQ A;  1P3G C;  3V9R B;  3AZJ B;  4DRB A;  5AV5 B;  3TU4 C;  3X1V D;  5GT0 A;  2UWX A;  4YM6 C;  1U35 D;  3WTP E;  4J8U B;  1EQZ D;  5BNV A;  3AZK D;  5B32 G;  1M19 D;  2FJ7 A;  2NQB D;  2JSS A;  3NQJ B;  1BH9 A;  2YFV A;  5B0Y C;  5CPI D;  4ZBJ B;  2CV5 C;  5DNN D;  3W98 B;  3AZH D;  2HIO A;  3WKJ D;  3AV1 A;  5DNM B;  3AZI B;  5BO0 A;  5B1M B;  2Y2P A;  4G92 C;  5AV6 A;  1P3M D;  3W99 D;  3W97 D;  4JJN B;  4HGA C;  3VH6 W;  3FDD A;  3AZE D;  3LZ0 A;  5GSU A;  5E5A C;  2Y2Q A;  2YFW A;  5B2I B;  4R8P B;  5CP6 D;  4QLC B;  2BYM A;  1KX4 B;  3MNN A;  1P3L B;  2FJ7 C;  3UTA B;  1P3I A;  4Z5T A;  4LD9 D;  3MGR D;  1WWS A;  3MGS B;  3B0C W;  5B33 C;  1P34 B;  4KGC B;  3NQU B;  3R45 B;  3B6F A;  2ZY2 A;  3AV1 C;  3AZF A;  3KXB A;  1ID3 B;  5AV6 C;  2JE5 A;  5CPK D;  5JA4 B;  2IO5 B;  1Z2C B;  5KDM B;  3B6G A;  3AZM C;  4WV4 B;  1KX5 A;  3AN2 A;  1JFI B;  5GXQ A;  1HQ3 D;  3REH A;  5BT1 D;  3LZ0 C;  4J8V B;  5GSU C;  3A1I A;  3AFA D;  1S32 C;  2BG1 A;  2L5A A;  4H9O A;  5BNX B;  1P3B B;  5B31 A;  3A6N A;  3WTP B;  3H0M C;  3X1S A;  3VH6 A;  2PYO A;  3MNN C;  5B1L A;  4Z5T C;  1ZLA D;  2Y2H A;  1TZY A;  3AV2 C;  3EPH A;  1EQZ B;  4J8W D;  1U35 B;  2NQB B;  1T3U A;  3AZK B;  1M19 B;  3REK A;  4Z2M G;  1M1A C;  3B6F C;  3LJA D;  3C1B D;  4UUZ B;  4AWL C;  5DNN B;  1P3O D;  2HIO B;  3AZH B;  3LZ1 A;  2BYK B;  4X23 D;  3B6G C;  1KX5 C;  5GXQ C;  5AY8 A;  3MVD D;  3AZL A;  3AYW D;  1P3M B;  3AZJ D;  4H9Q A;  3W97 B;  1M18 A;  5B31 C;  5B2J A;  3A6N C;  5CPJ A;  3X1S C;  2PYO C;  3WA9 C;  5B1L C;  2YFW B;  3AZN A;  5GT3 A;  5CP6 B;  2NZD A;  1KX3 A;  1W2E A;  5B24 C;  4LD9 B;  5F99 A;  3MGR B;  5DNM D;  5AV9 A;  3AZI D;  3VH5 W;  4H9N A;  4G91 B;  5AVB A;  3REJ D;  5AV8 A;  4JJN D;  3LZ1 C;  1F66 C;  2F8N H;  3MGQ A;  3UTB D;  4J8X C;  3AZF B;  5AY8 C;  3KXB B;  3UT9 D;  2W8S A;  2Y2N A;  4KUD C;  3REI D;  5B32 A;  2F8N D;  4R8P D;  4KHA B;  1P3K C;  1M18 C;  5B2J C;  2HUE B;  4QLC D;  5CPJ C;  3REH B;  1P3A C;  1P3G D;  5G49 B;  3AFA B;  5JRG B;  1H3O B;  4E44 A;  2G5I C;  5GT3 C;  2LY8 A;  4WU9 A;  2NZD C;  3TU4 A;  4YM6 D;  3W96 C;  3EPL A;  1ZLA B;  5F99 C;  4WZS B;  1TZY B;  3X1T A;  3MGP C;  5AV9 C;  4NFT A;  1ID3 D;  3AL0 C;  5AVB C;  3REK B;  3LEL A;  3LJA B;  3O62 D;  3C1C C;  3C1B B;  4UPK A;  5AV5 C;  1P3O B;  3AZG A;  4J8U C;  3EG5 B;  3H0L C;  2XD1 A;  5E5A A;  3A1K A;  3MVD B;  3AYW B;  1P3F A;  4ZUX B;  4WU9 C;  5GT0 D;  2XD5 A;  2FJ7 D;  3AZN B;  3X1T C;  5FUG B;  1BFM A;  1B6W A;  5B33 A;  4Z66 A;  2HIO D;  1BH8 A;  3LEL C;  3AV1 D;  5B40 C;  5AV6 D;  4H9N B;  5AV8 B;  3REJ B;  3AZG C;  1AOI A;  1R4V A;  4WU8 C;  4E45 A;  2ARO A;  3AZM A;  3UTB B;  3LZ0 D;  5GSU D;  3UT9 B;  2ZY3 A;  5B32 B;  3REI B;  1S32 A;  3X1V A;  2F8N B;  4KGC C;  1HTA A;  2ZY4 A;  1P3F C;  4H9R B;  3MNN D;  1P3G B;  5CPI A;  1P3I D;  4Z5T D;  1P3P C;  1KU5 A;  2FFF B;  3AV2 A;  3WAA A;  3B0D C;  3TU4 B;  4XZQ A;  4YM6 B;  4Z66 C;  3X1U A;  3IP4 C;  3B6F D;  1M1A A;  5AVC A;  5B0Y B;  3W99 A;  3AZF D;  3KXB D;  2CV5 B;  4WNN B;  1AOI C;  3EPJ A;  3REL A;  3AZE A;  1KX5 D;  2ARO C;  3AN2 D;  5GXQ D;  3O62 B;  3REH D;  4EO5 C;  4G92 B;  5JRG D;  3X1V C;  4HGA B;  5B31 D;  3A6N D;  3X1S D;  2PYO D;  2G5H C;  5CPI C;  3WA9 A;  1TZY D;  3KWQ A;  4XUJ A;  3WAA C;  3WKJ C;  4XZQ C;  5GT0 B;  2RVQ C;  5C3I C;  5BNV B;  2FJ7 B;  1TAF A;  5B24 A;  3X1U C;  3REK D;  2VQR A;  2DQN C;  1BH9 B;  2YFV B;  3W99 C;  5AVC C;  1ULY A;  5B33 B;  4WJ3 C;  4YS3 A;  3KUY A;  1F66 A;  3AZE C;  3REL C;  2F8N K;  3AV1 B;  4J8X A;  5BO0 B;  3AZL D;  2Y2G A;  5AV6 B;  4KUD A;  1M18 D;  1P3K A;  4ZUX D;  5B2J D;  5CPJ D;  3AZM B;  1P3A A;  3LZ0 B;  5GSU B;  3AZN D;  1S32 B;  3KWQ C;  4XUJ C;  5GT3 D;  2NZD D;  2BYM B;  1KX3 D;  3MNN B;  3W96 A;  5B0Z A;  1P3I B;  4Z5T B;  5F99 D;  5CPK C;  5AV9 D;  2Y2M A;  3MGP A;  3AV2 B;  5BS7 A;  4YS3 C;  5AV8 D;  3KUY C;  1HQ3 C;  3B6F B;  1M1A B;  3V9R A;  3MGQ D;  5CHL B;  3C1C A;  4AWL B;  4H9P A;  5AV5 A;  5B32 D;  1Q9C A;  4J8U A;  3B6G B;  4CSR A;  3AN2 B;  1KX5 B;  5GXQ B;  3NQJ A;  4H9O B;  2ZY5 A;  4DQY B;  3W98 A;  4WU9 D;  4J8W C;  5B31 B;  3A6N B;  3TU4 D;  5JRG A;  4NE5 A;  3X1S B;  2PYO B;  5B0Z C;  3WA9 B;  5B1L B;  5B1M A;  3X1T D;  5B0Y D;  3F6T A;  2CV5 D;  5BS7 C;  4X23 C;  5B24 B;  3MVD C;  3LEL D;  5B40 A;  3AZJ C;  5B2I A;  4R8P A;  1KX4 A;  3LZ1 B;  2Y2K A;  1F66 B;  4WU8 A;  1P3L A;  3UTA A;  2CWE A;  4J8X B;  5AY8 B;  3MGS A;  5E5A D;  3AZL B;  4KUD B;  4ZBJ C;  4H9Q B;  1P3F D;  1P34 A;  4KGC A;  1M18 B;  3W98 C;  3NQU A;  3R45 A;  5B2J B;  5CPJ B;  5DNM C;  3AZI C;  1P3P A;  5B1M C;  1ID3 A;  5JA4 A;  5GT3 B;  4JJN C;  2NZD B;  5B33 D;  4Z66 D;  1KX3 B;  1JFI A;  3UTB C;  3W96 B;  2Y2O A;  5F99 B;  4J8V A;  3MGP B;  5AV9 B;  5B2I C;  4R8P C;  1N1J A;  1P3B A;  5AVB B;  3WTP A;  4QLC C;  1AOI D;  1KX4 C;  3AZM D;  2ARO D;  1P3L C;  3UTA C;  3MGQ B;  4Z2M H;  3C1C B;  4H9P B;  3MGS C;  1S32 D;  1P34 C;  1EQZ A;  1U35 A;  2NQB A;  4CSR B;  3AZK A;  1M19 A;  2F8N G;  1PZR A;  4UUZ A;  1ID3 C;  5DNN A;  2DF4 C;  3AV2 D;  4WU9 B;  2IO5 C;  3AZH A;  3WAA D;  4XZQ D;  2BYK A;  2RVQ D;  3WKJ A;  2F2A C;  1B67 A;  3O62 C;  3X1U D;  1M1A D;  1P3M A;  5AVC D;  2Y2I A;  4J8V C;  3X1T B;  3W97 A;  1P3B C;  3VH6 T;  3WTP C;  3REL D;  3B6G D;  3LEL B;  5B40 B;  4NE6 A;  5CP6 A;  3AZG B;  5GT0 C;  1EQZ C;  4WU8 B;  1U35 C;  2NQB C;  3AZK C;  1M19 C;  4LD9 A;  3MGR A;  3EPK A;  3H0R C;  5E5A B;  3WA9 D;  3B0C T;  5B1L D;  5DNN C;  3KWQ D;  4XUJ D;  1P3F B;  2HIO C;  3P5J B;  3AZH C;  4H9S A;  4DRA A;  1P3P B;  5B24 D;  1P3M C;  5CPK A;  3W97 C;  3B0B A;  3B0D B;  4KHA A;  4YS3 D;  4Z66 B;  3KUY D;  1BH8 B;  3LZ1 D;  1HQ3 A;  1F66 D;  5G49 A;  4J8X D;  4M6B A;  5AY8 D;  1H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...