1P3AA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKHVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3aA00
3B0DC 4CAYA 1M1AC 3C1BA 3MVDB 3AZJB 5B24A 1P3PB 3AZFD 5AVCD 4ZBJB 5B24B 3REIB 2PYOC 4WU9D 3MGPC 1P34C 5B1MC 1F66A 1P3GA 3KUYB 3RELC 4J8UA 5DNNA 1F66B 5G49A 2F8ND 5AV5D 1P3GB 3V9RA 4J8UB 5DNNB 4LD9C 5G49B 3AZGB 1S32A 3V9RB 1M1AA 1P3MD 1S32B 5FUGB 3B0DB 1M1AB 3W98D 3X1SD 4M6BA 5B1LD 1P3OA 1BH9B 1P3FC 3AFAC 3MGPA 5B1MA 2NQBC 5B0YD 1HQ3D 2PYOB 5B2ID 4E45A 3MGPB 5B0ZD 1P34B 5B1MB 3RELB 5B32G 4LD9A 4J8WC 3NQUB 2HIOC 5F99D 3C1CD 4KUDC 5GXQC 1P3KC 5B2JC 1P3AD 4LD9B 3AZED 3WTPD 3MNND 3AZKC 5B33C 1P3PA 3VH6W 4E44A 4J8XD 3AFAA 4ZUXC 1U35D 5GT0D 3MGSC 2NQBA 5BT1D 3MGRD 4J8VD 1P3FB 3AFAB 3VH5A 3WTPE 4XZQD 2NQBB 3AZIA 1KX4D 5B31G 2CV5D 1KX3C 4J8WA 2HIOA 3AZIB 4KUDA 5GXQA 1P3KA 5B2JA 3AZJD 4J8WB 2HIOB 4Z66D 1P3PD 4KUDB 1N1JA 5GXQB 5DNMC 5B2JB 3C1BD 5B33A 3AZKA 1P3KB 3W97D 5JRGD 3B6GA 1N1JB 4ZUXA 3AZKB 5B33B 3MGSA 4ZUXB 3REHC 4NE3A 3MGSB 1P3GD 4H9SC 5E5AC 5B40C 3B0BA 1M18C 3LJAC 2YFVA 1KX3B 3AZNA 3AZHC 5AY8D 4CSRB 4NE6A 2YFVB 1TZYC 3REKC 5GSUC 4NE5A 5DNMB 3AV1C 1P3OD 1B67A 5KDMA 5AV6C 3O62C 5GT3A 3MGPD 3REHA 5KDMB 3MGQD 5BNXB 5B40A 1ZLAC 4R8PC 3LJAA 3REHB 3WAAD 1WWSA 3R45B 5E5AB 3UTAC 5B40B 5AVBD 4LD9D 3LJAB 3AZHA 5CPKA 4G91C 3W99A 1P3ID 3KWQC 4EO5C 3AZHB 1KX5A 3REKA 5GSUA 5AV9C 3AV1A 3UT9A 2F8NG 3O62A 5GSUB 3AFAD 3REKB 3AZLC 3AV1B 4QLCC 2F8NK 2NQBD 3UT9B 3O62B 3X1VA 3X1UA 1ZLAA 5CPIC 3AZID 1KU5A 3UTAA 5B32C 1ZLAB 2L5AA 5C3IC 5GXQD 3UTAB 2AROD 3REIA 3LZ1C 4G91B 5AV9A 3KUYA 4AWLC 3KWQB 4EO5B 4XUJC 3B6GD 5AV8D 5AV9B 5BS7A 4QLCA 3MGSD 3LELC 5BNVB 3VH5W 3AZLB 2NZDC 3AZGA 4QLCB 4YS3D 5CPIA 1F1EA 3AV2C 5FUGA 2FJ7C 1ID3C 5CPIB 4JJND 5B32B 1BH9A 3AYWC 3AZND 3WA9C 5C3IB 3LZ1A 3W96D 4X23C 2PYOA 1AOID 4XUJA 1P34A 3LZ1B 5BO0A 3RELA 4AWLB 5CP6D 3LELA 4XUJB 3NQUA 4WU8C 1P3BD 5GT3D 5BO0B 4KHAA 3LELB 3AV2A 2NZDB 3LJAD 4KHAB 2FJ7A 4YM6D 1H3OB 3AZMC 3AV2B 3AYWA 3AZHD 5CPKD 2FJ7B 3B6FC 2RVQD 4Z2MH 3W99D 1P3FA 3B0CW 3AYWB 1KX5D 1EQZC 3REKD 4X23B 3UT9D 4WU8A 3A6NC 4Z5TC 5CPJD 3X1VD 3WKJC 4WU8B 3X1UD 3MVDD 3UTAD 3AZFC 3B6FA 4DRAA 3AZMB 5B24D 3REID 4WU9C 1EQZA 3REJC 3B6FB 2YFWB 3KUYD 1EQZB 5AV5C 1F66D 4J8UD 5DNND 1KX3A 1Q9CA 2F8NH 3WKJA 3A6NB 4Z5TB 3AZGD 4CSRA 1P3MC 3W98C 3WKJB 3LZ0C 1S32D 1M1AD 5DNMA 3X1SC 5B1LC 3AZFB 4UUZA 1ULYA 3REJA 3LZ1D 1R4VA 4WU9B 5B2IC 4UUZB 2PYOD 5BNXA 5B0ZC 3REJB 1P34D 5B1MD 5AV5A 4H9QB 3R45A 3RELD 4H9SA 5E5AA 3LELD 1M18A 2F8NB 5AV5B 3C1CC 1P3AC 3AZEC 4DRBA 1M18B 1BH8A 3LZ0A 2FJ7D 1BFMA 5B1LA 1BH8B 4J8XC 1P3MB 1B6WA 1P3LC 1TZYA 3LZ0B 1U35C 5GT0C 3X1SB 5B1LB 3MGRC 4J8VC 5AV6A 1TZYB 1P3FD 5B2IA 4XZQC 3AN2C 1WWIA 3TU4C 5AV6B 2CV5C 5B2IB 4R8PA 2HUEC 3AZJC 3AZEA 5CHLB 4Z66C 4R8PB 4J8WD 2HIOD 3C1CB 3C1BC 4H9OA 1P3AB 4KUDD 1HTAA 5B2JD 1P3KD 3AZEB 3W97C 5JRGC 3KWQA 1P3LA 4H9OB 3AZKD 5GT0A 5B33D 3B6FD 3MGRA 4J8XB 2JSSA 1P3LB 4ZUXD 1U35B 5BNVA 3AZLA 5GT0B 3AN2A 1EQZD 3MGRB 3TU4A 3VH6T 3B0CT 4XZQB 3UTBC 4H9RB 3AN2B 3TU4B 2CV5B 5B32A 5B31C 1KX3D 4Z66A 5AY8C 3WKJD 2BYKB 2HUEB 3W97A 4WNNA 5JRGA 4Z66B 4CAYB 3C1BB 5DNMD 3W97B 1P3OC 4WNNB 5JRGB 3KXBC 3REJD 3MGQC 1M19C 1A7WA 3UTBA 4KGCC 2NZDA 3WAAC 3REHD 1H3OA 5AVBC 5E5AD 5B40D 3UTBB 5B31A 1M18D 5AY8A 1ID3A 1P3IC 5B31B 5AY8B 3WA9A 1ID3B 3LZ0D 4HGAC 4X23A 3WA9B 1TZYD 5GSUD 3KXBA 3AV1D 1P3OB 3X1TC 3MGQA 1M19A 5AV6D 5JA4A 3O62D 3KXBB 4KGCA 3WAAA 3AZIC 3MGQB 1M19B 5JA4B 5AVBA 4WV4B 4KGCB 1ZLAD 4R8PD 3WAAB 2AROC 4G92C 5AVBB 1P3IA 3AZMA 5AVCC 1P3IB 2YFWA 3KWQD 1P3LD 3B6GC 5AV8C 5AV9D 3X1TA 4HGAB 2LY8A 2IO5C 3AZLD 3A6NA 4Z5TA 3AN2D 4YS3C 3X1TB 4QLCD 3TU4D 2CWEA 3KSYA 4JJNC 5CPID 2AROA 1TAFA 3NQJA 5B32D 3AZNC 3AZFA 2AROB 5AVCA 1TAFB 3NQJB 3W96C 4G92B 4WU9A 1AOIC 5AV8A 5AVCB 5B0YC 4H9QA 1HQ3C 5CP6C 4H9PA 4H9NA 1P3BC 3B6GB 5AV8B 5GT3C 4XUJD 1JFIA 2F8NA 4YS3A 4H9NB 4H9PB 5F99C 1JFIB 2IO5B 3UTBD 2NZDD 4YM6C 4YS3B 4Z2MG 4JJNA 3WTPC 1P3MA 3W98A 3AV2D 3VH5T 5B31D 3MNNC 5CPKC 1ID3D 2RVQC 3X1SA 3VH6A 4JJNB 3W99C 3W96A 3W98B 3AZNB 1KX5C 3AYWD 1AOIA 3WA9D 5BT1C 5B0YA 3W96B 1HQ3A 3UT9C 5CP6A 4X23D 4NFTA 1P3BA 5B0ZA 1AOIB 5B0YB 3KXBD 1KX4C 5CPJC 1HQ3B 5CP6B 3X1VC 1P3BB 5B0ZB 1M19D 5F99A 5GT3B 3X1UC 4WU8D 3C1CA 4KGCD 1P3AA 4YM6A 3MVDC 3WTPA 5F99B 1P3PC 3MNNA 4YM6B 4WZSB 3WTPB 4ZBJC 5B24C 4J8XA 3REIC 3AZMD 3MNNB 5CPKB 1U35A 3W99B 3KUYC 4J8VA 1KX5B 2BYMA 4XZQA 1F66C 4H9RA 1P3GC 5BS7C 4J8VB 1KX4A 4J8UC 5CPJA 5DNNC 3X1TD 2CV5A 2BYMB 3AZGC 3A6ND 1KX4B 2BYKA 4Z5TD 5CPJB 3MVDA 3AZJA 3X1VB 3X1UB 1S32C
chains in the Genus database with same CATH superfamily
3B0DC 4CAYA 2XD5A 1M1AC 3C1BA 3MVDB 3AZJB 2Y2QA 5B24A 1P3PB 3AZFD 5AVCD 4ZBJB 5B24B 3REIB 2PYOC 4WU9D 3MGPC 1P34C 5B1MC 1F66A 1P3GA 3KUYB 3RELC 4J8UA 5DNNA 1F66B 5G49A 3EPLA 4DQYB 2F8ND 5AV5D 1P3GB 3V9RA 3KFUG 4J8UB 5DNNB 4LD9C 5G49B 3AZGB 1S32A 3V9RB 1M1AA 1P3MD 1S32B 5FUGB 3B0DB 1M1AB 3W98D 2DQNC 3X1SD 4M6BA 5B1LD 1P3OA 1BH9B 2ZY5A 1P3FC 3AFAC 3MGPA 2VQRA 5B1MA 2NQBC 5B0YD 1HQ3D 2PYOB 5B2ID 4E45A 3MGPB 5B0ZD 1P34B 5B1MB 3FDDA 3RELB 5B32G 4LD9A 4J8WC 3NQUB 2HIOC 5F99D 3C1CD 4KUDC 5GXQC 1P3KC 5B2JC 1P3AD 4LD9B 3AZED 3WTPD 3EPJA 2Y2JA 3MNND 3AZKC 5B33C 1P3PA 3VH6W 4E44A 4J8XD 3AFAA 4ZUXC 1U35D 5GT0D 3MGSC 2NQBA 5BT1D 3MGRD 4J8VD 1P3FB 3AFAB 3VH5A 3WTPE 4XZQD 2NQBB 3AZIA 1KX4D 5B31G 2CV5D 1KX3C 4J8WA 2HIOA 3AZIB 4KUDA 5GXQA 1P3KA 5B2JA 3AZJD 4J8WB 2HIOB 4Z66D 1P3PD 4KUDB 1N1JA 5GXQB 5DNMC 5B2JB 3C1BD 5B33A 3AZKA 1P3KB 3W97D 3AL0C 5JRGD 3B6GA 1N1JB 4ZUXA 3AZKB 5B33B 3MGSA 4ZUXB 2J8PA 1Z2CB 3REHC 4NE3A 3MGSB 1P3GD 4H9SC 5E5AC 5B40C 3B0BA 1M18C 3LJAC 2YFVA 1KX3B 3AZNA 3AZHC 5AY8D 4CSRB 4NE6A 2YFVB 1TZYC 3REKC 5GSUC 4NE5A 5DNMB 3AV1C 1P3OD 1B67A 5KDMA 5AV6C 3O62C 5GT3A 3MGPD 3REHA 5KDMB 3MGQD 5BNXB 5B40A 1ZLAC 4R8PC 3LJAA 3REHB 3WAAD 1WWSA 3R45B 2Y2MA 5E5AB 5B40B 3UTAC 5AVBD 2ZY4A 4LD9D 3LJAB 3AZHA 5CPKA 4G91C 3W99A 1P3ID 3KWQC 4EO5C 3AZHB 1KX5A 3REKA 5GSUA 3EPHA 3H0LC 2W8SA 5AV9C 3AV1A 3IP4C 3UT9A 2F8NG 3O62A 5GSUB 3AFAD 3REKB 3AZLC 3AV1B 4QLCC 2F8NK 2NQBD 3UT9B 3O62B 3X1VA 2G5IC 3X1UA 1ZLAA 3P5JB 5CPIC 3AZID 1KU5A 3UTAA 5B32C 1ZLAB 2L5AA 5C3IC 5GXQD 3UTAB 2AROD 3EG5B 3REIA 3LZ1C 4G91B 5AV9A 3KUYA 2UWXA 4AWLC 3KWQB 4EO5B 4XUJC 3B6GD 5AV8D 5AV9B 5BS7A 4QLCA 3MGSD 3LELC 5BNVB 3VH5W 3AZLB 2NZDC 3AZGA 4QLCB 4YS3D 5CPIA 1F1EA 3AV2C 5FUGA 2FJ7C 1ID3C 2Y2NA 5CPIB 4JJND 5B32B 1BH9A 1W2EA 3AYWC 3AZND 3WA9C 5C3IB 3LZ1A 3W96D 4X23C 2PYOA 1AOID 4XUJA 1P34A 3LZ1B 5BO0A 3RELA 4AWLB 5CP6D 3LELA 4XUJB 3NQUA 4WU8C 1P3BD 5GT3D 5BO0B 4KHAA 3LELB 3AV2A 2NZDB 3LJAD 4KHAB 2FJ7A 4YM6D 1H3OB 3AZMC 3AV2B 2Y2OA 3AYWA 3AZHD 5CPKD 2FJ7B 3B6FC 2RVQD 4Z2MH 3W99D 1P3FA 3B0CW 3AYWB 1KX5D 1EQZC 3REKD 4X23B 4UPKA 3UT9D 4WU8A 3A6NC 4Z5TC 5CPJD 3X1VD 3WKJC 4WU8B 3X1UD 3MVDD 3UTAD 3AZFC 3B6FA 4DRAA 3AZMB 5B24D 3REID 4WU9C 4WJ3C 1EQZA 3REJC 3B6FB 3EPKA 2YFWB 3KUYD 2RIQA 1EQZB 5AV5C 1F66D 1PZRA 4J8UD 3A1IA 5DNND 1KX3A 1Q9CA 2F8NH 3WKJA 3A6NB 4Z5TB 3AZGD 4CSRA 1P3MC 3W98C 3WKJB 3LZ0C 1S32D 1M1AD 5DNMA 3X1SC 5B1LC 3AZFB 4UUZA 1ULYA 3REJA 3LZ1D 1R4VA 4WU9B 5B2IC 4UUZB 2PYOD 5BNXA 1T3UA 3H0MC 5B0ZC 3A1KA 3REJB 1P34D 5B1MD 5AV5A 4H9QB 3R45A 3RELD 4H9SA 5E5AA 3LELD 1M18A 2F8NB 5AV5B 3C1CC 1P3AC 3AZEC 4DRBA 1M18B 1BH8A 3LZ0A 2Y2HA 2FJ7D 1BFMA 5B1LA 1BH8B 4J8XC 1P3MB 1B6WA 1P3LC 1TZYA 3LZ0B 1U35C 5GT0C 3X1SB 5B1LB 3MGRC 4J8VC 5AV6A 1TZYB 1P3FD 5B2IA 4XZQC 3AN2C 1WWIA 3TU4C 5AV6B 2CV5C 5B2IB 2F2AC 4R8PA 2HUEC 3AZJC 3AZEA 5CHLB 4Z66C 4R8PB 4J8WD 2HIOD 3C1CB 3C1BC 4H9OA 1P3AB 4KUDD 1HTAA 5B2JD 1P3KD 3AZEB 3W97C 5JRGC 3KWQA 1P3LA 2Y2IA 4H9OB 3AZKD 5GT0A 2JE5A 5B33D 3B6FD 3MGRA 4J8XB 2JSSA 1P3LB 2Y2KA 3F6TA 4ZUXD 5BNVA 2G5HC 5GT0B 3AZLA 3AN2A 1U35B 1EQZD 3MGRB 3TU4A 3VH6T 3B0CT 4XZQB 3UTBC 4H9RB 3AN2B 3TU4B 2CV5B 5B32A 5B31C 1KX3D 2ZY2A 5AY8C 4Z66A 3WKJD 2BYKB 2HUEB 2Y2GA 3W97A 4WNNA 5JRGA 4Z66B 4CAYB 3C1BB 5DNMD 3W97B 1P3OC 4WNNB 5JRGB 3KXBC 3REJD 3MGQC 1M19C 1A7WA 3UTBA 4KGCC 2NZDA 3WAAC 3REHD 1H3OA 5AVBC 5E5AD 5B40D 3UTBB 5B31A 1M18D 5AY8A 1ID3A 1P3IC 2XD1A 5B31B 5AY8B 3WA9A 1ID3B 2FFFB 3LZ0D 4HGAC 4X23A 3WA9B 1TZYD 5GSUD 3KXBA 3AV1D 1P3OB 2ZM5A 3X1TC 3MGQA 1M19A 5AV6D 5JA4A 3O62D 3KXBB 4KGCA 3WAAA 3AZIC 3MGQB 1M19B 5JA4B 5AVBA 4WV4B 4KGCB 1ZLAD 4R8PD 3WAAB 2AROC 4G92C 2BG1A 5AVBB 1P3IA 3AZMA 5AVCC 1P3IB 2YFWA 2DF4C 2ZY3A 3KWQD 1P3LD 3B6GC 5AV8C 5AV9D 3X1TA 4HGAB 2LY8A 2IO5C 3AZLD 3A6NA 4Z5TA 3AN2D 4YS3C 3X1TB 4QLCD 3TU4D 2CWEA 3KSYA 4JJNC 5CPID 2AROA 1TAFA 3NQJA 5B32D 3AZNC 3AZFA 2AROB 5AVCA 1TAFB 3NQJB 3W96C 4G92B 4WU9A 1AOIC 5AV8A 2Y2PA 5AVCB 5B0YC 4H9QA 1HQ3C 5CP6C 4H9PA 4H9NA 1P3BC 3B6GB 3H0RC 5AV8B 5GT3C 4XUJD 1JFIA 2F8NA 4YS3A 4H9NB 4H9PB 5F99C 1JFIB 2IO5B 3UTBD 2NZDD 4YM6C 4YS3B 4Z2MG 4JJNA 3WTPC 1P3MA 3W98A 3AV2D 3VH5T 5B31D 3MNNC 5CPKC 1ID3D 2RVQC 3X1SA 3VH6A 4JJNB 3W99C 3W96A 3W98B 3AZNB 1KX5C 3AYWD 1AOIA 3WA9D 5BT1C 5B0YA 3W96B 1HQ3A 3UT9C 5CP6A 4X23D 4NFTA 1P3BA 5B0ZA 1AOIB 5B0YB 3KXBD 1KX4C 5CPJC 1HQ3B 5CP6B 3X1VC 1P3BB 5B0ZB 1M19D 5F99A 5GT3B 3X1UC 4WU8D 3C1CA 4KGCD 1P3AA 4YM6A 3MVDC 3WTPA 5F99B 1P3PC 3MNNA 4YM6B 4WZSB 2JCHA 3WTPB 4ZBJC 5B24C 4J8XA 3REIC 3AZMD 3MNNB 5CPKB 1U35A 3W99B 3KUYC 4J8VA 1KX5B 2BYMA 4XZQA 1F66C 4H9RA 1P3GC 5BS7C 4J8VB 1KX4A 4J8UC 5CPJA 2Y2LA 5DNNC 3X1TD 2CV5A 2BYMB 3AZGC 3A6ND 1KX4B 2BYKA 4Z5TD 5CPJB 3MVDA 3AZJA 3X1VB 3X1UB 1S32C
chains in the Genus database with same CATH topology
3B0DC 4CAYA 2XD5A 1M1AC 3C1BA 3MVDB 3AZJB 2Y2QA 5B24A 1P3PB 3AZFD 5AVCD 4ZBJB 5B24B 3REIB 2PYOC 4WU9D 3MGPC 1P34C 5B1MC 1F66A 1P3GA 3KUYB 3RELC 4J8UA 5DNNA 1F66B 5G49A 3EPLA 4DQYB 2F8ND 5AV5D 1P3GB 3V9RA 3KFUG 4J8UB 5DNNB 4LD9C 5G49B 3AZGB 1S32A 3V9RB 1M1AA 1P3MD 1S32B 5FUGB 3B0DB 1M1AB 3W98D 2DQNC 3X1SD 4M6BA 5B1LD 1P3OA 1BH9B 2ZY5A 1P3FC 3AFAC 3MGPA 2VQRA 5B1MA 2NQBC 5B0YD 1HQ3D 2PYOB 5B2ID 4E45A 3MGPB 5B0ZD 1P34B 5B1MB 3FDDA 3RELB 5B32G 4LD9A 4J8WC 3NQUB 2HIOC 5F99D 3C1CD 4KUDC 5GXQC 1P3KC 5B2JC 1P3AD 4LD9B 3AZED 3WTPD 3EPJA 2Y2JA 3MNND 3AZKC 5B33C 1P3PA 3VH6W 4E44A 4J8XD 3AFAA 4ZUXC 1U35D 5GT0D 3MGSC 2NQBA 5BT1D 3MGRD 4J8VD 1P3FB 3AFAB 3VH5A 3WTPE 4XZQD 2NQBB 3AZIA 1KX4D 5B31G 2CV5D 1KX3C 4J8WA 2HIOA 3AZIB 4KUDA 5GXQA 1P3KA 5B2JA 3AZJD 4J8WB 2HIOB 4Z66D 1P3PD 4KUDB 1N1JA 5GXQB 5DNMC 5B2JB 3C1BD 5B33A 3AZKA 1P3KB 3W97D 3AL0C 5JRGD 3B6GA 1N1JB 4ZUXA 3AZKB 5B33B 3MGSA 4ZUXB 2J8PA 1Z2CB 3REHC 4NE3A 3MGSB 1P3GD 4H9SC 5E5AC 5B40C 3B0BA 1M18C 3LJAC 2YFVA 1KX3B 3AZNA 3AZHC 5AY8D 4CSRB 4NE6A 2YFVB 1TZYC 3REKC 5GSUC 4NE5A 5DNMB 3AV1C 1P3OD 1B67A 5KDMA 5AV6C 3O62C 5GT3A 3MGPD 3REHA 5KDMB 3MGQD 5BNXB 5B40A 1ZLAC 4R8PC 3LJAA 3REHB 3WAAD 1WWSA 3R45B 2Y2MA 5E5AB 5B40B 3UTAC 5AVBD 2ZY4A 4LD9D 3LJAB 3AZHA 5CPKA 4G91C 3W99A 1P3ID 3KWQC 4EO5C 3AZHB 1KX5A 3REKA 5GSUA 3EPHA 3H0LC 2W8SA 5AV9C 3AV1A 3IP4C 3UT9A 2F8NG 3O62A 5GSUB 3AFAD 3REKB 3AZLC 3AV1B 4QLCC 2F8NK 2NQBD 3UT9B 3O62B 3X1VA 2G5IC 3X1UA 1ZLAA 3P5JB 5CPIC 3AZID 1KU5A 3UTAA 5B32C 1ZLAB 2L5AA 5C3IC 5GXQD 3UTAB 2AROD 3EG5B 3REIA 3LZ1C 4G91B 5AV9A 3KUYA 2UWXA 4AWLC 3KWQB 4EO5B 4XUJC 3B6GD 5AV8D 5AV9B 5BS7A 4QLCA 3MGSD 3LELC 5BNVB 3VH5W 3AZLB 2NZDC 3AZGA 4QLCB 4YS3D 5CPIA 1F1EA 3AV2C 5FUGA 2FJ7C 1ID3C 2Y2NA 5CPIB 4JJND 5B32B 1BH9A 1W2EA 3AYWC 3AZND 3WA9C 5C3IB 3LZ1A 3W96D 4X23C 2PYOA 1AOID 4XUJA 1P34A 3LZ1B 5BO0A 3RELA 4AWLB 5CP6D 3LELA 4XUJB 3NQUA 4WU8C 1P3BD 5GT3D 5BO0B 4KHAA 3LELB 3AV2A 2NZDB 3LJAD 4KHAB 2FJ7A 4YM6D 1H3OB 3AZMC 3AV2B 2Y2OA 3AYWA 3AZHD 5CPKD 2FJ7B 3B6FC 2RVQD 4Z2MH 3W99D 1P3FA 3B0CW 3AYWB 1KX5D 1EQZC 3REKD 4X23B 4UPKA 3UT9D 4WU8A 3A6NC 4Z5TC 5CPJD 3X1VD 3WKJC 4WU8B 3X1UD 3MVDD 3UTAD 3AZFC 3B6FA 4DRAA 3AZMB 5B24D 3REID 4WU9C 4WJ3C 1EQZA 3REJC 3B6FB 3EPKA 2YFWB 3KUYD 2RIQA 1EQZB 5AV5C 1F66D 1PZRA 4J8UD 3A1IA 5DNND 1KX3A 1Q9CA 2F8NH 3WKJA 3A6NB 4Z5TB 3AZGD 4CSRA 1P3MC 3W98C 3WKJB 3LZ0C 1S32D 1M1AD 5DNMA 3X1SC 5B1LC 3AZFB 4UUZA 1ULYA 3REJA 3LZ1D 1R4VA 4WU9B 5B2IC 4UUZB 2PYOD 5BNXA 1T3UA 3H0MC 5B0ZC 3A1KA 3REJB 1P34D 5B1MD 5AV5A 4H9QB 3R45A 3RELD 4H9SA 5E5AA 3LELD 1M18A 2F8NB 5AV5B 3C1CC 1P3AC 3AZEC 4DRBA 1M18B 1BH8A 3LZ0A 2Y2HA 2FJ7D 1BFMA 5B1LA 1BH8B 4J8XC 1P3MB 1B6WA 1P3LC 1TZYA 3LZ0B 1U35C 5GT0C 3X1SB 5B1LB 3MGRC 4J8VC 5AV6A 1TZYB 1P3FD 5B2IA 4XZQC 3AN2C 1WWIA 3TU4C 5AV6B 2CV5C 5B2IB 2F2AC 4R8PA 2HUEC 3AZJC 3AZEA 5CHLB 4Z66C 4R8PB 4J8WD 2HIOD 3C1CB 3C1BC 4H9OA 1P3AB 4KUDD 1HTAA 5B2JD 1P3KD 3AZEB 3W97C 5JRGC 3KWQA 1P3LA 2Y2IA 4H9OB 3AZKD 5GT0A 2JE5A 5B33D 3B6FD 3MGRA 4J8XB 2JSSA 1P3LB 2Y2KA 3F6TA 4ZUXD 5BNVA 2G5HC 5GT0B 3AZLA 3AN2A 1U35B 1EQZD 3MGRB 3TU4A 3VH6T 3B0CT 4XZQB 3UTBC 4H9RB 3AN2B 3TU4B 2CV5B 5B32A 5B31C 1KX3D 2ZY2A 5AY8C 4Z66A 3WKJD 2BYKB 2HUEB 2Y2GA 3W97A 4WNNA 5JRGA 4Z66B 4CAYB 3C1BB 5DNMD 3W97B 1P3OC 4WNNB 5JRGB 3KXBC 3REJD 3MGQC 1M19C 1A7WA 3UTBA 4KGCC 2NZDA 3WAAC 3REHD 1H3OA 5AVBC 5E5AD 5B40D 3UTBB 5B31A 1M18D 5AY8A 1ID3A 1P3IC 2XD1A 5B31B 5AY8B 3WA9A 1ID3B 2FFFB 3LZ0D 4HGAC 4X23A 3WA9B 1TZYD 5GSUD 3KXBA 3AV1D 1P3OB 2ZM5A 3X1TC 3MGQA 1M19A 5AV6D 5JA4A 3O62D 3KXBB 4KGCA 3WAAA 3AZIC 3MGQB 1M19B 5JA4B 5AVBA 4WV4B 4KGCB 1ZLAD 4R8PD 3WAAB 2AROC 4G92C 2BG1A 5AVBB 1P3IA 3AZMA 5AVCC 1P3IB 2YFWA 2DF4C 2ZY3A 3KWQD 1P3LD 3B6GC 5AV8C 5AV9D 3X1TA 4HGAB 2LY8A 2IO5C 3AZLD 3A6NA 4Z5TA 3AN2D 4YS3C 3X1TB 4QLCD 3TU4D 2CWEA 3KSYA 4JJNC 5CPID 2AROA 1TAFA 3NQJA 5B32D 3AZNC 3AZFA 2AROB 5AVCA 1TAFB 3NQJB 3W96C 4G92B 4WU9A 1AOIC 5AV8A 2Y2PA 5AVCB 5B0YC 4H9QA 1HQ3C 5CP6C 4H9PA 4H9NA 1P3BC 3B6GB 3H0RC 5AV8B 5GT3C 4XUJD 1JFIA 2F8NA 4YS3A 4H9NB 4H9PB 5F99C 1JFIB 2IO5B 3UTBD 2NZDD 4YM6C 4YS3B 4Z2MG 4JJNA 3WTPC 1P3MA 3W98A 3AV2D 3VH5T 5B31D 3MNNC 5CPKC 1ID3D 2RVQC 3X1SA 3VH6A 4JJNB 3W99C 3W96A 3W98B 3AZNB 1KX5C 3AYWD 1AOIA 3WA9D 5BT1C 5B0YA 3W96B 1HQ3A 3UT9C 5CP6A 4X23D 4NFTA 1P3BA 5B0ZA 1AOIB 5B0YB 3KXBD 1KX4C 5CPJC 1HQ3B 5CP6B 3X1VC 1P3BB 5B0ZB 1M19D 5F99A 5GT3B 3X1UC 4WU8D 3C1CA 4KGCD 1P3AA 4YM6A 3MVDC 3WTPA 5F99B 1P3PC 3MNNA 4YM6B 4WZSB 2JCHA 3WTPB 4ZBJC 5B24C 4J8XA 3REIC 3AZMD 3MNNB 5CPKB 1U35A 3W99B 3KUYC 4J8VA 1KX5B 2BYMA 4XZQA 1F66C 4H9RA 1P3GC 5BS7C 4J8VB 1KX4A 4J8UC 5CPJA 2Y2LA 5DNNC 3X1TD 2CV5A 2BYMB 3AZGC 3A6ND 1KX4B 2BYKA 4Z5TD 5CPJB 3MVDA 3AZJA 3X1VB 3X1UB 1S32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0D C;  4CAY A;  1M1A C;  3C1B A;  3MVD B;  3AZJ B;  5B24 A;  1P3P B;  3AZF D;  5AVC D;  4ZBJ B;  5B24 B;  3REI B;  2PYO C;  4WU9 D;  3MGP C;  1P34 C;  5B1M C;  1F66 A;  1P3G A;  3KUY B;  3REL C;  4J8U A;  5DNN A;  1F66 B;  5G49 A;  2F8N D;  5AV5 D;  1P3G B;  3V9R A;  4J8U B;  5DNN B;  4LD9 C;  5G49 B;  3AZG B;  1S32 A;  3V9R B;  1M1A A;  1P3M D;  1S32 B;  5FUG B;  3B0D B;  1M1A B;  3W98 D;  3X1S D;  4M6B A;  5B1L D;  1P3O A;  1BH9 B;  1P3F C;  3AFA C;  3MGP A;  5B1M A;  2NQB C;  5B0Y D;  1HQ3 D;  2PYO B;  5B2I D;  4E45 A;  3MGP B;  5B0Z D;  1P34 B;  5B1M B;  3REL B;  5B32 G;  4LD9 A;  4J8W C;  3NQU B;  2HIO C;  5F99 D;  3C1C D;  4KUD C;  5GXQ C;  1P3K C;  5B2J C;  1P3A D;  4LD9 B;  3AZE D;  3WTP D;  3MNN D;  3AZK C;  5B33 C;  1P3P A;  3VH6 W;  4E44 A;  4J8X D;  3AFA A;  4ZUX C;  1U35 D;  5GT0 D;  3MGS C;  2NQB A;  5BT1 D;  3MGR D;  4J8V D;  1P3F B;  3AFA B;  3VH5 A;  3WTP E;  4XZQ D;  2NQB B;  3AZI A;  1KX4 D;  5B31 G;  2CV5 D;  1KX3 C;  4J8W A;  2HIO A;  3AZI B;  4KUD A;  5GXQ A;  1P3K A;  5B2J A;  3AZJ D;  4J8W B;  2HIO B;  4Z66 D;  1P3P D;  4KUD B;  1N1J A;  5GXQ B;  5DNM C;  5B2J B;  3C1B D;  5B33 A;  3AZK A;  1P3K B;  3W97 D;  5JRG D;  3B6G A;  1N1J B;  4ZUX A;  3AZK B;  5B33 B;  3MGS A;  4ZUX B;  3REH C;  4NE3 A;  3MGS B;  1P3G D;  4H9S C;  5E5A C;  5B40 C;  3B0B A;  1M18 C;  3LJA C;  2YFV A;  1KX3 B;  3AZN A;  3AZH C;  5AY8 D;  4CSR B;  4NE6 A;  2YFV B;  1TZY C;  3REK C;  5GSU C;  4NE5 A;  5DNM B;  3AV1 C;  1P3O D;  1B67 A;  5KDM A;  5AV6 C;  3O62 C;  5GT3 A;  3MGP D;  3REH A;  5KDM B;  3MGQ D;  5BNX B;  5B40 A;  1ZLA C;  4R8P C;  3LJA A;  3REH B;  3WAA D;  1WWS A;  3R45 B;  5E5A B;  3UTA C;  5B40 B;  5AVB D;  4LD9 D;  3LJA B;  3AZH A;  5CPK A;  4G91 C;  3W99 A;  1P3I D;  3KWQ C;  4EO5 C;  3AZH B;  1KX5 A;  3REK A;  5GSU A;  5AV9 C;  3AV1 A;  3UT9 A;  2F8N G;  3O62 A;  5GSU B;  3AFA D;  3REK B;  3AZL C;  3AV1 B;  4QLC C;  2F8N K;  2NQB D;  3UT9 B;  3O62 B;  3X1V A;  3X1U A;  1ZLA A;  5CPI C;  3AZI D;  1KU5 A;  3UTA A;  5B32 C;  1ZLA B;  2L5A A;  5C3I C;  5GXQ D;  3UTA B;  2ARO D;  3REI A;  3LZ1 C;  4G91 B;  5AV9 A;  3KUY A;  4AWL C;  3KWQ B;  4EO5 B;  4XUJ C;  3B6G D;  5AV8 D;  5AV9 B;  5BS7 A;  4QLC A;  3MGS D;  3LEL C;  5BNV B;  3VH5 W;  3AZL B;  2NZD C;  3AZG A;  4QLC B;  4YS3 D;  5CPI A;  1F1E A;  3AV2 C;  5FUG A;  2FJ7 C;  1ID3 C;  5CPI B;  4JJN D;  5B32 B;  1BH9 A;  3AYW C;  3AZN D;  3WA9 C;  5C3I B;  3LZ1 A;  3W96 D;  4X23 C;  2PYO A;  1AOI D;  4XUJ A;  1P34 A;  3LZ1 B;  5BO0 A;  3REL A;  4AWL B;  5CP6 D;  3LEL A;  4XUJ B;  3NQU A;  4WU8 C;  1P3B D;  5GT3 D;  5BO0 B;  4KHA A;  3LEL B;  3AV2 A;  2NZD B;  3LJA D;  4KHA B;  2FJ7 A;  4YM6 D;  1H3O B;  3AZM C;  3AV2 B;  3AYW A;  3AZH D;  5CPK D;  2FJ7 B;  3B6F C;  2RVQ D;  4Z2M H;  3W99 D;  1P3F A;  3B0C W;  3AYW B;  1KX5 D;  1EQZ C;  3REK D;  4X23 B;  3UT9 D;  4WU8 A;  3A6N C;  4Z5T C;  5CPJ D;  3X1V D;  3WKJ C;  4WU8 B;  3X1U D;  3MVD D;  3UTA D;  3AZF C;  3B6F A;  4DRA A;  3AZM B;  5B24 D;  3REI D;  4WU9 C;  1EQZ A;  3REJ C;  3B6F B;  2YFW B;  3KUY D;  1EQZ B;  5AV5 C;  1F66 D;  4J8U D;  5DNN D;  1KX3 A;  1Q9C A;  2F8N H;  3WKJ A;  3A6N B;  4Z5T B;  3AZG D;  4CSR A;  1P3M C;  3W98 C;  3WKJ B;  3LZ0 C;  1S32 D;  1M1A D;  5DNM A;  3X1S C;  5B1L C;  3AZF B;  4UUZ A;  1ULY A;  3REJ A;  3LZ1 D;  1R4V A;  4WU9 B;  5B2I C;  4UUZ B;  2PYO D;  5BNX A;  5B0Z C;  3REJ B;  1P34 D;  5B1M D;  5AV5 A;  4H9Q B;  3R45 A;  3REL D;  4H9S A;  5E5A A;  3LEL D;  1M18 A;  2F8N B;  5AV5 B;  3C1C C;  1P3A C;  3AZE C;  4DRB A;  1M18 B;  1BH8 A;  3LZ0 A;  2FJ7 D;  1BFM A;  5B1L A;  1BH8 B;  4J8X C;  1P3M B;  1B6W A;  1P3L C;  1TZY A;  3LZ0 B;  1U35 C;  5GT0 C;  3X1S B;  5B1L B;  3MGR C;  4J8V C;  5AV6 A;  1TZY B;  1P3F D;  5B2I A;  4XZQ C;  3AN2 C;  1WWI A;  3TU4 C;  5AV6 B;  2CV5 C;  5B2I B;  4R8P A;  2HUE C;  3AZJ C;  3AZE A;  5CHL B;  4Z66 C;  4R8P B;  4J8W D;  2HIO D;  3C1C B;  3C1B C;  4H9O A;  1P3A B;  4KUD D;  1HTA A;  5B2J D;  1P3K D;  3AZE B;  3W97 C;  5JRG C;  3KWQ A;  1P3L A;  4H9O B;  3AZK D;  5GT0 A;  5B33 D;  3B6F D;  3MGR A;  4J8X B;  2JSS A;  1P3L B;  4ZUX D;  1U35 B;  5BNV A;  3AZL A;  5GT0 B;  3AN2 A;  1EQZ D;  3MGR B;  3TU4 A;  3VH6 T;  3B0C T;  4XZQ B;  3UTB C;  4H9R B;  3AN2 B;  3TU4 B;  2CV5 B;  5B32 A;  5B31 C;  1KX3 D;  4Z66 A;  5AY8 C;  3WKJ D;  2BYK B;  2HUE B;  3W97 A;  4WNN A;  5JRG A;  4Z66 B;  4CAY B;  3C1B B;  5DNM D;  3W97 B;  1P3O C;  4WNN B;  5JRG B;  3KXB C;  3REJ D;  3MGQ C;  1M19 C;  1A7W A;  3UTB A;  4KGC C;  2NZD A;  3WAA C;  3REH D;  1H3O A;  5AVB C;  5E5A D;  5B40 D;  3UTB B;  5B31 A;  1M18 D;  5AY8 A;  1ID3 A;  1P3I C;  5B31 B;  5AY8 B;  3WA9 A;  1ID3 B;  3LZ0 D;  4HGA C;  4X23 A;  3WA9 B;  1TZY D;  5GSU D;  3KXB A;  3AV1 D;  1P3O B;  3X1T C;  3MGQ A;  1M19 A;  5AV6 D;  5JA4 A;  3O62 D;  3KXB B;  4KGC A;  3WAA A;  3AZI C;  3MGQ B;  1M19 B;  5JA4 B;  5AVB A;  4WV4 B;  4KGC B;  1ZLA D;  4R8P D;  3WAA B;  2ARO C;  4G92 C;  5AVB B;  1P3I A;  3AZM A;  5AVC C;  1P3I B;  2YFW A;  3KWQ D;  1P3L D;  3B6G C;  5AV8 C;  5AV9 D;  3X1T A;  4HGA B;  2LY8 A;  2IO5 C;  3AZL D;  3A6N A;  4Z5T A;  3AN2 D;  4YS3 C;  3X1T B;  4QLC D;  3TU4 D;  2CWE A;  3KSY A;  4JJN C;  5CPI D;  2ARO A;  1TAF A;  3NQJ A;  5B32 D;  3AZN C;  3AZF A;  2ARO B;  5AVC A;  1TAF B;  3NQJ B;  3W96 C;  4G92 B;  4WU9 A;  1AOI C;  5AV8 A;  5AVC B;  5B0Y C;  4H9Q A;  1HQ3 C;  5CP6 C;  4H9P A;  4H9N A;  1P3B C;  3B6G B;  5AV8 B;  5GT3 C;  4XUJ D;  1JFI A;  2F8N A;  4YS3 A;  4H9N B;  4H9P B;  5F99 C;  1JFI B;  2IO5 B;  3UTB D;  2NZD D;  4YM6 C;  4YS3 B;  4Z2M G;  4JJN A;  3WTP C;  1P3M A;  3W98 A;  3AV2 D;  3VH5 T;  5B31 D;  3MNN C;  5CPK C;  1ID3 D;  2RVQ C;  3X1S A;  3VH6 A;  4JJN B;  3W99 C;  3W96 A;  3W98 B;  3AZN B;  1KX5 C;  3AYW D;  1AOI A;  3WA9 D;  5BT1 C;  5B0Y A;  3W96 B;  1HQ3 A;  3UT9 C;  5CP6 A;  4X23 D;  4NFT A;  1P3B A;  5B0Z A;  1AOI B;  5B0Y B;  3KXB D;  1KX4 C;  5CPJ C;  1HQ3 B;  5CP6 B;  3X1V C;  1P3B B;  5B0Z B;  1M19 D;  5F99 A;  5GT3 B;  3X1U C;  4WU8 D;  3C1C A;  4KGC D;  1P3A A;  4YM6 A;  3MVD C;  3WTP A;  5F99 B;  1P3P C;  3MNN A;  4YM6 B;  4WZS B;  3WTP B;  4ZBJ C;  5B24 C;  4J8X A;  3REI C;  3AZM D;  3MNN B;  5CPK B;  1U35 A;  3W99 B;  3KUY C;  4J8V A;  1KX5 B;  2BYM A;  4XZQ A;  1F66 C;  4H9R A;  1P3G C;  5BS7 C;  4J8V B;  1KX4 A;  4J8U C;  5CPJ A;  5DNN C;  3X1T D;  2CV5 A;  2BYM B;  3AZG C;  3A6N D;  1KX4 B;  2BYK A;  4Z5T D;  5CPJ B;  3MVD A;  3AZJ A;  3X1V B;  3X1U B;  1S32 C; 
#chains in the Genus database with same CATH topology
 3B0D C;  4CAY A;  2XD5 A;  1M1A C;  3C1B A;  3MVD B;  3AZJ B;  2Y2Q A;  5B24 A;  1P3P B;  3AZF D;  5AVC D;  4ZBJ B;  5B24 B;  3REI B;  2PYO C;  4WU9 D;  3MGP C;  1P34 C;  5B1M C;  1F66 A;  1P3G A;  3KUY B;  3REL C;  4J8U A;  5DNN A;  1F66 B;  5G49 A;  3EPL A;  4DQY B;  2F8N D;  5AV5 D;  1P3G B;  3V9R A;  3KFU G;  4J8U B;  5DNN B;  4LD9 C;  5G49 B;  3AZG B;  1S32 A;  3V9R B;  1M1A A;  1P3M D;  1S32 B;  5FUG B;  3B0D B;  1M1A B;  3W98 D;  2DQN C;  3X1S D;  4M6B A;  5B1L D;  1P3O A;  1BH9 B;  2ZY5 A;  1P3F C;  3AFA C;  3MGP A;  2VQR A;  5B1M A;  2NQB C;  5B0Y D;  1HQ3 D;  2PYO B;  5B2I D;  4E45 A;  3MGP B;  5B0Z D;  1P34 B;  5B1M B;  3FDD A;  3REL B;  5B32 G;  4LD9 A;  4J8W C;  3NQU B;  2HIO C;  5F99 D;  3C1C D;  4KUD C;  5GXQ C;  1P3K C;  5B2J C;  1P3A D;  4LD9 B;  3AZE D;  3WTP D;  3EPJ A;  2Y2J A;  3MNN D;  3AZK C;  5B33 C;  1P3P A;  3VH6 W;  4E44 A;  4J8X D;  3AFA A;  4ZUX C;  1U35 D;  5GT0 D;  3MGS C;  2NQB A;  5BT1 D;  3MGR D;  4J8V D;  1P3F B;  3AFA B;  3VH5 A;  3WTP E;  4XZQ D;  2NQB B;  3AZI A;  1KX4 D;  5B31 G;  2CV5 D;  1KX3 C;  4J8W A;  2HIO A;  3AZI B;  4KUD A;  5GXQ A;  1P3K A;  5B2J A;  3AZJ D;  4J8W B;  2HIO B;  4Z66 D;  1P3P D;  4KUD B;  1N1J A;  5GXQ B;  5DNM C;  5B2J B;  3C1B D;  5B33 A;  3AZK A;  1P3K B;  3W97 D;  3AL0 C;  5JRG D;  3B6G A;  1N1J B;  4ZUX A;  3AZK B;  5B33 B;  3MGS A;  4ZUX B;  2J8P A;  1Z2C B;  3REH C;  4NE3 A;  3MGS B;  1P3G D;  4H9S C;  5E5A C;  5B40 C;  3B0B A;  1M18 C;  3LJA C;  2YFV A;  1KX3 B;  3AZN A;  3AZH C;  5AY8 D;  4CSR B;  4NE6 A;  2YFV B;  1TZY C;  3REK C;  5GSU C;  4NE5 A;  5DNM B;  3AV1 C;  1P3O D;  1B67 A;  5KDM A;  5AV6 C;  3O62 C;  5GT3 A;  3MGP D;  3REH A;  5KDM B;  3MGQ D;  5BNX B;  5B40 A;  1ZLA C;  4R8P C;  3LJA A;  3REH B;  3WAA D;  1WWS A;  3R45 B;  2Y2M A;  5E5A B;  5B40 B;  3UTA C;  5AVB D;  2ZY4 A;  4LD9 D;  3LJA B;  3AZH A;  5CPK A;  4G91 C;  3W99 A;  1P3I D;  3KWQ C;  4EO5 C;  3AZH B;  1KX5 A;  3REK A;  5GSU A;  3EPH A;  3H0L C;  2W8S A;  5AV9 C;  3AV1 A;  3IP4 C;  3UT9 A;  2F8N G;  3O62 A;  5GSU B;  3AFA D;  3REK B;  3AZL C;  3AV1 B;  4QLC C;  2F8N K;  2NQB D;  3UT9 B;  3O62 B;  3X1V A;  2G5I C;  3X1U A;  1ZLA A;  3P5J B;  5CPI C;  3AZI D;  1KU5 A;  3UTA A;  5B32 C;  1ZLA B;  2L5A A;  5C3I C;  5GXQ D;  3UTA B;  2ARO D;  3EG5 B;  3REI A;  3LZ1 C;  4G91 B;  5AV9 A;  3KUY A;  2UWX A;  4AWL C;  3KWQ B;  4EO5 B;  4XUJ C;  3B6G D;  5AV8 D;  5AV9 B;  5BS7 A;  4QLC A;  3MGS D;  3LEL C;  5BNV B;  3VH5 W;  3AZL B;  2NZD C;  3AZG A;  4QLC B;  4YS3 D;  5CPI A;  1F1E A;  3AV2 C;  5FUG A;  2FJ7 C;  1ID3 C;  2Y2N A;  5CPI B;  4JJN D;  5B32 B;  1BH9 A;  1W2E A;  3AYW C;  3AZN D;  3WA9 C;  5C3I B;  3LZ1 A;  3W96 D;  4X23 C;  2PYO A;  1AOI D;  4XUJ A;  1P34 A;  3LZ1 B;  5BO0 A;  3REL A;  4AWL B;  5CP6 D;  3LEL A;  4XUJ B;  3NQU A;  4WU8 C;  1P3B D;  5GT3 D;  5BO0 B;  4KHA A;  3LEL B;  3AV2 A;  2NZD B;  3LJA D;  4KHA B;  2FJ7 A;  4YM6 D;  1H3O B;  3AZM C;  3AV2 B;  2Y2O A;  3AYW A;  3AZH D;  5CPK D;  2FJ7 B;  3B6F C;  2RVQ D;  4Z2M H;  3W99 D;  1P3F A;  3B0C W;  3AYW B;  1KX5 D;  1EQZ C;  3REK D;  4X23 B;  4UPK A;  3UT9 D;  4WU8 A;  3A6N C;  4Z5T C;  5CPJ D;  3X1V D;  3WKJ C;  4WU8 B;  3X1U D;  3MVD D;  3UTA D;  3AZF C;  3B6F A;  4DRA A;  3AZM B;  5B24 D;  3REI D;  4WU9 C;  4WJ3 C;  1EQZ A;  3REJ C;  3B6F B;  3EPK A;  2YFW B;  3KUY D;  2RIQ A;  1EQZ B;  5AV5 C;  1F66 D;  1PZR A;  4J8U D;  3A1I A;  5DNN D;  1KX3 A;  1Q9C A;  2F8N H;  3WKJ A;  3A6N B;  4Z5T B;  3AZG D;  4CSR A;  1P3M C;  3W98 C;  3WKJ B;  3LZ0 C;  1S32 D;  1M1A D;  5DNM A;  3X1S C;  5B1L C;  3AZF B;  4UUZ A;  1ULY A;  3REJ A;  3LZ1 D;  1R4V A;  4WU9 B;  5B2I C;  4UUZ B;  2PYO D;  5BNX A;  1T3U A;  3H0M C;  5B0Z C;  3A1K A;  3REJ B;  1P34 D;  5B1M D;  5AV5 A;  4H9Q B;  3R45 A;  3REL D;  4H9S A;  5E5A A;  3LEL D;  1M18 A;  2F8N B;  5AV5 B;  3C1C C;  1P3A C;  3AZE C;  4DRB A;  1M18 B;  1BH8 A;  3LZ0 A;  2Y2H A;  2FJ7 D;  1BFM A;  5B1L A;  1BH8 B;  4J8X C;  1P3M B;  1B6W A;  1P3L C;  1TZY A;  3LZ0 B;  1U35 C;  5GT0 C;  3X1S B;  5B1L B;  3MGR C;  4J8V C;  5AV6 A;  1TZY B;  1P3F D;  5B2I A;  4XZQ C;  3AN2 C;  1WWI A;  3TU4 C;  5AV6 B;  2CV5 C;  5B2I B;  2F2A C;  4R8P A;  2HUE C;  3AZJ C;  3AZE A;  5CHL B;  4Z66 C;  4R8P B;  4J8W D;  2HIO D;  3C1C B;  3C1B C;  4H9O A;  1P3A B;  4KUD D;  1HTA A;  5B2J D;  1P3K D;  3AZE B;  3W97 C;  5JRG C;  3KWQ A;  1P3L A;  2Y2I A;  4H9O B;  3AZK D;  5GT0 A;  2JE5 A;  5B33 D;  3B6F D;  3MGR A;  4J8X B;  2JSS A;  1P3L B;  2Y2K A;  3F6T A;  4ZUX D;  5BNV A;  2G5H C;  5GT0 B;  3AZL A;  3AN2 A;  1U35 B;  1EQZ D;  3MGR B;  3TU4 A;  3VH6 T;  3B0C T;  4XZQ B;  3UTB C;  4H9R B;  3AN2 B;  3TU4 B;  2CV5 B;  5B32 A;  5B31 C;  1KX3 D;  2ZY2 A;  5AY8 C;  4Z66 A;  3WKJ D;  2BYK B;  2HUE B;  2Y2G A;  3W97 A;  4WNN A;  5JRG A;  4Z66 B;  4CAY B;  3C1B B;  5DNM D;  3W97 B;  1P3O C;  4WNN B;  5JRG B;  3KXB C;  3REJ D;  3MGQ C;  1M19 C;  1A7W A;  3UTB A;  4KGC C;  2NZD A;  3WAA C;  3REH D;  1H3O A;  5AVB C;  5E5A D;  5B40 D;  3UTB B;  5B31 A;  1M18 D;  5AY8 A;  1ID3 A;  1P3I C;  2XD1 A;  5B31 B;  5AY8 B;  3WA9 A;  1ID3 B;  2FFF B;  3LZ0 D;  4HGA C;  4X23 A;  3WA9 B;  1TZY D;  5GSU D;  3KXB A;  3AV1 D;  1P3O B;  2ZM5 A;  3X1T C;  3MGQ A;  1M19 A;  5AV6 D;  5JA4 A;  3O62 D;  3KXB B;  4KGC A;  3WAA A;  3AZI C;  3MGQ B;  1M19 B;  5JA4 B;  5AVB A;  4WV4 B;  4KGC B;  1ZLA D;  4R8P D;  3WAA B;  2ARO C;  4G92 C;  2BG1 A;  5AVB B;  1P3I A;  3AZM A;  5AVC C;  1P3I B;  2YFW A;  2DF4 C;  2ZY3 A;  3KWQ D;  1P3L D;  3B6G C;  5AV8 C;  5AV9 D;  3X1T A;  4HGA B;  2LY8 A;  2IO5 C;  3AZL D;  3A6N A;  4Z5T A;  3AN2 D;  4YS3 C;  3X1T B;  4QLC D;  3TU4 D;  2CWE A;  3KSY A;  4JJN C;  5CPI D;  2ARO A;  1TAF A;  3NQJ A;  5B32 D;  3AZN C;  3AZF A;  2ARO B;  5AVC A;  1TAF B;  3NQJ B;  3W96 C;  4G92 B;  4WU9 A;  1AOI C;  5AV8 A;  2Y2P A;  5AVC B;  5B0Y C;  4H9Q A;  1HQ3 C;  5CP6 C;  4H9P A;  4H9N A;  1P3B C;  3B6G B;  3H0R C;  5AV8 B;  5GT3 C;  4XUJ D;  1JFI A;  2F8N A;  4YS3 A;  4H9N B;  4H9P B;  5F99 C;  1JFI B;  2IO5 B;  3UTB D;  2NZD D;  4YM6 C;  4YS3 B;  4Z2M G;  4JJN A;  3WTP C;  1P3M A;  3W98 A;  3AV2 D;  3VH5 T;  5B31 D;  3MNN C;  5CPK C;  1ID3 D;  2RVQ C;  3X1S A;  3VH6 A;  4JJN B;  3W99 C;  3W96 A;  3W98 B;  3AZN B;  1KX5 C;  3AYW D;  1AOI A;  3WA9 D;  5BT1 C;  5B0Y A;  3W96 B;  1HQ3 A;  3UT9 C;  5CP6 A;  4X23 D;  4NFT A;  1P3B A;  5B0Z A;  1AOI B;  5B0Y B;  3KXB D;  1KX4 C;  5CPJ C;  1HQ3 B;  5CP6 B;  3X1V C;  1P3B B;  5B0Z B;  1M19 D;  5F99 A;  5GT3 B;  3X1U C;  4WU8 D;  3C1C A;  4KGC D;  1P3A A;  4YM6 A;  3MVD C;  3WTP A;  5F99 B;  1P3P C;  3MNN A;  4YM6 B;  4WZS B;  2JCH A;  3WTP B;  4ZBJ C;  5B24 C;  4J8X A;  3REI C;  3AZM D;  3MNN B;  5CPK B;  1U35 A;  3W99 B;  3KUY C;  4J8V A;  1KX5 B;  2BYM A;  4XZQ A;  1F66 C;  4H9R A;  1P3G C;  5BS7 C;  4J8V B;  1KX4 A;  4J8U C;  5CPJ A;  2Y2L A;  5DNN C;  3X1T D;  2CV5 A;  2BYM B;  3AZG C;  3A6N D;  1KX4 B;  2BYK A;  4Z5T D;  5CPJ B;  3MVD A;  3AZJ A;  3X1V B;  3X1U B;  1S32 C; 
#chains in the Genus database with same CATH homology
 3B0D C;  4CAY A;  2XD5 A;  1M1A C;  3C1B A;  3MVD B;  3AZJ B;  2Y2Q A;  5B24 A;  1P3P B;  3AZF D;  5AVC D;  4ZBJ B;  5B24 B;  3REI B;  2PYO C;  4WU9 D;  3MGP C;  1P34 C;  5B1M C;  1F66 A;  1P3G A;  3KUY B;  3REL C;  4J8U A;  5DNN A;  1F66 B;  5G49 A;  3EPL A;  4DQY B;  2F8N D;  5AV5 D;  1P3G B;  3V9R A;  3KFU G;  4J8U B;  5DNN B;  4LD9 C;  5G49 B;  3AZG B;  1S32 A;  3V9R B;  1M1A A;  1P3M D;  1S32 B;  5FUG B;  3B0D B;  1M1A B;  3W98 D;  2DQN C;  3X1S D;  4M6B A;  5B1L D;  1P3O A;  1BH9 B;  2ZY5 A;  1P3F C;  3AFA C;  3MGP A;  2VQR A;  5B1M A;  2NQB C;  5B0Y D;  1HQ3 D;  2PYO B;  5B2I D;  4E45 A;  3MGP B;  5B0Z D;  1P34 B;  5B1M B;  3FDD A;  3REL B;  5B32 G;  4LD9 A;  4J8W C;  3NQU B;  2HIO C;  5F99 D;  3C1C D;  4KUD C;  5GXQ C;  1P3K C;  5B2J C;  1P3A D;  4LD9 B;  3AZE D;  3WTP D;  3EPJ A;  2Y2J A;  3MNN D;  3AZK C;  5B33 C;  1P3P A;  3VH6 W;  4E44 A;  4J8X D;  3AFA A;  4ZUX C;  1U35 D;  5GT0 D;  3MGS C;  2NQB A;  5BT1 D;  3MGR D;  4J8V D;  1P3F B;  3AFA B;  3VH5 A;  3WTP E;  4XZQ D;  2NQB B;  3AZI A;  1KX4 D;  5B31 G;  2CV5 D;  1KX3 C;  4J8W A;  2HIO A;  3AZI B;  4KUD A;  5GXQ A;  1P3K A;  5B2J A;  3AZJ D;  4J8W B;  2HIO B;  4Z66 D;  1P3P D;  4KUD B;  1N1J A;  5GXQ B;  5DNM C;  5B2J B;  3C1B D;  5B33 A;  3AZK A;  1P3K B;  3W97 D;  3AL0 C;  5JRG D;  3B6G A;  1N1J B;  4ZUX A;  3AZK B;  5B33 B;  3MGS A;  4ZUX B;  2J8P A;  1Z2C B;  3REH C;  4NE3 A;  3MGS B;  1P3G D;  4H9S C;  5E5A C;  5B40 C;  3B0B A;  1M18 C;  3LJA C;  2YFV A;  1KX3 B;  3AZN A;  3AZH C;  5AY8 D;  4CSR B;  4NE6 A;  2YFV B;  1TZY C;  3REK C;  5GSU C;  4NE5 A;  5DNM B;  3AV1 C;  1P3O D;  1B67 A;  5KDM A;  5AV6 C;  3O62 C;  5GT3 A;  3MGP D;  3REH A;  5KDM B;  3MGQ D;  5BNX B;  5B40 A;  1ZLA C;  4R8P C;  3LJA A;  3REH B;  3WAA D;  1WWS A;  3R45 B;  2Y2M A;  5E5A B;  5B40 B;  3UTA C;  5AVB D;  2ZY4 A;  4LD9 D;  3LJA B;  3AZH A;  5CPK A;  4G91 C;  3W99 A;  1P3I D;  3KWQ C;  4EO5 C;  3AZH B;  1KX5 A;  3REK A;  5GSU A;  3EPH A;  3H0L C;  2W8S A;  5AV9 C;  3AV1 A;  3IP4 C;  3UT9 A;  2F8N G;  3O62 A;  5GSU B;  3AFA D;  3REK B;  3AZL C;  3AV1 B;  4QLC C;  2F8N K;  2NQB D;  3UT9 B;  3O62 B;  3X1V A;  2G5I C;  3X1U A;  1ZLA A;  3P5J B;  5CPI C;  3AZI D;  1KU5 A;  3UTA A;  5B32 C;  1ZLA B;  2L5A A;  5C3I C;  5GXQ D;  3UTA B;  2ARO D;  3EG5 B;  3REI A;  3LZ1 C;  4G91 B;  5AV9 A;  3KUY A;  2UWX A;  4AWL C;  3KWQ B;  4EO5 B;  4XUJ C;  3B6G D;  5AV8 D;  5AV9 B;  5BS7 A;  4QLC A;  3MGS D;  3LEL C;  5BNV B;  3VH5 W;  3AZL B;  2NZD C;  3AZG A;  4QLC B;  4YS3 D;  5CPI A;  1F1E A;  3AV2 C;  5FUG A;  2FJ7 C;  1ID3 C;  2Y2N A;  5CPI B;  4JJN D;  5B32 B;  1BH9 A;  1W2E A;  3AYW C;  3AZN D;  3WA9 C;  5C3I B;  3LZ1 A;  3W96 D;  4X23 C;  2PYO A;  1AOI D;  4XUJ A;  1P34 A;  3LZ1 B;  5BO0 A;  3REL A;  4AWL B;  5CP6 D;  3LEL A;  4XUJ B;  3NQU A;  4WU8 C;  1P3B D;  5GT3 D;  5BO0 B;  4KHA A;  3LEL B;  3AV2 A;  2NZD B;  3LJA D;  4KHA B;  2FJ7 A;  4YM6 D;  1H3O B;  3AZM C;  3AV2 B;  2Y2O A;  3AYW A;  3AZH D;  5CPK D;  2FJ7 B;  3B6F C;  2RVQ D;  4Z2M H;  3W99 D;  1P3F A;  3B0C W;  3AYW B;  1KX5 D;  1EQZ C;  3REK D;  4X23 B;  4UPK A;  3UT9 D;  4WU8 A;  3A6N C;  4Z5T C;  5CPJ D;  3X1V D;  3WKJ C;  4WU8 B;  3X1U D;  3MVD D;  3UTA D;  3AZF C;  3B6F A;  4DRA A;  3AZM B;  5B24 D;  3REI D;  4WU9 C;  4WJ3 C;  1EQZ A;  3REJ C;  3B6F B;  3EPK A;  2YFW B;  3KUY D;  2RIQ A;  1EQZ B;  5AV5 C;  1F66 D;  1PZR A;  4J8U D;  3A1I A;  5DNN D;  1KX3 A;  1Q9C A;  2F8N H;  3WKJ A;  3A6N B;  4Z5T B;  3AZG D;  4CSR A;  1P3M C;  3W98 C;  3WKJ B;  3LZ0 C;  1S32 D;  1M1A D;  5DNM A;  3X1S C;  5B1L C;  3AZF B;  4UUZ A;  1ULY A;  3REJ A;  3LZ1 D;  1R4V A;  4WU9 B;  5B2I C;  4UUZ B;  2PYO D;  5BNX A;  1T3U A;  3H0M C;  5B0Z C;  3A1K A;  3REJ B;  1P34 D;  5B1M D;  5AV5 A;  4H9Q B;  3R45 A;  3REL D;  4H9S A;  5E5A A;  3LEL D;  1M18 A;  2F8N B;  5AV5 B;  3C1C C;  1P3A C;  3AZE C;  4DRB A;  1M18 B;  1BH8 A;  3LZ0 A;  2Y2H A;  2FJ7 D;  1BFM A;  5B1L A;  1BH8 B;  4J8X C;  1P3M B;  1B6W A;  1P3L C;  1TZY A;  3LZ0 B;  1U35 C;  5GT0 C;  3X1S B;  5B1L B;  3MGR C;  4J8V C;  5AV6 A;  1TZY B;  1P3F D;  5B2I A;  4XZQ C;  3AN2 C;  1WWI A;  3TU4 C;  5AV6 B;  2CV5 C;  5B2I B;  2F2A C;  4R8P A;  2HUE C;  3AZJ C;  3AZE A;  5CHL B;  4Z66 C;  4R8P B;  4J8W D;  2HIO D;  3C1C B;  3C1B C;  4H9O A;  1P3A B;  4KUD D;  1HTA A;  5B2J D;  1P3K D;  3AZE B;  3W97 C;  5JRG C;  3KWQ A;  1P3L A;  2Y2I A;  4H9O B;  3AZK D;  5GT0 A;  2JE5 A;  5B33 D;  3B6F D;  3MGR A;  4J8X B;  2JSS A;  1P3L B;  2Y2K A;  3F6T A;  4ZUX D;  5BNV A;  2G5H C;  5GT0 B;  3AZL A;  3AN2 A;  1U35 B;  1EQZ D;  3MGR B;  3TU4 A;  3VH6 T;  3B0C T;  4XZQ B;  3UTB C;  4H9R B;  3AN2 B;  3TU4 B;  2CV5 B;  5B32 A;  5B31 C;  1KX3 D;  2ZY2 A;  5AY8 C;  4Z66 A;  3WKJ D;  2BYK B;  2HUE B;  2Y2G A;  3W97 A;  4WNN A;  5JRG A;  4Z66 B;  4CAY B;  3C1B B;  5DNM D;  3W97 B;  1P3O C;  4WNN B;  5JRG B;  3KXB C;  3REJ D;  3MGQ C;  1M19 C;  1A7W A;  3UTB A;  4KGC C;  2NZD A;  3WAA C;  3REH D;  1H3O A;  5AVB C;  5E5A D;  5B40 D;  3UTB B;  5B31 A;  1M18 D;  5AY8 A;  1ID3 A;  1P3I C;  2XD1 A;  5B31 B;  5AY8 B;  3WA9 A;  1ID3 B;  2FFF B;  3LZ0 D;  4HGA C;  4X23 A;  3WA9 B;  1TZY D;  5GSU D;  3KXB A;  3AV1 D;  1P3O B;  2ZM5 A;  3X1T C;  3MGQ A;  1M19 A;  5AV6 D;  5JA4 A;  3O62 D;  3KXB B;  4KGC A;  3WAA A;  3AZI C;  3MGQ B;  1M19 B;  5JA4 B;  5AVB A;  4WV4 B;  4KGC B;  1ZLA D;  4R8P D;  3WAA B;  2ARO C;  4G92 C;  2BG1 A;  5AVB B;  1P3I A;  3AZM A;  5AVC C;  1P3I B;  2YFW A;  2DF4 C;  2ZY3 A;  3KWQ D;  1P3L D;  3B6G C;  5AV8 C;  5AV9 D;  3X1T A;  4HGA B;  2LY8 A;  2IO5 C;  3AZL D;  3A6N A;  4Z5T A;  3AN2 D;  4YS3 C;  3X1T B;  4QLC D;  3TU4 D;  2CWE A;  3KSY A;  4JJN C;  5CPI D;  2ARO A;  1TAF A;  3NQJ A;  5B32 D;  3AZN C;  3AZF A;  2ARO B;  5AVC A;  1TAF B;  3NQJ B;  3W96 C;  4G92 B;  4WU9 A;  1AOI C;  5AV8 A;  2Y2P A;  5AVC B;  5B0Y C;  4H9Q A;  1HQ3 C;  5CP6 C;  4H9P A;  4H9N A;  1P3B C;  3B6G B;  3H0R C;  5AV8 B;  5GT3 C;  4XUJ D;  1JFI A;  2F8N A;  4YS3 A;  4H9N B;  4H9P B;  5F99 C;  1JFI B;  2IO5 B;  3UTB D;  2NZD D;  4YM6 C;  4YS3 B;  4Z2M G;  4JJN A;  3WTP C;  1P3M A;  3W98 A;  3AV2 D;  3VH5 T;  5B31 D;  3MNN C;  5CPK C;  1ID3 D;  2RVQ C;  3X1S A;  3VH6 A;  4JJN B;  3W99 C;  3W96 A;  3W98 B;  3AZN B;  1KX5 C;  3AYW D;  1AOI A;  3WA9 D;  5BT1 C;  5B0Y A;  3W96 B;  1HQ3 A;  3UT9 C;  5CP6 A;  4X23 D;  4NFT A;  1P3B A;  5B0Z A;  1AOI B;  5B0Y B;  3KXB D;  1KX4 C;  5CPJ C;  1HQ3 B;  5CP6 B;  3X1V C;  1P3B B;  5B0Z B;  1M19 D;  5F99 A;  5GT3 B;  3X1U C;  4WU8 D;  3C1C A;  4KGC D;  1P3A A;  4YM6 A;  3MVD C;  3WTP A;  5F99 B;  1P3P C;  3MNN A;  4YM6 B;  4WZS B;  2JCH A;  3WTP B;  4ZBJ C;  5B24 C;  4J8X A;  3REI C;  3AZM D;  3MNN B;  5CPK B;  1U35 A;  3W99 B;  3KUY C;  4J8V A;  1KX5 B;  2BYM A;  4XZQ A;  1F66 C;  4H9R A;  1P3G C;  5BS7 C;  4J8V B;  1KX4 A;  4J8U C;  5CPJ A;  2Y2L A;  5DNN C;  3X1T D;  2CV5 A;  2BYM B;  3AZG C;  3A6N D;  1KX4 B;  2BYK A;  4Z5T D;  5CPJ B;  3MVD A;  3AZJ A;  3X1V B;  3X1U B;  1S32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...