3UT9A

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9A00
3UT9D 5AVCB 3REID 5B1MB 5C3IC 3X1UB 5B31G 5JA4A 1P3LC 3AN2D 4WU8B 1M18B 5CPID 5DNMA 3B0DB 5F99B 5CPKB 3C1BB 4G91B 5AV6A 4H9OB 5AV9C 4J8VB 3LJAC 1P3MD 1TZYD 3NQUA 5BS7C 3AZED 5B32C 5F99C 5AVBB 3KXBD 3B6FC 4KHAA 4NE5A 3UT9C 1BH9A 3A6ND 5B24B 3W98D 3REIC 4WU9B 4H9QA 1P3LA 3AN2C 5B40B 3AZGA 5CPIC 1TZYB 4X23B 4QLCB 3LELB 4J8UA 1N1JB 3O62D 5GXQB 1JFIA 3V9RB 1TZYC 3AZIA 3AZHA 1P3MC 1KX4D 1AOID 3B6GA 5BS7A 5B32A 3AZEC 3KXBC 3B6FA 3X1SB 5AY8D 4ZBJC 3UT9A 3A6NC 5CPJB 3REIA 3W98C 4E45A 4CSRB 3AN2A 3AFAB 3WTPE 3REHB 1AOIB 4Z2MG 3WA9B 3W99A 2IO5B 1ZLAA 4H9SA 3O62C 1F66B 1KX4C 1AOIC 4NE3A 5B2ID 5B0ZB 4R8PD 1KX3D 5AV8D 5AY8C 5DNNA 3R45B 1ID3B 3RELD 3W97B 3REKD 3W98A 1EQZA 3VH5A 4YM6D 4H9NB 5B31D 3WAAD 2BYKB 5CP6B 4YS3D 1P3AB 1P3GD 3AV2B 5G49A 5B2IC 4R8PC 3AZFD 5B2JA 1KX3C 5AV8C 3MGRB 3VH5W 5GT0B 3RELC 4XUJD 3REKC 3LZ0B 2F8NB 5GT3A 1P3KD 4YM6C 5E5AD 2NZDB 1P3GB 5B31C 5BO0A 3REJA 3AV1D 3WAAC 3VH6T 3TU4D 3UTBD 4E44A 4YS3C 3AZMB 1P3GC 1P34B 4KGCD 5B1LD 2PYOD 4Z66D 3AZFC 1KX3A 5AV8A 3W96B 3RELA 3AZMC 3AZKA 4WNNB 4XZQB 4XUJC 2RVQD 1P3KC 4LD9B 3MGSD 2BYMA 5E5AC 5AV5B 3AYWB 4H9RA 3AZJB 3WAAA 3MVDB 3AV1C 3TU4C 2PYOB 3MGPB 4ZUXB 3X1TD 4J8XB 3UTBC 1P3BD 5BNXB 4JJNB 4KGCC 5BNVB 2PYOC 5AVCD 4Z66C 3LZ1B 5B1MD 3X1UD 3AZFA 1KU5A 1F1EA 1P3ID 4DRAA 4WU8D 1U35B 3X1VA 1M18D 2RVQC 1P3KA 3KWQB 5JRGB 2AROB 5F99D 5CPKD 3MGSC 3KUYB 3C1BD 1BH8B 3WKJB 3AV1A 4J8VD 3TU4A 4Z2MH 5DNMB 3X1TC 1KX5B 1P3IB 5AVBD 4EO5B 2CV5A 3B0BA 1P3BC 2F8NG 5B1LA 4Z5TA 5B24D 5AVCC 3NQUB 5B1MC 3X1UC 4WU9D 1P3IC 5B40D 5B33B 4WU8C 1M18C 1H3OA 4X23D 3B0DC 2HIOA 1B67A 4QLCD 5CPKC 3LELD 3C1BC 4G91C 4J8VC 5GXQD 1HQ3B 3UTAD 3X1TA 4J8UB 5AVBC 5B0YB 2NQBB 3X1SD 1P3BA 1P3FB 3AZIB 3AZHB 5CPJD 2YFWA 5B24C 5AVCA 3B6GB 5B1MA 4WU9C 1S32B 5B0YC 5GSUB 5B40C 5AV9A 3AFAD 3LJAA 3C1CB 3REHD 4X23C 3UTAB 3WA9D 5F99A 4QLCC 3LELC 2HUEB 2L5AA 5GXQC 1F66D 3W99B 3UTAC 1ZLAB 5AVBA 5B0ZD 3X1SC 5CPIA 3VH5T 1ID3D 3W97D 5CPJC 4AWLB 4WU9A 2YFVA 5B40A 2FJ7B 3AFAC 5DNNB 3REHC 1TZYA 1P3MA 1WWIA 5CHLB 3WA9C 3AZEA 2IO5C 3KXBA 5CP6D 1N1JA 1M1AB 4J8WB 3A6NA 1P3AD 5GXQA 3V9RA 1F66C 3AV2D 5B0ZC 3X1SA 3MGRD 1ID3C 5GT0D 3W97C 3LZ0D 2F8ND 2F8NK 3O62A 4UUZB 4CSRA 5B2JB 3AZLB 3WTPB 3AFAA 2NZDD 1KX4A 1AOIA 5GT3B 5CP6C 3AZND 5AY8A 3WTPC 1WWSA 3AZMD 1P3AC 3REJB 1P34D 3AV2C 1P3OD 5B0ZA 3W96D 3R45A 3MGRC 1ID3A 2F8NH 5GT0C 3W97A 4XZQD 1P3PB 3LZ0C 3AZNB 1B6WA 4LD9D 4CAYB 4KUDB 3NQJB 5AV5D 2NZDC 3AYWD 3AZJD 3MVDD 1P3OB 3MGPD 2LY8A 5CP6A 5B2IA 4ZUXD 4R8PA 4J8XD 3AZNC 1M19B 5FUGA 3MGQD 3MNNB 3REKA 4JJND 3AV2A 1P34C 5KDMA 1P3OC 4YM6A 3LZ1D 3W96C 5B31A 3MGRA 1U35D 4XZQC 3LZ0A 3KWQD 5JRGD 4YS3A 2AROD 4LD9C 3KUYD 3MGQB 4H9PB 2NZDA 1P3GA 5AV5C 3AYWC 3WKJD 3AZJC 3X1VB 3MVDC 5BT1D 5DNMD 1BFMA 3MGPC 4ZUXC 4J8XC 1KX5D 3MGQC 3AZMA 1P34A 4XUJA 4JJNC 3LZ1C 5E5AA 3W96A 5JA4B 3VH6A 5B33D 1U35C 4WNNA 4XZQA 4Z5TB 3UTBA 3KWQC 5JRGC 4LD9A 2AROC 4NE6A 3KUYC 5AV5A 5AV6B 3AYWA 3WKJC 3AZGD 4KGCA 1H3OB 5BT1C 3KSYA 5DNMC 2PYOA 2HIOB 4Z66A 1HQ3D 1KX5C 1R4VA 4J8UD 5B0YD 4EO5C 2NQBD 4KHAB 4JJNA 1BH9B 1P3FD 3AZID 3AZHD 3B6GD 5C3IB 3MGSA 4H9QB 1P3LB 1S32D 3AZGB 5GSUD 5B33C 3C1CD 1TAFA 2YFWB 3KWQA 5JRGA 2AROA 2CWEA 3KUYA 1BH8A 3WKJA 5AV9B 3AZGC 3LJAB 1JFIB 3W99D 1HQ3C 3X1UA 1KX5A 5B32B 3B6FB 1ZLAD 4J8UC 1P3IA 4WU8A 2NQBC 1M18A 3UT9B 1P3FC 3AZIC 3AZHC 3REIB 1Q9CA 5CPKA 3B6GC 3C1BA 3AN2B 1S32C 4H9OA 5GSUC 5B33A 4J8VA 3C1CC 5DNND 5CPIB 2FJ7D 1EQZD 1M1AD 2YFVB 4M6BA 2HUEC 4J8WD 1P3MB 1ULYA 5B24A 3W99C 1HQ3A 3B0CW 3AZEB 3KXBB 1ZLAC 5B0YA 4ZBJB 4H9SC 4DRBA 2NQBA 1P3FA 4X23A 3A6NB 3W98B 4QLCA 1EQZB 3LELA 4AWLC 1S32A 5B2JD 5GSUA 3AZLD 3WTPD 3C1CA 2FJ7C 5DNNC 3UTAA 4NFTA 1EQZC 5GT3D 3O62B 1M1AC 4J8WC 1KX4B 5CPJA 3REJD 5G49B 5AY8B 3REHA 3WA9A 1P3PD 5B2JC 3AZLC 2FJ7A 4KUDD 5BO0B 1F66A 5B32G 3AZKD 5GT3C 1M19D 1M1AA 4J8WA 3MNND 3REJC 5B2IB 4R8PB 1KX3B 5AV8B 5FUGB 4H9NA 3RELB 3REKB 3AZKB 2BYKA 5KDMB 1P3PC 4YM6B 2BYMB 4UUZA 3AZLA 5B31B 3WTPA 1P3AA 4KUDC 4H9RB 3WAAB 3X1VD 3AZKC 4YS3B 1A7WA 1M19C 2JSSA 5GT0A 3MNNC 2F8NA 3AZFB 2CV5D 4XUJB 1P3PA 4Z5TD 1P3KB 3AZNA 5E5AB 4CAYA 4KUDA 3NQJA 5AV6D 3AV1B 4WV4B 3TU4B 3X1VC 1P3OA 2HIOD 3UTBB 1M19A 2CV5B 3MNNA 4KGCB 4HGAB 5B1LB 4Z66B 1P3LD 1HTAA 4WZSB 2CV5C 3AZJA 3MVDA 4G92B 3MGPA 4HGAC 5B1LC 4Z5TC 4ZUXA 4J8XA 3MGSB 3MGQA 4H9PA 5AV6C 5BNXA 5AV9D 3LJAD 1TAFB 3VH6W 5BNVA 4G92C 3X1TB 2HIOC 3B0CT 3LZ1A 5B32D 3B6FD 1U35A 1P3BB
chains in the Genus database with same CATH superfamily
3UT9D 5AVCB 3REID 5B1MB 5C3IC 3X1UB 5B31G 5JA4A 1P3LC 3AN2D 4WU8B 1M18B 5CPID 5DNMA 3B0DB 5F99B 5CPKB 3C1BB 4G91B 3FDDA 5AV6A 4H9OB 5AV9C 4J8VB 3LJAC 1P3MD 1TZYD 3NQUA 5BS7C 3AZED 5B32C 5F99C 5AVBB 3KXBD 3B6FC 4KHAA 4NE5A 3UT9C 1BH9A 3A6ND 5B24B 3W98D 3REIC 2Y2LA 4WU9B 4H9QA 1P3LA 3AN2C 5B40B 3AZGA 5CPIC 1TZYB 4X23B 4QLCB 3LELB 4J8UA 1N1JB 3O62D 5GXQB 1JFIA 3V9RB 1TZYC 3AZIA 3AZHA 1P3MC 1KX4D 1AOID 3B6GA 5BS7A 5B32A 3AZEC 3A1KA 3KXBC 3B6FA 3X1SB 5AY8D 4ZBJC 3UT9A 3A6NC 5CPJB 3REIA 3EPLA 3W98C 4E45A 4CSRB 3AN2A 3AFAB 3WTPE 3REHB 2G5IC 1AOIB 4Z2MG 3WA9B 3W99A 2IO5B 1ZLAA 4H9SA 3O62C 1F66B 1KX4C 1AOIC 4NE3A 5B2ID 5B0ZB 4R8PD 3IP4C 1KX3D 5AV8D 5AY8C 5DNNA 3R45B 1ID3B 3RELD 3W97B 3REKD 3W98A 1EQZA 3VH5A 4YM6D 4H9NB 5B31D 3WAAD 2BYKB 5CP6B 4YS3D 1P3AB 3EG5B 1P3GD 3AV2B 5G49A 5B2IC 4R8PC 3AZFD 5B2JA 1KX3C 5AV8C 3MGRB 3VH5W 5GT0B 3RELC 4XUJD 3REKC 3LZ0B 2F8NB 5GT3A 1P3KD 4YM6C 2ZY2A 5E5AD 2NZDB 1P3GB 5B31C 5BO0A 3REJA 3AV1D 3WAAC 3VH6T 3TU4D 3UTBD 4E44A 4YS3C 3AZMB 1P3GC 1P34B 4KGCD 5B1LD 2PYOD 4Z66D 3AZFC 1KX3A 5AV8A 3W96B 3RELA 3AZMC 3AZKA 4WNNB 4XZQB 4XUJC 2RVQD 3EPJA 1P3KC 4LD9B 2Y2IA 3MGSD 2BYMA 5E5AC 5AV5B 3AYWB 4H9RA 3AZJB 3WAAA 3MVDB 3AV1C 3TU4C 2PYOB 3MGPB 4ZUXB 3X1TD 4J8XB 3UTBC 2UWXA 1P3BD 5BNXB 3F6TA 4JJNB 4KGCC 5BNVB 2PYOC 5AVCD 4Z66C 2Y2GA 5B1MD 3X1UD 3LZ1B 3AZFA 1KU5A 1F1EA 1P3ID 2F2AC 4DRAA 4WU8D 1U35B 3X1VA 1M18D 2RVQC 1P3KA 3KWQB 5JRGB 2AROB 5F99D 5CPKD 3MGSC 2XD5A 3H0RC 3KUYB 3C1BD 1BH8B 3WKJB 3AV1A 4J8VD 3TU4A 4Z2MH 5DNMB 3X1TC 1KX5B 1P3IB 5AVBD 4EO5B 2CV5A 4UPKA 2G5HC 3B0BA 1P3BC 2F8NG 5B1LA 4Z5TA 5B24D 5AVCC 3NQUB 5B1MC 3X1UC 4WU9D 1P3IC 5B40D 5B33B 4WU8C 1M18C 1H3OA 4X23D 3B0DC 2HIOA 1B67A 4QLCD 5CPKC 3LELD 3C1BC 4G91C 4J8VC 5GXQD 1HQ3B 3UTAD 3X1TA 4J8UB 5AVBC 5B0YB 2NQBB 3X1SD 1P3BA 1P3FB 3AZIB 3AZHB 5CPJD 2YFWA 5B24C 5AVCA 3B6GB 5B1MA 4WU9C 1S32B 5B0YC 5GSUB 5B40C 5AV9A 3AFAD 3LJAA 3C1CB 3REHD 2ZY4A 4X23C 3UTAB 3WA9D 5F99A 4QLCC 3LELC 2Y2HA 1PZRA 2HUEB 2L5AA 5GXQC 1F66D 3W99B 1Z2CB 3UTAC 1ZLAB 5AVBA 5B0ZD 3X1SC 5CPIA 3VH5T 1ID3D 3W97D 5CPJC 4AWLB 4WU9A 2YFVA 5B40A 2FJ7B 3AFAC 5DNNB 3REHC 1TZYA 1P3MA 1WWIA 5CHLB 3WA9C 3AZEA 2IO5C 3KXBA 5CP6D 1N1JA 1M1AB 4J8WB 3A6NA 1P3AD 5GXQA 3V9RA 1F66C 3AV2D 5B0ZC 3X1SA 3H0LC 3MGRD 1ID3C 5GT0D 3A1IA 3W97C 3LZ0D 2F8ND 2F8NK 3O62A 4UUZB 4CSRA 2Y2PA 5B2JB 3AZLB 3WTPB 3AFAA 2NZDD 1KX4A 1AOIA 5GT3B 5CP6C 3AZND 5AY8A 3WTPC 1WWSA 3AZMD 1P3AC 3REJB 1P34D 3AV2C 1P3OD 5B0ZA 3W96D 3R45A 3MGRC 1ID3A 2F8NH 5GT0C 3W97A 4XZQD 1P3PB 3LZ0C 3AZNB 1B6WA 4LD9D 4CAYB 4KUDB 3NQJB 5AV5D 2NZDC 3AYWD 3AZJD 3MVDD 1P3OB 3MGPD 2LY8A 5CP6A 5B2IA 4ZUXD 4R8PA 4J8XD 3AZNC 2W8SA 1M19B 5FUGA 3MGQD 3MNNB 3REKA 4JJND 3AV2A 1P34C 5KDMA 1P3OC 4YM6A 3LZ1D 3W96C 5B31A 3MGRA 1U35D 3H0MC 4XZQC 3LZ0A 3KWQD 5JRGD 4YS3A 2AROD 4LD9C 3KUYD 3MGQB 4H9PB 2NZDA 1P3GA 5AV5C 3AYWC 3WKJD 3AZJC 3X1VB 3MVDC 5BT1D 5DNMD 1BFMA 3MGPC 4ZUXC 4J8XC 1KX5D 3MGQC 3AZMA 1P34A 4XUJA 4JJNC 3EPHA 3LZ1C 5E5AA 3W96A 5JA4B 3VH6A 5B33D 1U35C 4WNNA 4XZQA 4Z5TB 3UTBA 3KWQC 5JRGC 4LD9A 2AROC 4NE6A 3KUYC 5AV5A 5AV6B 3AYWA 3WKJC 3AZGD 4KGCA 1H3OB 5BT1C 3KSYA 5DNMC 4DQYB 2HIOB 4Z66A 2PYOA 1HQ3D 1KX5C 1R4VA 4J8UD 5B0YD 4EO5C 2NQBD 4KHAB 2ZY5A 4JJNA 1BH9B 1P3FD 4WJ3C 3AZID 3AZHD 3B6GD 5C3IB 3MGSA 4H9QB 1P3LB 1S32D 3AZGB 5GSUD 5B33C 3C1CD 1TAFA 2YFWB 3KWQA 5JRGA 2AROA 2CWEA 3KUYA 1BH8A 3WKJA 5AV9B 3AZGC 3LJAB 1JFIB 3W99D 1HQ3C 3X1UA 1KX5A 5B32B 2ZY3A 3B6FB 1ZLAD 4J8UC 1P3IA 2JE5A 4WU8A 2NQBC 1M18A 3UT9B 1P3FC 3AZIC 3AZHC 3REIB 1Q9CA 5CPKA 3B6GC 3C1BA 3AN2B 1S32C 4H9OA 5GSUC 5B33A 4J8VA 3C1CC 5DNND 5CPIB 2FJ7D 1EQZD 2Y2NA 1M1AD 2YFVB 4M6BA 2HUEC 4J8WD 1P3MB 1ULYA 2Y2JA 5B24A 3W99C 1HQ3A 3B0CW 3AZEB 3KXBB 1ZLAC 5B0YA 4ZBJB 4H9SC 4DRBA 2NQBA 2DQNC 1P3FA 2JCHA 4X23A 3A6NB 3W98B 4QLCA 1EQZB 3LELA 4AWLC 1S32A 5B2JD 5GSUA 2BG1A 3AZLD 3WTPD 3C1CA 2FJ7C 5DNNC 3UTAA 4NFTA 1EQZC 5GT3D 3O62B 1M1AC 4J8WC 1KX4B 5CPJA 3REJD 5G49B 2J8PA 5AY8B 3REHA 3WA9A 2Y2QA 1P3PD 5B2JC 3AZLC 2FJ7A 4KUDD 5BO0B 1F66A 3AL0C 5B32G 3AZKD 5GT3C 1M19D 1M1AA 2Y2MA 2FFFB 4J8WA 3MNND 3REJC 5B2IB 4R8PB 1KX3B 3KFUG 5AV8B 5FUGB 4H9NA 2Y2OA 1T3UA 3RELB 3REKB 3AZKB 2BYKA 5KDMB 1P3PC 4YM6B 2BYMB 4UUZA 3AZLA 5B31B 3WTPA 1P3AA 4KUDC 4H9RB 2XD1A 3WAAB 3X1VD 3AZKC 2VQRA 4YS3B 1A7WA 1M19C 2JSSA 3P5JB 5GT0A 3MNNC 2F8NA 3EPKA 3AZFB 2Y2KA 2RIQA 2CV5D 4XUJB 2DF4C 1P3PA 4Z5TD 1P3KB 3AZNA 5E5AB 4CAYA 4KUDA 3NQJA 5AV6D 3AV1B 4WV4B 3TU4B 3X1VC 1P3OA 2HIOD 3UTBB 1M19A 2CV5B 3MNNA 4KGCB 4HGAB 5B1LB 4Z66B 1P3LD 1HTAA 4WZSB 2CV5C 3AZJA 3MVDA 4G92B 3MGPA 4HGAC 5B1LC 4Z5TC 1W2EA 4ZUXA 4J8XA 3MGSB 3MGQA 4H9PA 2ZM5A 5AV6C 5BNXA 5AV9D 3LJAD 1TAFB 3VH6W 5BNVA 4G92C 3X1TB 2HIOC 3B0CT 3LZ1A 5B32D 3B6FD 1U35A 1P3BB
chains in the Genus database with same CATH topology
3UT9D 5AVCB 3REID 5B1MB 5C3IC 3X1UB 5B31G 5JA4A 1P3LC 3AN2D 4WU8B 1M18B 5CPID 5DNMA 3B0DB 5F99B 5CPKB 3C1BB 4G91B 3FDDA 5AV6A 4H9OB 5AV9C 4J8VB 3LJAC 1P3MD 1TZYD 3NQUA 5BS7C 3AZED 5B32C 5F99C 5AVBB 3KXBD 3B6FC 4KHAA 4NE5A 3UT9C 1BH9A 3A6ND 5B24B 3W98D 3REIC 2Y2LA 4WU9B 4H9QA 1P3LA 3AN2C 5B40B 3AZGA 5CPIC 1TZYB 4X23B 4QLCB 3LELB 4J8UA 1N1JB 3O62D 5GXQB 1JFIA 3V9RB 1TZYC 3AZIA 3AZHA 1P3MC 1KX4D 1AOID 3B6GA 5BS7A 5B32A 3AZEC 3A1KA 3KXBC 3B6FA 3X1SB 5AY8D 4ZBJC 3UT9A 3A6NC 5CPJB 3REIA 3EPLA 3W98C 4E45A 4CSRB 3AN2A 3AFAB 3WTPE 3REHB 2G5IC 1AOIB 4Z2MG 3WA9B 3W99A 2IO5B 1ZLAA 4H9SA 3O62C 1F66B 1KX4C 1AOIC 4NE3A 5B2ID 5B0ZB 4R8PD 3IP4C 1KX3D 5AV8D 5AY8C 5DNNA 3R45B 1ID3B 3RELD 3W97B 3REKD 3W98A 1EQZA 3VH5A 4YM6D 4H9NB 5B31D 3WAAD 2BYKB 5CP6B 4YS3D 1P3AB 3EG5B 1P3GD 3AV2B 5G49A 5B2IC 4R8PC 3AZFD 5B2JA 1KX3C 5AV8C 3MGRB 3VH5W 5GT0B 3RELC 4XUJD 3REKC 3LZ0B 2F8NB 5GT3A 1P3KD 4YM6C 2ZY2A 5E5AD 2NZDB 1P3GB 5B31C 5BO0A 3REJA 3AV1D 3WAAC 3VH6T 3TU4D 3UTBD 4E44A 4YS3C 3AZMB 1P3GC 1P34B 4KGCD 5B1LD 2PYOD 4Z66D 3AZFC 1KX3A 5AV8A 3W96B 3RELA 3AZMC 3AZKA 4WNNB 4XZQB 4XUJC 2RVQD 3EPJA 1P3KC 4LD9B 2Y2IA 3MGSD 2BYMA 5E5AC 5AV5B 3AYWB 4H9RA 3AZJB 3WAAA 3MVDB 3AV1C 3TU4C 2PYOB 3MGPB 4ZUXB 3X1TD 4J8XB 3UTBC 2UWXA 1P3BD 5BNXB 3F6TA 4JJNB 4KGCC 5BNVB 2PYOC 5AVCD 4Z66C 2Y2GA 5B1MD 3X1UD 3LZ1B 3AZFA 1KU5A 1F1EA 1P3ID 2F2AC 4DRAA 4WU8D 1U35B 3X1VA 1M18D 2RVQC 1P3KA 3KWQB 5JRGB 2AROB 5F99D 5CPKD 3MGSC 2XD5A 3H0RC 3KUYB 3C1BD 1BH8B 3WKJB 3AV1A 4J8VD 3TU4A 4Z2MH 5DNMB 3X1TC 1KX5B 1P3IB 5AVBD 4EO5B 2CV5A 4UPKA 2G5HC 3B0BA 1P3BC 2F8NG 5B1LA 4Z5TA 5B24D 5AVCC 3NQUB 5B1MC 3X1UC 4WU9D 1P3IC 5B40D 5B33B 4WU8C 1M18C 1H3OA 4X23D 3B0DC 2HIOA 1B67A 4QLCD 5CPKC 3LELD 3C1BC 4G91C 4J8VC 5GXQD 1HQ3B 3UTAD 3X1TA 4J8UB 5AVBC 5B0YB 2NQBB 3X1SD 1P3BA 1P3FB 3AZIB 3AZHB 5CPJD 2YFWA 5B24C 5AVCA 3B6GB 5B1MA 4WU9C 1S32B 5B0YC 5GSUB 5B40C 5AV9A 3AFAD 3LJAA 3C1CB 3REHD 2ZY4A 4X23C 3UTAB 3WA9D 5F99A 4QLCC 3LELC 2Y2HA 1PZRA 2HUEB 2L5AA 5GXQC 1F66D 3W99B 1Z2CB 3UTAC 1ZLAB 5AVBA 5B0ZD 3X1SC 5CPIA 3VH5T 1ID3D 3W97D 5CPJC 4AWLB 4WU9A 2YFVA 5B40A 2FJ7B 3AFAC 5DNNB 3REHC 1TZYA 1P3MA 1WWIA 5CHLB 3WA9C 3AZEA 2IO5C 3KXBA 5CP6D 1N1JA 1M1AB 4J8WB 3A6NA 1P3AD 5GXQA 3V9RA 1F66C 3AV2D 5B0ZC 3X1SA 3H0LC 3MGRD 1ID3C 5GT0D 3A1IA 3W97C 3LZ0D 2F8ND 2F8NK 3O62A 4UUZB 4CSRA 2Y2PA 5B2JB 3AZLB 3WTPB 3AFAA 2NZDD 1KX4A 1AOIA 5GT3B 5CP6C 3AZND 5AY8A 3WTPC 1WWSA 3AZMD 1P3AC 3REJB 1P34D 3AV2C 1P3OD 5B0ZA 3W96D 3R45A 3MGRC 1ID3A 2F8NH 5GT0C 3W97A 4XZQD 1P3PB 3LZ0C 3AZNB 1B6WA 4LD9D 4CAYB 4KUDB 3NQJB 5AV5D 2NZDC 3AYWD 3AZJD 3MVDD 1P3OB 3MGPD 2LY8A 5CP6A 5B2IA 4ZUXD 4R8PA 4J8XD 3AZNC 2W8SA 1M19B 5FUGA 3MGQD 3MNNB 3REKA 4JJND 3AV2A 1P34C 5KDMA 1P3OC 4YM6A 3LZ1D 3W96C 5B31A 3MGRA 1U35D 3H0MC 4XZQC 3LZ0A 3KWQD 5JRGD 4YS3A 2AROD 4LD9C 3KUYD 3MGQB 4H9PB 2NZDA 1P3GA 5AV5C 3AYWC 3WKJD 3AZJC 3X1VB 3MVDC 5BT1D 5DNMD 1BFMA 3MGPC 4ZUXC 4J8XC 1KX5D 3MGQC 3AZMA 1P34A 4XUJA 4JJNC 3EPHA 3LZ1C 5E5AA 3W96A 5JA4B 3VH6A 5B33D 1U35C 4WNNA 4XZQA 4Z5TB 3UTBA 3KWQC 5JRGC 4LD9A 2AROC 4NE6A 3KUYC 5AV5A 5AV6B 3AYWA 3WKJC 3AZGD 4KGCA 1H3OB 5BT1C 3KSYA 5DNMC 4DQYB 2HIOB 4Z66A 2PYOA 1HQ3D 1KX5C 1R4VA 4J8UD 5B0YD 4EO5C 2NQBD 4KHAB 2ZY5A 4JJNA 1BH9B 1P3FD 4WJ3C 3AZID 3AZHD 3B6GD 5C3IB 3MGSA 4H9QB 1P3LB 1S32D 3AZGB 5GSUD 5B33C 3C1CD 1TAFA 2YFWB 3KWQA 5JRGA 2AROA 2CWEA 3KUYA 1BH8A 3WKJA 5AV9B 3AZGC 3LJAB 1JFIB 3W99D 1HQ3C 3X1UA 1KX5A 5B32B 2ZY3A 3B6FB 1ZLAD 4J8UC 1P3IA 2JE5A 4WU8A 2NQBC 1M18A 3UT9B 1P3FC 3AZIC 3AZHC 3REIB 1Q9CA 5CPKA 3B6GC 3C1BA 3AN2B 1S32C 4H9OA 5GSUC 5B33A 4J8VA 3C1CC 5DNND 5CPIB 2FJ7D 1EQZD 2Y2NA 1M1AD 2YFVB 4M6BA 2HUEC 4J8WD 1P3MB 1ULYA 2Y2JA 5B24A 3W99C 1HQ3A 3B0CW 3AZEB 3KXBB 1ZLAC 5B0YA 4ZBJB 4H9SC 4DRBA 2NQBA 2DQNC 1P3FA 2JCHA 4X23A 3A6NB 3W98B 4QLCA 1EQZB 3LELA 4AWLC 1S32A 5B2JD 5GSUA 2BG1A 3AZLD 3WTPD 3C1CA 2FJ7C 5DNNC 3UTAA 4NFTA 1EQZC 5GT3D 3O62B 1M1AC 4J8WC 1KX4B 5CPJA 3REJD 5G49B 2J8PA 5AY8B 3REHA 3WA9A 2Y2QA 1P3PD 5B2JC 3AZLC 2FJ7A 4KUDD 5BO0B 1F66A 3AL0C 5B32G 3AZKD 5GT3C 1M19D 1M1AA 2Y2MA 2FFFB 4J8WA 3MNND 3REJC 5B2IB 4R8PB 1KX3B 3KFUG 5AV8B 5FUGB 4H9NA 2Y2OA 1T3UA 3RELB 3REKB 3AZKB 2BYKA 5KDMB 1P3PC 4YM6B 2BYMB 4UUZA 3AZLA 5B31B 3WTPA 1P3AA 4KUDC 4H9RB 2XD1A 3WAAB 3X1VD 3AZKC 2VQRA 4YS3B 1A7WA 1M19C 2JSSA 3P5JB 5GT0A 3MNNC 2F8NA 3EPKA 3AZFB 2Y2KA 2RIQA 2CV5D 4XUJB 2DF4C 1P3PA 4Z5TD 1P3KB 3AZNA 5E5AB 4CAYA 4KUDA 3NQJA 5AV6D 3AV1B 4WV4B 3TU4B 3X1VC 1P3OA 2HIOD 3UTBB 1M19A 2CV5B 3MNNA 4KGCB 4HGAB 5B1LB 4Z66B 1P3LD 1HTAA 4WZSB 2CV5C 3AZJA 3MVDA 4G92B 3MGPA 4HGAC 5B1LC 4Z5TC 1W2EA 4ZUXA 4J8XA 3MGSB 3MGQA 4H9PA 2ZM5A 5AV6C 5BNXA 5AV9D 3LJAD 1TAFB 3VH6W 5BNVA 4G92C 3X1TB 2HIOC 3B0CT 3LZ1A 5B32D 3B6FD 1U35A 1P3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  5AVC B;  3REI D;  5B1M B;  5C3I C;  3X1U B;  5B31 G;  5JA4 A;  1P3L C;  3AN2 D;  4WU8 B;  1M18 B;  5CPI D;  5DNM A;  3B0D B;  5F99 B;  5CPK B;  3C1B B;  4G91 B;  5AV6 A;  4H9O B;  5AV9 C;  4J8V B;  3LJA C;  1P3M D;  1TZY D;  3NQU A;  5BS7 C;  3AZE D;  5B32 C;  5F99 C;  5AVB B;  3KXB D;  3B6F C;  4KHA A;  4NE5 A;  3UT9 C;  1BH9 A;  3A6N D;  5B24 B;  3W98 D;  3REI C;  4WU9 B;  4H9Q A;  1P3L A;  3AN2 C;  5B40 B;  3AZG A;  5CPI C;  1TZY B;  4X23 B;  4QLC B;  3LEL B;  4J8U A;  1N1J B;  3O62 D;  5GXQ B;  1JFI A;  3V9R B;  1TZY C;  3AZI A;  3AZH A;  1P3M C;  1KX4 D;  1AOI D;  3B6G A;  5BS7 A;  5B32 A;  3AZE C;  3KXB C;  3B6F A;  3X1S B;  5AY8 D;  4ZBJ C;  3UT9 A;  3A6N C;  5CPJ B;  3REI A;  3W98 C;  4E45 A;  4CSR B;  3AN2 A;  3AFA B;  3WTP E;  3REH B;  1AOI B;  4Z2M G;  3WA9 B;  3W99 A;  2IO5 B;  1ZLA A;  4H9S A;  3O62 C;  1F66 B;  1KX4 C;  1AOI C;  4NE3 A;  5B2I D;  5B0Z B;  4R8P D;  1KX3 D;  5AV8 D;  5AY8 C;  5DNN A;  3R45 B;  1ID3 B;  3REL D;  3W97 B;  3REK D;  3W98 A;  1EQZ A;  3VH5 A;  4YM6 D;  4H9N B;  5B31 D;  3WAA D;  2BYK B;  5CP6 B;  4YS3 D;  1P3A B;  1P3G D;  3AV2 B;  5G49 A;  5B2I C;  4R8P C;  3AZF D;  5B2J A;  1KX3 C;  5AV8 C;  3MGR B;  3VH5 W;  5GT0 B;  3REL C;  4XUJ D;  3REK C;  3LZ0 B;  2F8N B;  5GT3 A;  1P3K D;  4YM6 C;  5E5A D;  2NZD B;  1P3G B;  5B31 C;  5BO0 A;  3REJ A;  3AV1 D;  3WAA C;  3VH6 T;  3TU4 D;  3UTB D;  4E44 A;  4YS3 C;  3AZM B;  1P3G C;  1P34 B;  4KGC D;  5B1L D;  2PYO D;  4Z66 D;  3AZF C;  1KX3 A;  5AV8 A;  3W96 B;  3REL A;  3AZM C;  3AZK A;  4WNN B;  4XZQ B;  4XUJ C;  2RVQ D;  1P3K C;  4LD9 B;  3MGS D;  2BYM A;  5E5A C;  5AV5 B;  3AYW B;  4H9R A;  3AZJ B;  3WAA A;  3MVD B;  3AV1 C;  3TU4 C;  2PYO B;  3MGP B;  4ZUX B;  3X1T D;  4J8X B;  3UTB C;  1P3B D;  5BNX B;  4JJN B;  4KGC C;  5BNV B;  2PYO C;  5AVC D;  4Z66 C;  3LZ1 B;  5B1M D;  3X1U D;  3AZF A;  1KU5 A;  1F1E A;  1P3I D;  4DRA A;  4WU8 D;  1U35 B;  3X1V A;  1M18 D;  2RVQ C;  1P3K A;  3KWQ B;  5JRG B;  2ARO B;  5F99 D;  5CPK D;  3MGS C;  3KUY B;  3C1B D;  1BH8 B;  3WKJ B;  3AV1 A;  4J8V D;  3TU4 A;  4Z2M H;  5DNM B;  3X1T C;  1KX5 B;  1P3I B;  5AVB D;  4EO5 B;  2CV5 A;  3B0B A;  1P3B C;  2F8N G;  5B1L A;  4Z5T A;  5B24 D;  5AVC C;  3NQU B;  5B1M C;  3X1U C;  4WU9 D;  1P3I C;  5B40 D;  5B33 B;  4WU8 C;  1M18 C;  1H3O A;  4X23 D;  3B0D C;  2HIO A;  1B67 A;  4QLC D;  5CPK C;  3LEL D;  3C1B C;  4G91 C;  4J8V C;  5GXQ D;  1HQ3 B;  3UTA D;  3X1T A;  4J8U B;  5AVB C;  5B0Y B;  2NQB B;  3X1S D;  1P3B A;  1P3F B;  3AZI B;  3AZH B;  5CPJ D;  2YFW A;  5B24 C;  5AVC A;  3B6G B;  5B1M A;  4WU9 C;  1S32 B;  5B0Y C;  5GSU B;  5B40 C;  5AV9 A;  3AFA D;  3LJA A;  3C1C B;  3REH D;  4X23 C;  3UTA B;  3WA9 D;  5F99 A;  4QLC C;  3LEL C;  2HUE B;  2L5A A;  5GXQ C;  1F66 D;  3W99 B;  3UTA C;  1ZLA B;  5AVB A;  5B0Z D;  3X1S C;  5CPI A;  3VH5 T;  1ID3 D;  3W97 D;  5CPJ C;  4AWL B;  4WU9 A;  2YFV A;  5B40 A;  2FJ7 B;  3AFA C;  5DNN B;  3REH C;  1TZY A;  1P3M A;  1WWI A;  5CHL B;  3WA9 C;  3AZE A;  2IO5 C;  3KXB A;  5CP6 D;  1N1J A;  1M1A B;  4J8W B;  3A6N A;  1P3A D;  5GXQ A;  3V9R A;  1F66 C;  3AV2 D;  5B0Z C;  3X1S A;  3MGR D;  1ID3 C;  5GT0 D;  3W97 C;  3LZ0 D;  2F8N D;  2F8N K;  3O62 A;  4UUZ B;  4CSR A;  5B2J B;  3AZL B;  3WTP B;  3AFA A;  2NZD D;  1KX4 A;  1AOI A;  5GT3 B;  5CP6 C;  3AZN D;  5AY8 A;  3WTP C;  1WWS A;  3AZM D;  1P3A C;  3REJ B;  1P34 D;  3AV2 C;  1P3O D;  5B0Z A;  3W96 D;  3R45 A;  3MGR C;  1ID3 A;  2F8N H;  5GT0 C;  3W97 A;  4XZQ D;  1P3P B;  3LZ0 C;  3AZN B;  1B6W A;  4LD9 D;  4CAY B;  4KUD B;  3NQJ B;  5AV5 D;  2NZD C;  3AYW D;  3AZJ D;  3MVD D;  1P3O B;  3MGP D;  2LY8 A;  5CP6 A;  5B2I A;  4ZUX D;  4R8P A;  4J8X D;  3AZN C;  1M19 B;  5FUG A;  3MGQ D;  3MNN B;  3REK A;  4JJN D;  3AV2 A;  1P34 C;  5KDM A;  1P3O C;  4YM6 A;  3LZ1 D;  3W96 C;  5B31 A;  3MGR A;  1U35 D;  4XZQ C;  3LZ0 A;  3KWQ D;  5JRG D;  4YS3 A;  2ARO D;  4LD9 C;  3KUY D;  3MGQ B;  4H9P B;  2NZD A;  1P3G A;  5AV5 C;  3AYW C;  3WKJ D;  3AZJ C;  3X1V B;  3MVD C;  5BT1 D;  5DNM D;  1BFM A;  3MGP C;  4ZUX C;  4J8X C;  1KX5 D;  3MGQ C;  3AZM A;  1P34 A;  4XUJ A;  4JJN C;  3LZ1 C;  5E5A A;  3W96 A;  5JA4 B;  3VH6 A;  5B33 D;  1U35 C;  4WNN A;  4XZQ A;  4Z5T B;  3UTB A;  3KWQ C;  5JRG C;  4LD9 A;  2ARO C;  4NE6 A;  3KUY C;  5AV5 A;  5AV6 B;  3AYW A;  3WKJ C;  3AZG D;  4KGC A;  1H3O B;  5BT1 C;  3KSY A;  5DNM C;  2PYO A;  2HIO B;  4Z66 A;  1HQ3 D;  1KX5 C;  1R4V A;  4J8U D;  5B0Y D;  4EO5 C;  2NQB D;  4KHA B;  4JJN A;  1BH9 B;  1P3F D;  3AZI D;  3AZH D;  3B6G D;  5C3I B;  3MGS A;  4H9Q B;  1P3L B;  1S32 D;  3AZG B;  5GSU D;  5B33 C;  3C1C D;  1TAF A;  2YFW B;  3KWQ A;  5JRG A;  2ARO A;  2CWE A;  3KUY A;  1BH8 A;  3WKJ A;  5AV9 B;  3AZG C;  3LJA B;  1JFI B;  3W99 D;  1HQ3 C;  3X1U A;  1KX5 A;  5B32 B;  3B6F B;  1ZLA D;  4J8U C;  1P3I A;  4WU8 A;  2NQB C;  1M18 A;  3UT9 B;  1P3F C;  3AZI C;  3AZH C;  3REI B;  1Q9C A;  5CPK A;  3B6G C;  3C1B A;  3AN2 B;  1S32 C;  4H9O A;  5GSU C;  5B33 A;  4J8V A;  3C1C C;  5DNN D;  5CPI B;  2FJ7 D;  1EQZ D;  1M1A D;  2YFV B;  4M6B A;  2HUE C;  4J8W D;  1P3M B;  1ULY A;  5B24 A;  3W99 C;  1HQ3 A;  3B0C W;  3AZE B;  3KXB B;  1ZLA C;  5B0Y A;  4ZBJ B;  4H9S C;  4DRB A;  2NQB A;  1P3F A;  4X23 A;  3A6N B;  3W98 B;  4QLC A;  1EQZ B;  3LEL A;  4AWL C;  1S32 A;  5B2J D;  5GSU A;  3AZL D;  3WTP D;  3C1C A;  2FJ7 C;  5DNN C;  3UTA A;  4NFT A;  1EQZ C;  5GT3 D;  3O62 B;  1M1A C;  4J8W C;  1KX4 B;  5CPJ A;  3REJ D;  5G49 B;  5AY8 B;  3REH A;  3WA9 A;  1P3P D;  5B2J C;  3AZL C;  2FJ7 A;  4KUD D;  5BO0 B;  1F66 A;  5B32 G;  3AZK D;  5GT3 C;  1M19 D;  1M1A A;  4J8W A;  3MNN D;  3REJ C;  5B2I B;  4R8P B;  1KX3 B;  5AV8 B;  5FUG B;  4H9N A;  3REL B;  3REK B;  3AZK B;  2BYK A;  5KDM B;  1P3P C;  4YM6 B;  2BYM B;  4UUZ A;  3AZL A;  5B31 B;  3WTP A;  1P3A A;  4KUD C;  4H9R B;  3WAA B;  3X1V D;  3AZK C;  4YS3 B;  1A7W A;  1M19 C;  2JSS A;  5GT0 A;  3MNN C;  2F8N A;  3AZF B;  2CV5 D;  4XUJ B;  1P3P A;  4Z5T D;  1P3K B;  3AZN A;  5E5A B;  4CAY A;  4KUD A;  3NQJ A;  5AV6 D;  3AV1 B;  4WV4 B;  3TU4 B;  3X1V C;  1P3O A;  2HIO D;  3UTB B;  1M19 A;  2CV5 B;  3MNN A;  4KGC B;  4HGA B;  5B1L B;  4Z66 B;  1P3L D;  1HTA A;  4WZS B;  2CV5 C;  3AZJ A;  3MVD A;  4G92 B;  3MGP A;  4HGA C;  5B1L C;  4Z5T C;  4ZUX A;  4J8X A;  3MGS B;  3MGQ A;  4H9P A;  5AV6 C;  5BNX A;  5AV9 D;  3LJA D;  1TAF B;  3VH6 W;  5BNV A;  4G92 C;  3X1T B;  2HIO C;  3B0C T;  3LZ1 A;  5B32 D;  3B6F D;  1U35 A;  1P3B B; 
#chains in the Genus database with same CATH topology
 3UT9 D;  5AVC B;  3REI D;  5B1M B;  5C3I C;  3X1U B;  5B31 G;  5JA4 A;  1P3L C;  3AN2 D;  4WU8 B;  1M18 B;  5CPI D;  5DNM A;  3B0D B;  5F99 B;  5CPK B;  3C1B B;  4G91 B;  3FDD A;  5AV6 A;  4H9O B;  5AV9 C;  4J8V B;  3LJA C;  1P3M D;  1TZY D;  3NQU A;  5BS7 C;  3AZE D;  5B32 C;  5F99 C;  5AVB B;  3KXB D;  3B6F C;  4KHA A;  4NE5 A;  3UT9 C;  1BH9 A;  3A6N D;  5B24 B;  3W98 D;  3REI C;  2Y2L A;  4WU9 B;  4H9Q A;  1P3L A;  3AN2 C;  5B40 B;  3AZG A;  5CPI C;  1TZY B;  4X23 B;  4QLC B;  3LEL B;  4J8U A;  1N1J B;  3O62 D;  5GXQ B;  1JFI A;  3V9R B;  1TZY C;  3AZI A;  3AZH A;  1P3M C;  1KX4 D;  1AOI D;  3B6G A;  5BS7 A;  5B32 A;  3AZE C;  3A1K A;  3KXB C;  3B6F A;  3X1S B;  5AY8 D;  4ZBJ C;  3UT9 A;  3A6N C;  5CPJ B;  3REI A;  3EPL A;  3W98 C;  4E45 A;  4CSR B;  3AN2 A;  3AFA B;  3WTP E;  3REH B;  2G5I C;  1AOI B;  4Z2M G;  3WA9 B;  3W99 A;  2IO5 B;  1ZLA A;  4H9S A;  3O62 C;  1F66 B;  1KX4 C;  1AOI C;  4NE3 A;  5B2I D;  5B0Z B;  4R8P D;  3IP4 C;  1KX3 D;  5AV8 D;  5AY8 C;  5DNN A;  3R45 B;  1ID3 B;  3REL D;  3W97 B;  3REK D;  3W98 A;  1EQZ A;  3VH5 A;  4YM6 D;  4H9N B;  5B31 D;  3WAA D;  2BYK B;  5CP6 B;  4YS3 D;  1P3A B;  3EG5 B;  1P3G D;  3AV2 B;  5G49 A;  5B2I C;  4R8P C;  3AZF D;  5B2J A;  1KX3 C;  5AV8 C;  3MGR B;  3VH5 W;  5GT0 B;  3REL C;  4XUJ D;  3REK C;  3LZ0 B;  2F8N B;  5GT3 A;  1P3K D;  4YM6 C;  2ZY2 A;  5E5A D;  2NZD B;  1P3G B;  5B31 C;  5BO0 A;  3REJ A;  3AV1 D;  3WAA C;  3VH6 T;  3TU4 D;  3UTB D;  4E44 A;  4YS3 C;  3AZM B;  1P3G C;  1P34 B;  4KGC D;  5B1L D;  2PYO D;  4Z66 D;  3AZF C;  1KX3 A;  5AV8 A;  3W96 B;  3REL A;  3AZM C;  3AZK A;  4WNN B;  4XZQ B;  4XUJ C;  2RVQ D;  3EPJ A;  1P3K C;  4LD9 B;  2Y2I A;  3MGS D;  2BYM A;  5E5A C;  5AV5 B;  3AYW B;  4H9R A;  3AZJ B;  3WAA A;  3MVD B;  3AV1 C;  3TU4 C;  2PYO B;  3MGP B;  4ZUX B;  3X1T D;  4J8X B;  3UTB C;  2UWX A;  1P3B D;  5BNX B;  3F6T A;  4JJN B;  4KGC C;  5BNV B;  2PYO C;  5AVC D;  4Z66 C;  2Y2G A;  5B1M D;  3X1U D;  3LZ1 B;  3AZF A;  1KU5 A;  1F1E A;  1P3I D;  2F2A C;  4DRA A;  4WU8 D;  1U35 B;  3X1V A;  1M18 D;  2RVQ C;  1P3K A;  3KWQ B;  5JRG B;  2ARO B;  5F99 D;  5CPK D;  3MGS C;  2XD5 A;  3H0R C;  3KUY B;  3C1B D;  1BH8 B;  3WKJ B;  3AV1 A;  4J8V D;  3TU4 A;  4Z2M H;  5DNM B;  3X1T C;  1KX5 B;  1P3I B;  5AVB D;  4EO5 B;  2CV5 A;  4UPK A;  2G5H C;  3B0B A;  1P3B C;  2F8N G;  5B1L A;  4Z5T A;  5B24 D;  5AVC C;  3NQU B;  5B1M C;  3X1U C;  4WU9 D;  1P3I C;  5B40 D;  5B33 B;  4WU8 C;  1M18 C;  1H3O A;  4X23 D;  3B0D C;  2HIO A;  1B67 A;  4QLC D;  5CPK C;  3LEL D;  3C1B C;  4G91 C;  4J8V C;  5GXQ D;  1HQ3 B;  3UTA D;  3X1T A;  4J8U B;  5AVB C;  5B0Y B;  2NQB B;  3X1S D;  1P3B A;  1P3F B;  3AZI B;  3AZH B;  5CPJ D;  2YFW A;  5B24 C;  5AVC A;  3B6G B;  5B1M A;  4WU9 C;  1S32 B;  5B0Y C;  5GSU B;  5B40 C;  5AV9 A;  3AFA D;  3LJA A;  3C1C B;  3REH D;  2ZY4 A;  4X23 C;  3UTA B;  3WA9 D;  5F99 A;  4QLC C;  3LEL C;  2Y2H A;  1PZR A;  2HUE B;  2L5A A;  5GXQ C;  1F66 D;  3W99 B;  1Z2C B;  3UTA C;  1ZLA B;  5AVB A;  5B0Z D;  3X1S C;  5CPI A;  3VH5 T;  1ID3 D;  3W97 D;  5CPJ C;  4AWL B;  4WU9 A;  2YFV A;  5B40 A;  2FJ7 B;  3AFA C;  5DNN B;  3REH C;  1TZY A;  1P3M A;  1WWI A;  5CHL B;  3WA9 C;  3AZE A;  2IO5 C;  3KXB A;  5CP6 D;  1N1J A;  1M1A B;  4J8W B;  3A6N A;  1P3A D;  5GXQ A;  3V9R A;  1F66 C;  3AV2 D;  5B0Z C;  3X1S A;  3H0L C;  3MGR D;  1ID3 C;  5GT0 D;  3A1I A;  3W97 C;  3LZ0 D;  2F8N D;  2F8N K;  3O62 A;  4UUZ B;  4CSR A;  2Y2P A;  5B2J B;  3AZL B;  3WTP B;  3AFA A;  2NZD D;  1KX4 A;  1AOI A;  5GT3 B;  5CP6 C;  3AZN D;  5AY8 A;  3WTP C;  1WWS A;  3AZM D;  1P3A C;  3REJ B;  1P34 D;  3AV2 C;  1P3O D;  5B0Z A;  3W96 D;  3R45 A;  3MGR C;  1ID3 A;  2F8N H;  5GT0 C;  3W97 A;  4XZQ D;  1P3P B;  3LZ0 C;  3AZN B;  1B6W A;  4LD9 D;  4CAY B;  4KUD B;  3NQJ B;  5AV5 D;  2NZD C;  3AYW D;  3AZJ D;  3MVD D;  1P3O B;  3MGP D;  2LY8 A;  5CP6 A;  5B2I A;  4ZUX D;  4R8P A;  4J8X D;  3AZN C;  2W8S A;  1M19 B;  5FUG A;  3MGQ D;  3MNN B;  3REK A;  4JJN D;  3AV2 A;  1P34 C;  5KDM A;  1P3O C;  4YM6 A;  3LZ1 D;  3W96 C;  5B31 A;  3MGR A;  1U35 D;  3H0M C;  4XZQ C;  3LZ0 A;  3KWQ D;  5JRG D;  4YS3 A;  2ARO D;  4LD9 C;  3KUY D;  3MGQ B;  4H9P B;  2NZD A;  1P3G A;  5AV5 C;  3AYW C;  3WKJ D;  3AZJ C;  3X1V B;  3MVD C;  5BT1 D;  5DNM D;  1BFM A;  3MGP C;  4ZUX C;  4J8X C;  1KX5 D;  3MGQ C;  3AZM A;  1P34 A;  4XUJ A;  4JJN C;  3EPH A;  3LZ1 C;  5E5A A;  3W96 A;  5JA4 B;  3VH6 A;  5B33 D;  1U35 C;  4WNN A;  4XZQ A;  4Z5T B;  3UTB A;  3KWQ C;  5JRG C;  4LD9 A;  2ARO C;  4NE6 A;  3KUY C;  5AV5 A;  5AV6 B;  3AYW A;  3WKJ C;  3AZG D;  4KGC A;  1H3O B;  5BT1 C;  3KSY A;  5DNM C;  4DQY B;  2HIO B;  4Z66 A;  2PYO A;  1HQ3 D;  1KX5 C;  1R4V A;  4J8U D;  5B0Y D;  4EO5 C;  2NQB D;  4KHA B;  2ZY5 A;  4JJN A;  1BH9 B;  1P3F D;  4WJ3 C;  3AZI D;  3AZH D;  3B6G D;  5C3I B;  3MGS A;  4H9Q B;  1P3L B;  1S32 D;  3AZG B;  5GSU D;  5B33 C;  3C1C D;  1TAF A;  2YFW B;  3KWQ A;  5JRG A;  2ARO A;  2CWE A;  3KUY A;  1BH8 A;  3WKJ A;  5AV9 B;  3AZG C;  3LJA B;  1JFI B;  3W99 D;  1HQ3 C;  3X1U A;  1KX5 A;  5B32 B;  2ZY3 A;  3B6F B;  1ZLA D;  4J8U C;  1P3I A;  2JE5 A;  4WU8 A;  2NQB C;  1M18 A;  3UT9 B;  1P3F C;  3AZI C;  3AZH C;  3REI B;  1Q9C A;  5CPK A;  3B6G C;  3C1B A;  3AN2 B;  1S32 C;  4H9O A;  5GSU C;  5B33 A;  4J8V A;  3C1C C;  5DNN D;  5CPI B;  2FJ7 D;  1EQZ D;  2Y2N A;  1M1A D;  2YFV B;  4M6B A;  2HUE C;  4J8W D;  1P3M B;  1ULY A;  2Y2J A;  5B24 A;  3W99 C;  1HQ3 A;  3B0C W;  3AZE B;  3KXB B;  1ZLA C;  5B0Y A;  4ZBJ B;  4H9S C;  4DRB A;  2NQB A;  2DQN C;  1P3F A;  2JCH A;  4X23 A;  3A6N B;  3W98 B;  4QLC A;  1EQZ B;  3LEL A;  4AWL C;  1S32 A;  5B2J D;  5GSU A;  2BG1 A;  3AZL D;  3WTP D;  3C1C A;  2FJ7 C;  5DNN C;  3UTA A;  4NFT A;  1EQZ C;  5GT3 D;  3O62 B;  1M1A C;  4J8W C;  1KX4 B;  5CPJ A;  3REJ D;  5G49 B;  2J8P A;  5AY8 B;  3REH A;  3WA9 A;  2Y2Q A;  1P3P D;  5B2J C;  3AZL C;  2FJ7 A;  4KUD D;  5BO0 B;  1F66 A;  3AL0 C;  5B32 G;  3AZK D;  5GT3 C;  1M19 D;  1M1A A;  2Y2M A;  2FFF B;  4J8W A;  3MNN D;  3REJ C;  5B2I B;  4R8P B;  1KX3 B;  3KFU G;  5AV8 B;  5FUG B;  4H9N A;  2Y2O A;  1T3U A;  3REL B;  3REK B;  3AZK B;  2BYK A;  5KDM B;  1P3P C;  4YM6 B;  2BYM B;  4UUZ A;  3AZL A;  5B31 B;  3WTP A;  1P3A A;  4KUD C;  4H9R B;  2XD1 A;  3WAA B;  3X1V D;  3AZK C;  2VQR A;  4YS3 B;  1A7W A;  1M19 C;  2JSS A;  3P5J B;  5GT0 A;  3MNN C;  2F8N A;  3EPK A;  3AZF B;  2Y2K A;  2RIQ A;  2CV5 D;  4XUJ B;  2DF4 C;  1P3P A;  4Z5T D;  1P3K B;  3AZN A;  5E5A B;  4CAY A;  4KUD A;  3NQJ A;  5AV6 D;  3AV1 B;  4WV4 B;  3TU4 B;  3X1V C;  1P3O A;  2HIO D;  3UTB B;  1M19 A;  2CV5 B;  3MNN A;  4KGC B;  4HGA B;  5B1L B;  4Z66 B;  1P3L D;  1HTA A;  4WZS B;  2CV5 C;  3AZJ A;  3MVD A;  4G92 B;  3MGP A;  4HGA C;  5B1L C;  4Z5T C;  1W2E A;  4ZUX A;  4J8X A;  3MGS B;  3MGQ A;  4H9P A;  2ZM5 A;  5AV6 C;  5BNX A;  5AV9 D;  3LJA D;  1TAF B;  3VH6 W;  5BNV A;  4G92 C;  3X1T B;  2HIO C;  3B0C T;  3LZ1 A;  5B32 D;  3B6F D;  1U35 A;  1P3B B; 
#chains in the Genus database with same CATH homology
 3UT9 D;  5AVC B;  3REI D;  5B1M B;  5C3I C;  3X1U B;  5B31 G;  5JA4 A;  1P3L C;  3AN2 D;  4WU8 B;  1M18 B;  5CPI D;  5DNM A;  3B0D B;  5F99 B;  5CPK B;  3C1B B;  4G91 B;  3FDD A;  5AV6 A;  4H9O B;  5AV9 C;  4J8V B;  3LJA C;  1P3M D;  1TZY D;  3NQU A;  5BS7 C;  3AZE D;  5B32 C;  5F99 C;  5AVB B;  3KXB D;  3B6F C;  4KHA A;  4NE5 A;  3UT9 C;  1BH9 A;  3A6N D;  5B24 B;  3W98 D;  3REI C;  2Y2L A;  4WU9 B;  4H9Q A;  1P3L A;  3AN2 C;  5B40 B;  3AZG A;  5CPI C;  1TZY B;  4X23 B;  4QLC B;  3LEL B;  4J8U A;  1N1J B;  3O62 D;  5GXQ B;  1JFI A;  3V9R B;  1TZY C;  3AZI A;  3AZH A;  1P3M C;  1KX4 D;  1AOI D;  3B6G A;  5BS7 A;  5B32 A;  3AZE C;  3A1K A;  3KXB C;  3B6F A;  3X1S B;  5AY8 D;  4ZBJ C;  3UT9 A;  3A6N C;  5CPJ B;  3REI A;  3EPL A;  3W98 C;  4E45 A;  4CSR B;  3AN2 A;  3AFA B;  3WTP E;  3REH B;  2G5I C;  1AOI B;  4Z2M G;  3WA9 B;  3W99 A;  2IO5 B;  1ZLA A;  4H9S A;  3O62 C;  1F66 B;  1KX4 C;  1AOI C;  4NE3 A;  5B2I D;  5B0Z B;  4R8P D;  3IP4 C;  1KX3 D;  5AV8 D;  5AY8 C;  5DNN A;  3R45 B;  1ID3 B;  3REL D;  3W97 B;  3REK D;  3W98 A;  1EQZ A;  3VH5 A;  4YM6 D;  4H9N B;  5B31 D;  3WAA D;  2BYK B;  5CP6 B;  4YS3 D;  1P3A B;  3EG5 B;  1P3G D;  3AV2 B;  5G49 A;  5B2I C;  4R8P C;  3AZF D;  5B2J A;  1KX3 C;  5AV8 C;  3MGR B;  3VH5 W;  5GT0 B;  3REL C;  4XUJ D;  3REK C;  3LZ0 B;  2F8N B;  5GT3 A;  1P3K D;  4YM6 C;  2ZY2 A;  5E5A D;  2NZD B;  1P3G B;  5B31 C;  5BO0 A;  3REJ A;  3AV1 D;  3WAA C;  3VH6 T;  3TU4 D;  3UTB D;  4E44 A;  4YS3 C;  3AZM B;  1P3G C;  1P34 B;  4KGC D;  5B1L D;  2PYO D;  4Z66 D;  3AZF C;  1KX3 A;  5AV8 A;  3W96 B;  3REL A;  3AZM C;  3AZK A;  4WNN B;  4XZQ B;  4XUJ C;  2RVQ D;  3EPJ A;  1P3K C;  4LD9 B;  2Y2I A;  3MGS D;  2BYM A;  5E5A C;  5AV5 B;  3AYW B;  4H9R A;  3AZJ B;  3WAA A;  3MVD B;  3AV1 C;  3TU4 C;  2PYO B;  3MGP B;  4ZUX B;  3X1T D;  4J8X B;  3UTB C;  2UWX A;  1P3B D;  5BNX B;  3F6T A;  4JJN B;  4KGC C;  5BNV B;  2PYO C;  5AVC D;  4Z66 C;  2Y2G A;  5B1M D;  3X1U D;  3LZ1 B;  3AZF A;  1KU5 A;  1F1E A;  1P3I D;  2F2A C;  4DRA A;  4WU8 D;  1U35 B;  3X1V A;  1M18 D;  2RVQ C;  1P3K A;  3KWQ B;  5JRG B;  2ARO B;  5F99 D;  5CPK D;  3MGS C;  2XD5 A;  3H0R C;  3KUY B;  3C1B D;  1BH8 B;  3WKJ B;  3AV1 A;  4J8V D;  3TU4 A;  4Z2M H;  5DNM B;  3X1T C;  1KX5 B;  1P3I B;  5AVB D;  4EO5 B;  2CV5 A;  4UPK A;  2G5H C;  3B0B A;  1P3B C;  2F8N G;  5B1L A;  4Z5T A;  5B24 D;  5AVC C;  3NQU B;  5B1M C;  3X1U C;  4WU9 D;  1P3I C;  5B40 D;  5B33 B;  4WU8 C;  1M18 C;  1H3O A;  4X23 D;  3B0D C;  2HIO A;  1B67 A;  4QLC D;  5CPK C;  3LEL D;  3C1B C;  4G91 C;  4J8V C;  5GXQ D;  1HQ3 B;  3UTA D;  3X1T A;  4J8U B;  5AVB C;  5B0Y B;  2NQB B;  3X1S D;  1P3B A;  1P3F B;  3AZI B;  3AZH B;  5CPJ D;  2YFW A;  5B24 C;  5AVC A;  3B6G B;  5B1M A;  4WU9 C;  1S32 B;  5B0Y C;  5GSU B;  5B40 C;  5AV9 A;  3AFA D;  3LJA A;  3C1C B;  3REH D;  2ZY4 A;  4X23 C;  3UTA B;  3WA9 D;  5F99 A;  4QLC C;  3LEL C;  2Y2H A;  1PZR A;  2HUE B;  2L5A A;  5GXQ C;  1F66 D;  3W99 B;  1Z2C B;  3UTA C;  1ZLA B;  5AVB A;  5B0Z D;  3X1S C;  5CPI A;  3VH5 T;  1ID3 D;  3W97 D;  5CPJ C;  4AWL B;  4WU9 A;  2YFV A;  5B40 A;  2FJ7 B;  3AFA C;  5DNN B;  3REH C;  1TZY A;  1P3M A;  1WWI A;  5CHL B;  3WA9 C;  3AZE A;  2IO5 C;  3KXB A;  5CP6 D;  1N1J A;  1M1A B;  4J8W B;  3A6N A;  1P3A D;  5GXQ A;  3V9R A;  1F66 C;  3AV2 D;  5B0Z C;  3X1S A;  3H0L C;  3MGR D;  1ID3 C;  5GT0 D;  3A1I A;  3W97 C;  3LZ0 D;  2F8N D;  2F8N K;  3O62 A;  4UUZ B;  4CSR A;  2Y2P A;  5B2J B;  3AZL B;  3WTP B;  3AFA A;  2NZD D;  1KX4 A;  1AOI A;  5GT3 B;  5CP6 C;  3AZN D;  5AY8 A;  3WTP C;  1WWS A;  3AZM D;  1P3A C;  3REJ B;  1P34 D;  3AV2 C;  1P3O D;  5B0Z A;  3W96 D;  3R45 A;  3MGR C;  1ID3 A;  2F8N H;  5GT0 C;  3W97 A;  4XZQ D;  1P3P B;  3LZ0 C;  3AZN B;  1B6W A;  4LD9 D;  4CAY B;  4KUD B;  3NQJ B;  5AV5 D;  2NZD C;  3AYW D;  3AZJ D;  3MVD D;  1P3O B;  3MGP D;  2LY8 A;  5CP6 A;  5B2I A;  4ZUX D;  4R8P A;  4J8X D;  3AZN C;  2W8S A;  1M19 B;  5FUG A;  3MGQ D;  3MNN B;  3REK A;  4JJN D;  3AV2 A;  1P34 C;  5KDM A;  1P3O C;  4YM6 A;  3LZ1 D;  3W96 C;  5B31 A;  3MGR A;  1U35 D;  3H0M C;  4XZQ C;  3LZ0 A;  3KWQ D;  5JRG D;  4YS3 A;  2ARO D;  4LD9 C;  3KUY D;  3MGQ B;  4H9P B;  2NZD A;  1P3G A;  5AV5 C;  3AYW C;  3WKJ D;  3AZJ C;  3X1V B;  3MVD C;  5BT1 D;  5DNM D;  1BFM A;  3MGP C;  4ZUX C;  4J8X C;  1KX5 D;  3MGQ C;  3AZM A;  1P34 A;  4XUJ A;  4JJN C;  3EPH A;  3LZ1 C;  5E5A A;  3W96 A;  5JA4 B;  3VH6 A;  5B33 D;  1U35 C;  4WNN A;  4XZQ A;  4Z5T B;  3UTB A;  3KWQ C;  5JRG C;  4LD9 A;  2ARO C;  4NE6 A;  3KUY C;  5AV5 A;  5AV6 B;  3AYW A;  3WKJ C;  3AZG D;  4KGC A;  1H3O B;  5BT1 C;  3KSY A;  5DNM C;  4DQY B;  2HIO B;  4Z66 A;  2PYO A;  1HQ3 D;  1KX5 C;  1R4V A;  4J8U D;  5B0Y D;  4EO5 C;  2NQB D;  4KHA B;  2ZY5 A;  4JJN A;  1BH9 B;  1P3F D;  4WJ3 C;  3AZI D;  3AZH D;  3B6G D;  5C3I B;  3MGS A;  4H9Q B;  1P3L B;  1S32 D;  3AZG B;  5GSU D;  5B33 C;  3C1C D;  1TAF A;  2YFW B;  3KWQ A;  5JRG A;  2ARO A;  2CWE A;  3KUY A;  1BH8 A;  3WKJ A;  5AV9 B;  3AZG C;  3LJA B;  1JFI B;  3W99 D;  1HQ3 C;  3X1U A;  1KX5 A;  5B32 B;  2ZY3 A;  3B6F B;  1ZLA D;  4J8U C;  1P3I A;  2JE5 A;  4WU8 A;  2NQB C;  1M18 A;  3UT9 B;  1P3F C;  3AZI C;  3AZH C;  3REI B;  1Q9C A;  5CPK A;  3B6G C;  3C1B A;  3AN2 B;  1S32 C;  4H9O A;  5GSU C;  5B33 A;  4J8V A;  3C1C C;  5DNN D;  5CPI B;  2FJ7 D;  1EQZ D;  2Y2N A;  1M1A D;  2YFV B;  4M6B A;  2HUE C;  4J8W D;  1P3M B;  1ULY A;  2Y2J A;  5B24 A;  3W99 C;  1HQ3 A;  3B0C W;  3AZE B;  3KXB B;  1ZLA C;  5B0Y A;  4ZBJ B;  4H9S C;  4DRB A;  2NQB A;  2DQN C;  1P3F A;  2JCH A;  4X23 A;  3A6N B;  3W98 B;  4QLC A;  1EQZ B;  3LEL A;  4AWL C;  1S32 A;  5B2J D;  5GSU A;  2BG1 A;  3AZL D;  3WTP D;  3C1C A;  2FJ7 C;  5DNN C;  3UTA A;  4NFT A;  1EQZ C;  5GT3 D;  3O62 B;  1M1A C;  4J8W C;  1KX4 B;  5CPJ A;  3REJ D;  5G49 B;  2J8P A;  5AY8 B;  3REH A;  3WA9 A;  2Y2Q A;  1P3P D;  5B2J C;  3AZL C;  2FJ7 A;  4KUD D;  5BO0 B;  1F66 A;  3AL0 C;  5B32 G;  3AZK D;  5GT3 C;  1M19 D;  1M1A A;  2Y2M A;  2FFF B;  4J8W A;  3MNN D;  3REJ C;  5B2I B;  4R8P B;  1KX3 B;  3KFU G;  5AV8 B;  5FUG B;  4H9N A;  2Y2O A;  1T3U A;  3REL B;  3REK B;  3AZK B;  2BYK A;  5KDM B;  1P3P C;  4YM6 B;  2BYM B;  4UUZ A;  3AZL A;  5B31 B;  3WTP A;  1P3A A;  4KUD C;  4H9R B;  2XD1 A;  3WAA B;  3X1V D;  3AZK C;  2VQR A;  4YS3 B;  1A7W A;  1M19 C;  2JSS A;  3P5J B;  5GT0 A;  3MNN C;  2F8N A;  3EPK A;  3AZF B;  2Y2K A;  2RIQ A;  2CV5 D;  4XUJ B;  2DF4 C;  1P3P A;  4Z5T D;  1P3K B;  3AZN A;  5E5A B;  4CAY A;  4KUD A;  3NQJ A;  5AV6 D;  3AV1 B;  4WV4 B;  3TU4 B;  3X1V C;  1P3O A;  2HIO D;  3UTB B;  1M19 A;  2CV5 B;  3MNN A;  4KGC B;  4HGA B;  5B1L B;  4Z66 B;  1P3L D;  1HTA A;  4WZS B;  2CV5 C;  3AZJ A;  3MVD A;  4G92 B;  3MGP A;  4HGA C;  5B1L C;  4Z5T C;  1W2E A;  4ZUX A;  4J8X A;  3MGS B;  3MGQ A;  4H9P A;  2ZM5 A;  5AV6 C;  5BNX A;  5AV9 D;  3LJA D;  1TAF B;  3VH6 W;  5BNV A;  4G92 C;  3X1T B;  2HIO C;  3B0C T;  3LZ1 A;  5B32 D;  3B6F D;  1U35 A;  1P3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...