3UT9A

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9A00
3VH6T 5DNND 4ZUXC 3X1SD 4R8PB 2YFWA 4NE6A 4J8VA 5AY8C 2NZDA 4H9OB 3MGQA 3B6FA 5JRGA 3REHA 2IO5C 4ZUXD 4QLCB 4H9SC 5AV9B 3REKA 5B2JA 5AY8D 3AZGA 5F99B 5B1LB 4R8PC 1P3KA 2HIOA 3UTAB 4YS3C 3AZJA 5CPIA 3AFAB 1BH8A 5B0YB 1P3LB 4R8PD 4QLCC 5AV9C 2YFVB 5B31G 5F99C 5B1LC 1P34C 5E5AA 4YS3D 4CAYA 3UTAC 1TZYB 3TU4A 1JFIB 2AROA 5AV9D 4Z66B 5AVCC 3B0CW 5F99D 4HGAB 4CSRA 4XZQA 5B0YC 4JJNA 5B1LD 1P3LC 1ID3C 1P34D 3AZFA 5BO0A 3MGRA 4X23A 3RELA 3WTPB 1P3IA 3UTAD 3O62B 2BYMA 3W99B 4WNNB 5CPKB 5AVCD 3WAAB 1P3LD 1TZYC 5GT0A 5B0YD 1U35A 1ID3D 2PYOB 3REIA 3AZHB 2FJ7B 1HQ3A 1P3BA 5B31A 2NQBB 4Z66C 5GXQB 1ZLAB 5AV5B 4J8XA 5CHLB 5B1MC 4WU8A 4WU9A 3WTPC 3AZLB 5CPJA 3O62C 4XUJA 1TZYD 1HTAA 3AV1A 1M1AB 3AZEB 5B2IB 5CPKC 4Z66D 1KX4B 1P3AB 4KGCA 3MVDB 2PYOC 3KUYC 3AZHC 2FJ7C 3UT9B 5DNMA 5B1MD 5GXQC 3WTPD 3O62D 1ZLAC 4M6BA 3MGSA 3W97A 5AV5C 1P3PB 2RVQC 5G49A 5CPKD 1H3OA 2PYOD 3KUYD 3AZHD 2FJ7D 1M1AC 4H9NB 5B2IC 4NE5A 1KX4C 5GXQD 3C1BB 4DRAA 5CP6A 1ZLAD 3AFAA 3KSYA 4Z2MH 5AV5D 1WWSA 3X1SB 4J8WA 2RVQD 5KDMB 3W96A 1R4VA 3B0DB 1KX5C 3NQJB 4WV4B 3LJAA 3AZMB 3AN2B 1M1AD 5B2ID 3MNNA 2NZDC 1KX4D 1S32A 1M18A 3WA9B 3A6NA 5B24A 3C1BC 5GSUB 1KX5D 3AYWA 5B2JC 1P3MB 1BFMA 4H9RA 3KXBB 1AOIA 2NZDD 3B0DC 3MGPA 1B67A 3AZMC 3AN2C 5BS7A 3AZIA 3WTPE 3UTBB 3C1BD 3WKJA 4G91B 3WA9C 5B2JD 3AZJC 4J8UA 3X1VB 2BYKA 5GSUC 4EO5B 5AV6A 4UUZA 1P3MC 3AZMD 2CV5B 3AN2D 3KXBC 4YS3B 3VH5A 3R45A 5E5AC 4Z5TA 5GT3C 3WA9D 3AZJD 3UTBC 3TU4C 5GSUD 4G91C 1EQZA 5AVBB 1P3AA 5B32B 3LELA 1P3MD 3X1VC 1P34B 3KXBD 3UT9A 3AV2A 3AZFC 3RELC 5E5AD 4EO5C 3REJA 1Q9CA 3LZ1B 5AV8A 2CV5C 5GT3D 1P3GB 4YM6A 1BH9A 3UTBD 3TU4D 5AVCB 3C1CB 4H9PB 5BNXB 3X1TB 1ID3B 4KUDA 5B33A 3X1VD 1N1JA 3AZFD 5AVBC 3X1UB 5B32C 3RELD 2CV5D 5DNNA 3AZKB 3LZ0A 5KDMA 5B40C 4Z2MG 3LZ1C 1M19B 1P3GC 3B6GB 5BNVB 5AVBD 3C1CC 3X1TC 2JSSA 5B32D 5JA4B 1A7WA 4ZUXA 3X1UC 3W98A 5B1MB 5B40D 4LD9B 4H9QB 3LZ1D 5AY8A 5B0ZA 1P3FB 1P3GD 2F8NB 3AZKC 3W97C 1P3OB 3V9RB 3C1CD 4KHAB 3X1TD 1M19C 3B6GC 3KUYB 3X1UD 4H9SA 3KWQC 1KX3C 3AZKD 4R8PA 3W97D 1TAFB 4LD9C 1P3FC 2HUEC 1M19D 3B6GD 3AZNB 1F66B 3NQUB 3VH5W 3VH6A 1P3OC 4H9OA 3KWQD 1KX3D 4QLCA 4WZSB 4LD9D 5AV9A 1P3FD 5F99A 2YFWB 1KX5B 2F8ND 5B1LA 4J8VB 4G92B 2NZDB 1P3OD 3UTAA 3AZNC 1F66C 3MGQB 3MGPC 3B6FB 5JRGB 3REHB 5BS7C 4NFTA 1P3LA 5B0YA 3WKJC 3REKB 3AZGB 5B2JB 2YFVA 1P3KB 3AZND 1F66D 4J8VC 2HIOB 3MGPD 4AWLB 1WWIA 4G92C 2LY8A 3MGQC 1TZYA 3WKJD 4Z5TC 4ZBJB 3B6FC 3AZJB 1JFIA 5JRGC 5CPIB 3REHC 1BH8B 4Z66A 1F1EA 3REKC 3AZGC 4J8VD 5B1MA 3AV2C 3WTPA 1P3KC 3O62A 5E5AB 2HIOC 4CAYB 3MGQD 4AWLC 5GT3B 4Z5TD 3B6FD 5JRGD 3W99A 4YM6C 3REHD 3TU4B 4WNNA 5CPKA 3WAAA 2AROB 2PYOA 4ZBJC 3REKD 3AZGD 3AZHA 4JJNB 4XZQB 2FJ7A 5CPIC 4CSRB 2NQBA 3AZFB 5BO0B 5GXQA 3MGRB 4X23B 3AV2D 1P3KD 3RELB 1ZLAA 2HIOD 1P3IB 5AV5A 2BYMB 1TAFA 4YM6D 3AZLA 2CWEA 3LZ0C 3VH6W 1B6WA 5CPID 1M1AA 5GT0B 5B2IA 4E45A 3AZEA 1U35B 3REIB 2AROC 1KX4A 1HQ3B 3MVDA 1P3BB 5B31B 4JJNC 4XZQC 3MGRC 4X23C 5B40B 2F8NH 3LZ0D 4WU8B 4J8XB 4WU9B 5CPJB 1KX5A 1P3IC 3W98C 5B0ZC 1P3PA 4XUJB 2AROD 3AV1B 4JJND 4XZQD 4H9NA 5GT0C 1U35C 4KGCB 3REIC 3MGRD 3C1BA 1HQ3C 4X23D 1P3BC 5B31C 5DNMB 3W98D 1P3ID 5B0ZD 3X1SA 3MGSB 3W97B 4J8XC 4WU8C 4WU9C 5CPJC 3NQJA 5G49B 4XUJC 1H3OB 3AZMA 3AN2A 5GT0D 1U35D 3REID 3AV1C 1HQ3D 1P3BD 5B31D 3KWQB 4KGCC 3WA9A 5CP6B 1KX3B 5BT1C 5GSUA 5DNMC 4J8XD 4WU9D 4WU8D 5CPJD 2HUEB 4J8WB 3W96B 3B0CT 4DRBA 5B32G 4XUJD 3MGSC 1P3MA 3KXBA 3LJAB 3AV1D 3MNNB 1S32B 5GT3A 4KGCD 3UTBA 1M18B 5BT1D 5DNMD 4QLCD 3A6NB 5B24B 5FUGB 5CP6C 3MGSD 3AFAC 3AYWB 3X1VA 4J8WC 4H9RB 1AOIB 3W96C 2CV5A 3MGPB 3LJAC 4YS3A 3MNNC 3AZIB 1S32C 5CP6D 3WKJB 3AFAD 1M18C 3VH5T 3A6NC 5B24C 5AVBA 4J8WD 4E44A 4J8UB 2BYKB 5B32A 3W96D 4HGAC 1P34A 3AYWC 5AV6B 4UUZB 3LJAD 1AOIC 5B40A 3MNND 3LZ1A 1S32D 1P3GA 3R45B 4Z5TB 2F8NG 1M18D 3A6ND 3AZIC 5B24D 3W99C 5AVCA 3C1CA 4H9PA 5BNXA 3X1TA 3B0BA 3WAAC 1ID3A 1ULYA 1EQZB 2F8NK 3AYWD 3LELB 4J8UC 3X1UA 1AOID 3AV2B 2NQBC 3REJB 5AV6C 3AZKA 1KU5A 5AV8B 5C3IB 4YM6B 3AZID 1BH9B 3W99D 3AZLC 1M19A 3B6GA 3WAAD 5BNVA 4KUDB 5B33B 4J8UD 1N1JB 3AZEC 2NQBD 3KWQA 1EQZC 1P3AC 3MVDC 5JA4A 3LELC 5AV6D 1KX3A 3UT9C 5DNNB 4H9QA 4LD9A 1P3FA 3LZ0B 3AZLD 3REJC 2F8NA 5AV8C 5C3IC 1P3PC 1P3OA 3V9RA 3AZED 4KHAA 1EQZD 1P3AD 3KUYA 3MVDD 3LELD 4KUDC 5B33C 3UT9D 4ZUXB 3W98B 5FUGA 3REJD 4NE3A 5AY8B 5AV8D 2L5AA 5B0ZB 5DNNC 1P3PD 3X1SC 3AZNA 1F66A 3NQUA 4KUDD 5B33D 2IO5B
chains in the Genus database with same CATH superfamily
3VH6T 5DNND 2F2AC 4ZUXC 3X1SD 4R8PB 2YFWA 4NE6A 4J8VA 5AY8C 2NZDA 2W8SA 4H9OB 3MGQA 3B6FA 2G5IC 5JRGA 3REHA 2IO5C 4ZUXD 4QLCB 4H9SC 2XD1A 2RIQA 5AV9B 3REKA 5B2JA 5AY8D 3AZGA 3P5JB 5F99B 5B1LB 4R8PC 2G5HC 1P3KA 2HIOA 3UTAB 2Y2IA 4YS3C 3AZJA 5CPIA 3AFAB 1BH8A 5B0YB 1P3LB 4R8PD 4QLCC 5AV9C 2YFVB 5B31G 5F99C 5B1LC 1P34C 3EPHA 5E5AA 4YS3D 4CAYA 4UPKA 3UTAC 1TZYB 3TU4A 1JFIB 2AROA 5AV9D 4Z66B 5AVCC 3B0CW 5F99D 4HGAB 4CSRA 5B0YC 4XZQA 4JJNA 5B1LD 1P3LC 1ID3C 1P34D 3AZFA 5BO0A 3MGRA 4X23A 3RELA 3WTPB 1P3IA 4DQYB 3UTAD 3O62B 2BYMA 3W99B 3EPJA 4WNNB 5CPKB 5AVCD 3WAAB 1P3LD 1TZYC 5GT0A 5B0YD 1U35A 1ID3D 2PYOB 3REIA 3AZHB 2FJ7B 1HQ3A 1P3BA 5B31A 2NQBB 4Z66C 5GXQB 2Y2GA 2ZY5A 1ZLAB 5AV5B 4J8XA 5CHLB 5B1MC 4WU8A 4WU9A 3WTPC 3AZLB 5CPJA 3O62C 1T3UA 2XD5A 4XUJA 1TZYD 1HTAA 2UWXA 3EPKA 3AV1A 3AZEB 5B2IB 1M1AB 5CPKC 4Z66D 2Y2MA 1KX4B 1P3AB 4KGCA 3MVDB 2PYOC 3KUYC 3AZHC 2FJ7C 3UT9B 5DNMA 5B1MD 5GXQC 3WTPD 3O62D 1ZLAC 4M6BA 3MGSA 3W97A 5AV5C 1P3PB 2RVQC 5G49A 5CPKD 1H3OA 2PYOD 2DQNC 3KUYD 3AZHD 2FJ7D 1M1AC 4H9NB 5B2IC 4NE5A 1KX4C 5GXQD 3C1BB 4DRAA 5CP6A 1ZLAD 3AFAA 3KSYA 4Z2MH 5AV5D 1WWSA 3X1SB 4J8WA 2RVQD 5KDMB 3W96A 1R4VA 3B0DB 1KX5C 3NQJB 4WV4B 3EG5B 3LJAA 3AZMB 3AN2B 1M1AD 5B2ID 3MNNA 2NZDC 1KX4D 1S32A 1M18A 3WA9B 3A6NA 5B24A 3C1BC 5GSUB 1KX5D 3AYWA 5B2JC 1P3MB 1BFMA 4H9RA 3KXBB 1AOIA 2NZDD 3B0DC 3MGPA 1B67A 3AZMC 3AN2C 5BS7A 3AZIA 3WTPE 3UTBB 3C1BD 2ZM5A 3WKJA 4G91B 3H0MC 3WA9C 5B2JD 3AZJC 4J8UA 3X1VB 2BYKA 5GSUC 4EO5B 5AV6A 4UUZA 1P3MC 3AZMD 2CV5B 3AN2D 3KXBC 4YS3B 2ZY4A 3VH5A 3R45A 5E5AC 4Z5TA 5GT3C 3WA9D 3AZJD 3UTBC 3TU4C 5GSUD 4G91C 1EQZA 5AVBB 1P3AA 2ZY3A 3A1IA 5B32B 2FFFB 3LELA 1P3MD 2Y2HA 3X1VC 1P34B 3KXBD 3UT9A 3AV2A 3AZFC 3RELC 5E5AD 4EO5C 3REJA 1Q9CA 3LZ1B 5AV8A 2CV5C 5GT3D 3IP4C 1P3GB 4YM6A 1BH9A 3UTBD 3TU4D 5AVCB 3C1CB 4H9PB 5BNXB 3X1TB 1ID3B 4KUDA 5B33A 3X1VD 1N1JA 3AZFD 5AVBC 3X1UB 5B32C 3RELD 2CV5D 5DNNA 3AZKB 3LZ0A 5KDMA 5B40C 4Z2MG 2Y2QA 3LZ1C 1M19B 1P3GC 3B6GB 5BNVB 3F6TA 5AVBD 3C1CC 3X1TC 2JSSA 5B32D 5JA4B 1A7WA 4ZUXA 3X1UC 3W98A 5B1MB 5B40D 4LD9B 4H9QB 3LZ1D 5AY8A 5B0ZA 1P3FB 1P3GD 2F8NB 3AZKC 2ZY2A 3W97C 1P3OB 3V9RB 3C1CD 4KHAB 3X1TD 1M19C 3B6GC 3KUYB 3X1UD 4H9SA 3KWQC 1KX3C 3AZKD 4R8PA 3W97D 1TAFB 4LD9C 1P3FC 2HUEC 1M19D 3B6GD 3AZNB 1F66B 3NQUB 3VH5W 3VH6A 1P3OC 4H9OA 3KWQD 1KX3D 4QLCA 4WZSB 4LD9D 5AV9A 1P3FD 5F99A 2YFWB 1KX5B 2F8ND 5B1LA 4J8VB 4G92B 2NZDB 1P3OD 3UTAA 3AZNC 1F66C 3MGQB 3MGPC 3B6FB 5JRGB 3REHB 5BS7C 4NFTA 1P3LA 5B0YA 3WKJC 3REKB 3AZGB 5B2JB 2YFVA 1Z2CB 1P3KB 3AZND 1F66D 4J8VC 2HIOB 3MGPD 4AWLB 1WWIA 4G92C 2LY8A 3MGQC 1TZYA 3WKJD 4Z5TC 4ZBJB 3B6FC 3AZJB 1JFIA 5JRGC 5CPIB 3REHC 1BH8B 4Z66A 1F1EA 3REKC 3AZGC 4J8VD 2JE5A 5B1MA 2Y2LA 3WTPA 3AV2C 1P3KC 3O62A 5E5AB 2HIOC 4CAYB 3MGQD 4AWLC 5GT3B 4Z5TD 2Y2KA 3B6FD 5JRGD 3W99A 4YM6C 3REHD 3TU4B 4WNNA 5CPKA 3WAAA 2AROB 2PYOA 4ZBJC 3REKD 3AZGD 3AZHA 4JJNB 4XZQB 2FJ7A 5CPIC 4CSRB 2NQBA 3AZFB 5BO0B 5GXQA 3MGRB 4X23B 3AV2D 1P3KD 3RELB 1ZLAA 2HIOD 1P3IB 5AV5A 2BYMB 1TAFA 4YM6D 3AZLA 2CWEA 3LZ0C 3VH6W 1B6WA 5CPID 1M1AA 5GT0B 5B2IA 4E45A 3AZEA 1U35B 3REIB 2AROC 1KX4A 1HQ3B 3MVDA 1P3BB 5B31B 4JJNC 4XZQC 3MGRC 4X23C 3AL0C 5B40B 2F8NH 3LZ0D 4WU8B 4J8XB 4WU9B 5CPJB 1KX5A 1P3IC 3W98C 5B0ZC 1P3PA 4XUJB 2AROD 3AV1B 4JJND 4XZQD 4H9NA 5GT0C 1U35C 4KGCB 2Y2OA 3REIC 3MGRD 3C1BA 1HQ3C 4X23D 1P3BC 5B31C 5DNMB 3W98D 1P3ID 5B0ZD 3A1KA 3X1SA 3MGSB 3W97B 4J8XC 4WU8C 3H0LC 4WU9C 5CPJC 3NQJA 5G49B 4XUJC 1H3OB 3AZMA 3AN2A 5GT0D 1U35D 3REID 3AV1C 1HQ3D 1P3BD 5B31D 3KWQB 4KGCC 3WA9A 5CP6B 1KX3B 5BT1C 5GSUA 5DNMC 4J8XD 4WU9D 4WU8D 5CPJD 2HUEB 4J8WB 3W96B 3B0CT 4DRBA 5B32G 4XUJD 3MGSC 1P3MA 3KXBA 3LJAB 3AV1D 3MNNB 1S32B 5GT3A 4KGCD 3UTBA 1M18B 5BT1D 5DNMD 4QLCD 3A6NB 5B24B 5FUGB 5CP6C 3MGSD 3AFAC 3AYWB 3X1VA 4J8WC 4H9RB 1AOIB 3W96C 2CV5A 3MGPB 3LJAC 4YS3A 3MNNC 2BG1A 3AZIB 1S32C 5CP6D 3WKJB 3AFAD 1M18C 3VH5T 3A6NC 5B24C 5AVBA 4J8WD 4E44A 4J8UB 2BYKB 5B32A 3W96D 4HGAC 1P34A 3AYWC 5AV6B 4UUZB 3LJAD 3FDDA 1AOIC 5B40A 3MNND 1PZRA 3LZ1A 1S32D 1P3GA 3R45B 4Z5TB 2F8NG 1M18D 3A6ND 3AZIC 5B24D 3W99C 5AVCA 3C1CA 4H9PA 5BNXA 3X1TA 3B0BA 3WAAC 1ID3A 1ULYA 1EQZB 2F8NK 3AYWD 3LELB 4J8UC 3X1UA 1AOID 3AV2B 2NQBC 1W2EA 3REJB 5AV6C 3AZKA 1KU5A 5AV8B 5C3IB 4YM6B 3AZID 1BH9B 3W99D 3AZLC 1M19A 3B6GA 3WAAD 5BNVA 4KUDB 5B33B 4J8UD 1N1JB 3AZEC 2NQBD 3KWQA 1EQZC 1P3AC 3MVDC 5JA4A 2VQRA 3LELC 5AV6D 1KX3A 3KFUG 3UT9C 5DNNB 4H9QA 3H0RC 4LD9A 1P3FA 3LZ0B 3AZLD 2Y2PA 3REJC 2F8NA 5AV8C 5C3IC 1P3PC 2JCHA 1P3OA 3V9RA 2Y2JA 4KHAA 3AZED 1EQZD 1P3AD 3KUYA 3MVDD 3LELD 4KUDC 5B33C 3UT9D 4WJ3C 4ZUXB 2J8PA 5FUGA 3W98B 3REJD 4NE3A 5AY8B 5AV8D 2L5AA 5B0ZB 3EPLA 5DNNC 1P3PD 3X1SC 3AZNA 1F66A 3NQUA 4KUDD 5B33D 2DF4C 2Y2NA 2IO5B
chains in the Genus database with same CATH topology
3VH6T 5DNND 2F2AC 4ZUXC 3X1SD 4R8PB 2YFWA 4NE6A 4J8VA 5AY8C 2NZDA 2W8SA 4H9OB 3MGQA 3B6FA 2G5IC 5JRGA 3REHA 2IO5C 4ZUXD 4QLCB 4H9SC 2XD1A 2RIQA 5AV9B 3REKA 5B2JA 5AY8D 3AZGA 3P5JB 5F99B 5B1LB 4R8PC 2G5HC 1P3KA 2HIOA 3UTAB 2Y2IA 4YS3C 3AZJA 5CPIA 3AFAB 1BH8A 5B0YB 1P3LB 4R8PD 4QLCC 5AV9C 2YFVB 5B31G 5F99C 5B1LC 1P34C 3EPHA 5E5AA 4YS3D 4CAYA 4UPKA 3UTAC 1TZYB 3TU4A 1JFIB 2AROA 5AV9D 4Z66B 5AVCC 3B0CW 5F99D 4HGAB 4CSRA 5B0YC 4XZQA 4JJNA 5B1LD 1P3LC 1ID3C 1P34D 3AZFA 5BO0A 3MGRA 4X23A 3RELA 3WTPB 1P3IA 4DQYB 3UTAD 3O62B 2BYMA 3W99B 3EPJA 4WNNB 5CPKB 5AVCD 3WAAB 1P3LD 1TZYC 5GT0A 5B0YD 1U35A 1ID3D 2PYOB 3REIA 3AZHB 2FJ7B 1HQ3A 1P3BA 5B31A 2NQBB 4Z66C 5GXQB 2Y2GA 2ZY5A 1ZLAB 5AV5B 4J8XA 5CHLB 5B1MC 4WU8A 4WU9A 3WTPC 3AZLB 5CPJA 3O62C 1T3UA 2XD5A 4XUJA 1TZYD 1HTAA 2UWXA 3EPKA 3AV1A 3AZEB 5B2IB 1M1AB 5CPKC 4Z66D 2Y2MA 1KX4B 1P3AB 4KGCA 3MVDB 2PYOC 3KUYC 3AZHC 2FJ7C 3UT9B 5DNMA 5B1MD 5GXQC 3WTPD 3O62D 1ZLAC 4M6BA 3MGSA 3W97A 5AV5C 1P3PB 2RVQC 5G49A 5CPKD 1H3OA 2PYOD 2DQNC 3KUYD 3AZHD 2FJ7D 1M1AC 4H9NB 5B2IC 4NE5A 1KX4C 5GXQD 3C1BB 4DRAA 5CP6A 1ZLAD 3AFAA 3KSYA 4Z2MH 5AV5D 1WWSA 3X1SB 4J8WA 2RVQD 5KDMB 3W96A 1R4VA 3B0DB 1KX5C 3NQJB 4WV4B 3EG5B 3LJAA 3AZMB 3AN2B 1M1AD 5B2ID 3MNNA 2NZDC 1KX4D 1S32A 1M18A 3WA9B 3A6NA 5B24A 3C1BC 5GSUB 1KX5D 3AYWA 5B2JC 1P3MB 1BFMA 4H9RA 3KXBB 1AOIA 2NZDD 3B0DC 3MGPA 1B67A 3AZMC 3AN2C 5BS7A 3AZIA 3WTPE 3UTBB 3C1BD 2ZM5A 3WKJA 4G91B 3H0MC 3WA9C 5B2JD 3AZJC 4J8UA 3X1VB 2BYKA 5GSUC 4EO5B 5AV6A 4UUZA 1P3MC 3AZMD 2CV5B 3AN2D 3KXBC 4YS3B 2ZY4A 3VH5A 3R45A 5E5AC 4Z5TA 5GT3C 3WA9D 3AZJD 3UTBC 3TU4C 5GSUD 4G91C 1EQZA 5AVBB 1P3AA 2ZY3A 3A1IA 5B32B 2FFFB 3LELA 1P3MD 2Y2HA 3X1VC 1P34B 3KXBD 3UT9A 3AV2A 3AZFC 3RELC 5E5AD 4EO5C 3REJA 1Q9CA 3LZ1B 5AV8A 2CV5C 5GT3D 3IP4C 1P3GB 4YM6A 1BH9A 3UTBD 3TU4D 5AVCB 3C1CB 4H9PB 5BNXB 3X1TB 1ID3B 4KUDA 5B33A 3X1VD 1N1JA 3AZFD 5AVBC 3X1UB 5B32C 3RELD 2CV5D 5DNNA 3AZKB 3LZ0A 5KDMA 5B40C 4Z2MG 2Y2QA 3LZ1C 1M19B 1P3GC 3B6GB 5BNVB 3F6TA 5AVBD 3C1CC 3X1TC 2JSSA 5B32D 5JA4B 1A7WA 4ZUXA 3X1UC 3W98A 5B1MB 5B40D 4LD9B 4H9QB 3LZ1D 5AY8A 5B0ZA 1P3FB 1P3GD 2F8NB 3AZKC 2ZY2A 3W97C 1P3OB 3V9RB 3C1CD 4KHAB 3X1TD 1M19C 3B6GC 3KUYB 3X1UD 4H9SA 3KWQC 1KX3C 3AZKD 4R8PA 3W97D 1TAFB 4LD9C 1P3FC 2HUEC 1M19D 3B6GD 3AZNB 1F66B 3NQUB 3VH5W 3VH6A 1P3OC 4H9OA 3KWQD 1KX3D 4QLCA 4WZSB 4LD9D 5AV9A 1P3FD 5F99A 2YFWB 1KX5B 2F8ND 5B1LA 4J8VB 4G92B 2NZDB 1P3OD 3UTAA 3AZNC 1F66C 3MGQB 3MGPC 3B6FB 5JRGB 3REHB 5BS7C 4NFTA 1P3LA 5B0YA 3WKJC 3REKB 3AZGB 5B2JB 2YFVA 1Z2CB 1P3KB 3AZND 1F66D 4J8VC 2HIOB 3MGPD 4AWLB 1WWIA 4G92C 2LY8A 3MGQC 1TZYA 3WKJD 4Z5TC 4ZBJB 3B6FC 3AZJB 1JFIA 5JRGC 5CPIB 3REHC 1BH8B 4Z66A 1F1EA 3REKC 3AZGC 4J8VD 2JE5A 5B1MA 2Y2LA 3WTPA 3AV2C 1P3KC 3O62A 5E5AB 2HIOC 4CAYB 3MGQD 4AWLC 5GT3B 4Z5TD 2Y2KA 3B6FD 5JRGD 3W99A 4YM6C 3REHD 3TU4B 4WNNA 5CPKA 3WAAA 2AROB 2PYOA 4ZBJC 3REKD 3AZGD 3AZHA 4JJNB 4XZQB 2FJ7A 5CPIC 4CSRB 2NQBA 3AZFB 5BO0B 5GXQA 3MGRB 4X23B 3AV2D 1P3KD 3RELB 1ZLAA 2HIOD 1P3IB 5AV5A 2BYMB 1TAFA 4YM6D 3AZLA 2CWEA 3LZ0C 3VH6W 1B6WA 5CPID 1M1AA 5GT0B 5B2IA 4E45A 3AZEA 1U35B 3REIB 2AROC 1KX4A 1HQ3B 3MVDA 1P3BB 5B31B 4JJNC 4XZQC 3MGRC 4X23C 3AL0C 5B40B 2F8NH 3LZ0D 4WU8B 4J8XB 4WU9B 5CPJB 1KX5A 1P3IC 3W98C 5B0ZC 1P3PA 4XUJB 2AROD 3AV1B 4JJND 4XZQD 4H9NA 5GT0C 1U35C 4KGCB 2Y2OA 3REIC 3MGRD 3C1BA 1HQ3C 4X23D 1P3BC 5B31C 5DNMB 3W98D 1P3ID 5B0ZD 3A1KA 3X1SA 3MGSB 3W97B 4J8XC 4WU8C 3H0LC 4WU9C 5CPJC 3NQJA 5G49B 4XUJC 1H3OB 3AZMA 3AN2A 5GT0D 1U35D 3REID 3AV1C 1HQ3D 1P3BD 5B31D 3KWQB 4KGCC 3WA9A 5CP6B 1KX3B 5BT1C 5GSUA 5DNMC 4J8XD 4WU9D 4WU8D 5CPJD 2HUEB 4J8WB 3W96B 3B0CT 4DRBA 5B32G 4XUJD 3MGSC 1P3MA 3KXBA 3LJAB 3AV1D 3MNNB 1S32B 5GT3A 4KGCD 3UTBA 1M18B 5BT1D 5DNMD 4QLCD 3A6NB 5B24B 5FUGB 5CP6C 3MGSD 3AFAC 3AYWB 3X1VA 4J8WC 4H9RB 1AOIB 3W96C 2CV5A 3MGPB 3LJAC 4YS3A 3MNNC 2BG1A 3AZIB 1S32C 5CP6D 3WKJB 3AFAD 1M18C 3VH5T 3A6NC 5B24C 5AVBA 4J8WD 4E44A 4J8UB 2BYKB 5B32A 3W96D 4HGAC 1P34A 3AYWC 5AV6B 4UUZB 3LJAD 3FDDA 1AOIC 5B40A 3MNND 1PZRA 3LZ1A 1S32D 1P3GA 3R45B 4Z5TB 2F8NG 1M18D 3A6ND 3AZIC 5B24D 3W99C 5AVCA 3C1CA 4H9PA 5BNXA 3X1TA 3B0BA 3WAAC 1ID3A 1ULYA 1EQZB 2F8NK 3AYWD 3LELB 4J8UC 3X1UA 1AOID 3AV2B 2NQBC 1W2EA 3REJB 5AV6C 3AZKA 1KU5A 5AV8B 5C3IB 4YM6B 3AZID 1BH9B 3W99D 3AZLC 1M19A 3B6GA 3WAAD 5BNVA 4KUDB 5B33B 4J8UD 1N1JB 3AZEC 2NQBD 3KWQA 1EQZC 1P3AC 3MVDC 5JA4A 2VQRA 3LELC 5AV6D 1KX3A 3KFUG 3UT9C 5DNNB 4H9QA 3H0RC 4LD9A 1P3FA 3LZ0B 3AZLD 2Y2PA 3REJC 2F8NA 5AV8C 5C3IC 1P3PC 2JCHA 1P3OA 3V9RA 2Y2JA 4KHAA 3AZED 1EQZD 1P3AD 3KUYA 3MVDD 3LELD 4KUDC 5B33C 3UT9D 4WJ3C 4ZUXB 2J8PA 5FUGA 3W98B 3REJD 4NE3A 5AY8B 5AV8D 2L5AA 5B0ZB 3EPLA 5DNNC 1P3PD 3X1SC 3AZNA 1F66A 3NQUA 4KUDD 5B33D 2DF4C 2Y2NA 2IO5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH6 T;  5DNN D;  4ZUX C;  3X1S D;  4R8P B;  2YFW A;  4NE6 A;  4J8V A;  5AY8 C;  2NZD A;  4H9O B;  3MGQ A;  3B6F A;  5JRG A;  3REH A;  2IO5 C;  4ZUX D;  4QLC B;  4H9S C;  5AV9 B;  3REK A;  5B2J A;  5AY8 D;  3AZG A;  5F99 B;  5B1L B;  4R8P C;  1P3K A;  2HIO A;  3UTA B;  4YS3 C;  3AZJ A;  5CPI A;  3AFA B;  1BH8 A;  5B0Y B;  1P3L B;  4R8P D;  4QLC C;  5AV9 C;  2YFV B;  5B31 G;  5F99 C;  5B1L C;  1P34 C;  5E5A A;  4YS3 D;  4CAY A;  3UTA C;  1TZY B;  3TU4 A;  1JFI B;  2ARO A;  5AV9 D;  4Z66 B;  5AVC C;  3B0C W;  5F99 D;  4HGA B;  4CSR A;  4XZQ A;  5B0Y C;  4JJN A;  5B1L D;  1P3L C;  1ID3 C;  1P34 D;  3AZF A;  5BO0 A;  3MGR A;  4X23 A;  3REL A;  3WTP B;  1P3I A;  3UTA D;  3O62 B;  2BYM A;  3W99 B;  4WNN B;  5CPK B;  5AVC D;  3WAA B;  1P3L D;  1TZY C;  5GT0 A;  5B0Y D;  1U35 A;  1ID3 D;  2PYO B;  3REI A;  3AZH B;  2FJ7 B;  1HQ3 A;  1P3B A;  5B31 A;  2NQB B;  4Z66 C;  5GXQ B;  1ZLA B;  5AV5 B;  4J8X A;  5CHL B;  5B1M C;  4WU8 A;  4WU9 A;  3WTP C;  3AZL B;  5CPJ A;  3O62 C;  4XUJ A;  1TZY D;  1HTA A;  3AV1 A;  1M1A B;  3AZE B;  5B2I B;  5CPK C;  4Z66 D;  1KX4 B;  1P3A B;  4KGC A;  3MVD B;  2PYO C;  3KUY C;  3AZH C;  2FJ7 C;  3UT9 B;  5DNM A;  5B1M D;  5GXQ C;  3WTP D;  3O62 D;  1ZLA C;  4M6B A;  3MGS A;  3W97 A;  5AV5 C;  1P3P B;  2RVQ C;  5G49 A;  5CPK D;  1H3O A;  2PYO D;  3KUY D;  3AZH D;  2FJ7 D;  1M1A C;  4H9N B;  5B2I C;  4NE5 A;  1KX4 C;  5GXQ D;  3C1B B;  4DRA A;  5CP6 A;  1ZLA D;  3AFA A;  3KSY A;  4Z2M H;  5AV5 D;  1WWS A;  3X1S B;  4J8W A;  2RVQ D;  5KDM B;  3W96 A;  1R4V A;  3B0D B;  1KX5 C;  3NQJ B;  4WV4 B;  3LJA A;  3AZM B;  3AN2 B;  1M1A D;  5B2I D;  3MNN A;  2NZD C;  1KX4 D;  1S32 A;  1M18 A;  3WA9 B;  3A6N A;  5B24 A;  3C1B C;  5GSU B;  1KX5 D;  3AYW A;  5B2J C;  1P3M B;  1BFM A;  4H9R A;  3KXB B;  1AOI A;  2NZD D;  3B0D C;  3MGP A;  1B67 A;  3AZM C;  3AN2 C;  5BS7 A;  3AZI A;  3WTP E;  3UTB B;  3C1B D;  3WKJ A;  4G91 B;  3WA9 C;  5B2J D;  3AZJ C;  4J8U A;  3X1V B;  2BYK A;  5GSU C;  4EO5 B;  5AV6 A;  4UUZ A;  1P3M C;  3AZM D;  2CV5 B;  3AN2 D;  3KXB C;  4YS3 B;  3VH5 A;  3R45 A;  5E5A C;  4Z5T A;  5GT3 C;  3WA9 D;  3AZJ D;  3UTB C;  3TU4 C;  5GSU D;  4G91 C;  1EQZ A;  5AVB B;  1P3A A;  5B32 B;  3LEL A;  1P3M D;  3X1V C;  1P34 B;  3KXB D;  3UT9 A;  3AV2 A;  3AZF C;  3REL C;  5E5A D;  4EO5 C;  3REJ A;  1Q9C A;  3LZ1 B;  5AV8 A;  2CV5 C;  5GT3 D;  1P3G B;  4YM6 A;  1BH9 A;  3UTB D;  3TU4 D;  5AVC B;  3C1C B;  4H9P B;  5BNX B;  3X1T B;  1ID3 B;  4KUD A;  5B33 A;  3X1V D;  1N1J A;  3AZF D;  5AVB C;  3X1U B;  5B32 C;  3REL D;  2CV5 D;  5DNN A;  3AZK B;  3LZ0 A;  5KDM A;  5B40 C;  4Z2M G;  3LZ1 C;  1M19 B;  1P3G C;  3B6G B;  5BNV B;  5AVB D;  3C1C C;  3X1T C;  2JSS A;  5B32 D;  5JA4 B;  1A7W A;  4ZUX A;  3X1U C;  3W98 A;  5B1M B;  5B40 D;  4LD9 B;  4H9Q B;  3LZ1 D;  5AY8 A;  5B0Z A;  1P3F B;  1P3G D;  2F8N B;  3AZK C;  3W97 C;  1P3O B;  3V9R B;  3C1C D;  4KHA B;  3X1T D;  1M19 C;  3B6G C;  3KUY B;  3X1U D;  4H9S A;  3KWQ C;  1KX3 C;  3AZK D;  4R8P A;  3W97 D;  1TAF B;  4LD9 C;  1P3F C;  2HUE C;  1M19 D;  3B6G D;  3AZN B;  1F66 B;  3NQU B;  3VH5 W;  3VH6 A;  1P3O C;  4H9O A;  3KWQ D;  1KX3 D;  4QLC A;  4WZS B;  4LD9 D;  5AV9 A;  1P3F D;  5F99 A;  2YFW B;  1KX5 B;  2F8N D;  5B1L A;  4J8V B;  4G92 B;  2NZD B;  1P3O D;  3UTA A;  3AZN C;  1F66 C;  3MGQ B;  3MGP C;  3B6F B;  5JRG B;  3REH B;  5BS7 C;  4NFT A;  1P3L A;  5B0Y A;  3WKJ C;  3REK B;  3AZG B;  5B2J B;  2YFV A;  1P3K B;  3AZN D;  1F66 D;  4J8V C;  2HIO B;  3MGP D;  4AWL B;  1WWI A;  4G92 C;  2LY8 A;  3MGQ C;  1TZY A;  3WKJ D;  4Z5T C;  4ZBJ B;  3B6F C;  3AZJ B;  1JFI A;  5JRG C;  5CPI B;  3REH C;  1BH8 B;  4Z66 A;  1F1E A;  3REK C;  3AZG C;  4J8V D;  5B1M A;  3AV2 C;  3WTP A;  1P3K C;  3O62 A;  5E5A B;  2HIO C;  4CAY B;  3MGQ D;  4AWL C;  5GT3 B;  4Z5T D;  3B6F D;  5JRG D;  3W99 A;  4YM6 C;  3REH D;  3TU4 B;  4WNN A;  5CPK A;  3WAA A;  2ARO B;  2PYO A;  4ZBJ C;  3REK D;  3AZG D;  3AZH A;  4JJN B;  4XZQ B;  2FJ7 A;  5CPI C;  4CSR B;  2NQB A;  3AZF B;  5BO0 B;  5GXQ A;  3MGR B;  4X23 B;  3AV2 D;  1P3K D;  3REL B;  1ZLA A;  2HIO D;  1P3I B;  5AV5 A;  2BYM B;  1TAF A;  4YM6 D;  3AZL A;  2CWE A;  3LZ0 C;  3VH6 W;  1B6W A;  5CPI D;  1M1A A;  5GT0 B;  5B2I A;  4E45 A;  3AZE A;  1U35 B;  3REI B;  2ARO C;  1KX4 A;  1HQ3 B;  3MVD A;  1P3B B;  5B31 B;  4JJN C;  4XZQ C;  3MGR C;  4X23 C;  5B40 B;  2F8N H;  3LZ0 D;  4WU8 B;  4J8X B;  4WU9 B;  5CPJ B;  1KX5 A;  1P3I C;  3W98 C;  5B0Z C;  1P3P A;  4XUJ B;  2ARO D;  3AV1 B;  4JJN D;  4XZQ D;  4H9N A;  5GT0 C;  1U35 C;  4KGC B;  3REI C;  3MGR D;  3C1B A;  1HQ3 C;  4X23 D;  1P3B C;  5B31 C;  5DNM B;  3W98 D;  1P3I D;  5B0Z D;  3X1S A;  3MGS B;  3W97 B;  4J8X C;  4WU8 C;  4WU9 C;  5CPJ C;  3NQJ A;  5G49 B;  4XUJ C;  1H3O B;  3AZM A;  3AN2 A;  5GT0 D;  1U35 D;  3REI D;  3AV1 C;  1HQ3 D;  1P3B D;  5B31 D;  3KWQ B;  4KGC C;  3WA9 A;  5CP6 B;  1KX3 B;  5BT1 C;  5GSU A;  5DNM C;  4J8X D;  4WU9 D;  4WU8 D;  5CPJ D;  2HUE B;  4J8W B;  3W96 B;  3B0C T;  4DRB A;  5B32 G;  4XUJ D;  3MGS C;  1P3M A;  3KXB A;  3LJA B;  3AV1 D;  3MNN B;  1S32 B;  5GT3 A;  4KGC D;  3UTB A;  1M18 B;  5BT1 D;  5DNM D;  4QLC D;  3A6N B;  5B24 B;  5FUG B;  5CP6 C;  3MGS D;  3AFA C;  3AYW B;  3X1V A;  4J8W C;  4H9R B;  1AOI B;  3W96 C;  2CV5 A;  3MGP B;  3LJA C;  4YS3 A;  3MNN C;  3AZI B;  1S32 C;  5CP6 D;  3WKJ B;  3AFA D;  1M18 C;  3VH5 T;  3A6N C;  5B24 C;  5AVB A;  4J8W D;  4E44 A;  4J8U B;  2BYK B;  5B32 A;  3W96 D;  4HGA C;  1P34 A;  3AYW C;  5AV6 B;  4UUZ B;  3LJA D;  1AOI C;  5B40 A;  3MNN D;  3LZ1 A;  1S32 D;  1P3G A;  3R45 B;  4Z5T B;  2F8N G;  1M18 D;  3A6N D;  3AZI C;  5B24 D;  3W99 C;  5AVC A;  3C1C A;  4H9P A;  5BNX A;  3X1T A;  3B0B A;  3WAA C;  1ID3 A;  1ULY A;  1EQZ B;  2F8N K;  3AYW D;  3LEL B;  4J8U C;  3X1U A;  1AOI D;  3AV2 B;  2NQB C;  3REJ B;  5AV6 C;  3AZK A;  1KU5 A;  5AV8 B;  5C3I B;  4YM6 B;  3AZI D;  1BH9 B;  3W99 D;  3AZL C;  1M19 A;  3B6G A;  3WAA D;  5BNV A;  4KUD B;  5B33 B;  4J8U D;  1N1J B;  3AZE C;  2NQB D;  3KWQ A;  1EQZ C;  1P3A C;  3MVD C;  5JA4 A;  3LEL C;  5AV6 D;  1KX3 A;  3UT9 C;  5DNN B;  4H9Q A;  4LD9 A;  1P3F A;  3LZ0 B;  3AZL D;  3REJ C;  2F8N A;  5AV8 C;  5C3I C;  1P3P C;  1P3O A;  3V9R A;  3AZE D;  4KHA A;  1EQZ D;  1P3A D;  3KUY A;  3MVD D;  3LEL D;  4KUD C;  5B33 C;  3UT9 D;  4ZUX B;  3W98 B;  5FUG A;  3REJ D;  4NE3 A;  5AY8 B;  5AV8 D;  2L5A A;  5B0Z B;  5DNN C;  1P3P D;  3X1S C;  3AZN A;  1F66 A;  3NQU A;  4KUD D;  5B33 D;  2IO5 B; 
#chains in the Genus database with same CATH topology
 3VH6 T;  5DNN D;  2F2A C;  4ZUX C;  3X1S D;  4R8P B;  2YFW A;  4NE6 A;  4J8V A;  5AY8 C;  2NZD A;  2W8S A;  4H9O B;  3MGQ A;  3B6F A;  2G5I C;  5JRG A;  3REH A;  2IO5 C;  4ZUX D;  4QLC B;  4H9S C;  2XD1 A;  2RIQ A;  5AV9 B;  3REK A;  5B2J A;  5AY8 D;  3AZG A;  3P5J B;  5F99 B;  5B1L B;  4R8P C;  2G5H C;  1P3K A;  2HIO A;  3UTA B;  2Y2I A;  4YS3 C;  3AZJ A;  5CPI A;  3AFA B;  1BH8 A;  5B0Y B;  1P3L B;  4R8P D;  4QLC C;  5AV9 C;  2YFV B;  5B31 G;  5F99 C;  5B1L C;  1P34 C;  3EPH A;  5E5A A;  4YS3 D;  4CAY A;  4UPK A;  3UTA C;  1TZY B;  3TU4 A;  1JFI B;  2ARO A;  5AV9 D;  4Z66 B;  5AVC C;  3B0C W;  5F99 D;  4HGA B;  4CSR A;  5B0Y C;  4XZQ A;  4JJN A;  5B1L D;  1P3L C;  1ID3 C;  1P34 D;  3AZF A;  5BO0 A;  3MGR A;  4X23 A;  3REL A;  3WTP B;  1P3I A;  4DQY B;  3UTA D;  3O62 B;  2BYM A;  3W99 B;  3EPJ A;  4WNN B;  5CPK B;  5AVC D;  3WAA B;  1P3L D;  1TZY C;  5GT0 A;  5B0Y D;  1U35 A;  1ID3 D;  2PYO B;  3REI A;  3AZH B;  2FJ7 B;  1HQ3 A;  1P3B A;  5B31 A;  2NQB B;  4Z66 C;  5GXQ B;  2Y2G A;  2ZY5 A;  1ZLA B;  5AV5 B;  4J8X A;  5CHL B;  5B1M C;  4WU8 A;  4WU9 A;  3WTP C;  3AZL B;  5CPJ A;  3O62 C;  1T3U A;  2XD5 A;  4XUJ A;  1TZY D;  1HTA A;  2UWX A;  3EPK A;  3AV1 A;  3AZE B;  5B2I B;  1M1A B;  5CPK C;  4Z66 D;  2Y2M A;  1KX4 B;  1P3A B;  4KGC A;  3MVD B;  2PYO C;  3KUY C;  3AZH C;  2FJ7 C;  3UT9 B;  5DNM A;  5B1M D;  5GXQ C;  3WTP D;  3O62 D;  1ZLA C;  4M6B A;  3MGS A;  3W97 A;  5AV5 C;  1P3P B;  2RVQ C;  5G49 A;  5CPK D;  1H3O A;  2PYO D;  2DQN C;  3KUY D;  3AZH D;  2FJ7 D;  1M1A C;  4H9N B;  5B2I C;  4NE5 A;  1KX4 C;  5GXQ D;  3C1B B;  4DRA A;  5CP6 A;  1ZLA D;  3AFA A;  3KSY A;  4Z2M H;  5AV5 D;  1WWS A;  3X1S B;  4J8W A;  2RVQ D;  5KDM B;  3W96 A;  1R4V A;  3B0D B;  1KX5 C;  3NQJ B;  4WV4 B;  3EG5 B;  3LJA A;  3AZM B;  3AN2 B;  1M1A D;  5B2I D;  3MNN A;  2NZD C;  1KX4 D;  1S32 A;  1M18 A;  3WA9 B;  3A6N A;  5B24 A;  3C1B C;  5GSU B;  1KX5 D;  3AYW A;  5B2J C;  1P3M B;  1BFM A;  4H9R A;  3KXB B;  1AOI A;  2NZD D;  3B0D C;  3MGP A;  1B67 A;  3AZM C;  3AN2 C;  5BS7 A;  3AZI A;  3WTP E;  3UTB B;  3C1B D;  2ZM5 A;  3WKJ A;  4G91 B;  3H0M C;  3WA9 C;  5B2J D;  3AZJ C;  4J8U A;  3X1V B;  2BYK A;  5GSU C;  4EO5 B;  5AV6 A;  4UUZ A;  1P3M C;  3AZM D;  2CV5 B;  3AN2 D;  3KXB C;  4YS3 B;  2ZY4 A;  3VH5 A;  3R45 A;  5E5A C;  4Z5T A;  5GT3 C;  3WA9 D;  3AZJ D;  3UTB C;  3TU4 C;  5GSU D;  4G91 C;  1EQZ A;  5AVB B;  1P3A A;  2ZY3 A;  3A1I A;  5B32 B;  2FFF B;  3LEL A;  1P3M D;  2Y2H A;  3X1V C;  1P34 B;  3KXB D;  3UT9 A;  3AV2 A;  3AZF C;  3REL C;  5E5A D;  4EO5 C;  3REJ A;  1Q9C A;  3LZ1 B;  5AV8 A;  2CV5 C;  5GT3 D;  3IP4 C;  1P3G B;  4YM6 A;  1BH9 A;  3UTB D;  3TU4 D;  5AVC B;  3C1C B;  4H9P B;  5BNX B;  3X1T B;  1ID3 B;  4KUD A;  5B33 A;  3X1V D;  1N1J A;  3AZF D;  5AVB C;  3X1U B;  5B32 C;  3REL D;  2CV5 D;  5DNN A;  3AZK B;  3LZ0 A;  5KDM A;  5B40 C;  4Z2M G;  2Y2Q A;  3LZ1 C;  1M19 B;  1P3G C;  3B6G B;  5BNV B;  3F6T A;  5AVB D;  3C1C C;  3X1T C;  2JSS A;  5B32 D;  5JA4 B;  1A7W A;  4ZUX A;  3X1U C;  3W98 A;  5B1M B;  5B40 D;  4LD9 B;  4H9Q B;  3LZ1 D;  5AY8 A;  5B0Z A;  1P3F B;  1P3G D;  2F8N B;  3AZK C;  2ZY2 A;  3W97 C;  1P3O B;  3V9R B;  3C1C D;  4KHA B;  3X1T D;  1M19 C;  3B6G C;  3KUY B;  3X1U D;  4H9S A;  3KWQ C;  1KX3 C;  3AZK D;  4R8P A;  3W97 D;  1TAF B;  4LD9 C;  1P3F C;  2HUE C;  1M19 D;  3B6G D;  3AZN B;  1F66 B;  3NQU B;  3VH5 W;  3VH6 A;  1P3O C;  4H9O A;  3KWQ D;  1KX3 D;  4QLC A;  4WZS B;  4LD9 D;  5AV9 A;  1P3F D;  5F99 A;  2YFW B;  1KX5 B;  2F8N D;  5B1L A;  4J8V B;  4G92 B;  2NZD B;  1P3O D;  3UTA A;  3AZN C;  1F66 C;  3MGQ B;  3MGP C;  3B6F B;  5JRG B;  3REH B;  5BS7 C;  4NFT A;  1P3L A;  5B0Y A;  3WKJ C;  3REK B;  3AZG B;  5B2J B;  2YFV A;  1Z2C B;  1P3K B;  3AZN D;  1F66 D;  4J8V C;  2HIO B;  3MGP D;  4AWL B;  1WWI A;  4G92 C;  2LY8 A;  3MGQ C;  1TZY A;  3WKJ D;  4Z5T C;  4ZBJ B;  3B6F C;  3AZJ B;  1JFI A;  5JRG C;  5CPI B;  3REH C;  1BH8 B;  4Z66 A;  1F1E A;  3REK C;  3AZG C;  4J8V D;  2JE5 A;  5B1M A;  2Y2L A;  3WTP A;  3AV2 C;  1P3K C;  3O62 A;  5E5A B;  2HIO C;  4CAY B;  3MGQ D;  4AWL C;  5GT3 B;  4Z5T D;  2Y2K A;  3B6F D;  5JRG D;  3W99 A;  4YM6 C;  3REH D;  3TU4 B;  4WNN A;  5CPK A;  3WAA A;  2ARO B;  2PYO A;  4ZBJ C;  3REK D;  3AZG D;  3AZH A;  4JJN B;  4XZQ B;  2FJ7 A;  5CPI C;  4CSR B;  2NQB A;  3AZF B;  5BO0 B;  5GXQ A;  3MGR B;  4X23 B;  3AV2 D;  1P3K D;  3REL B;  1ZLA A;  2HIO D;  1P3I B;  5AV5 A;  2BYM B;  1TAF A;  4YM6 D;  3AZL A;  2CWE A;  3LZ0 C;  3VH6 W;  1B6W A;  5CPI D;  1M1A A;  5GT0 B;  5B2I A;  4E45 A;  3AZE A;  1U35 B;  3REI B;  2ARO C;  1KX4 A;  1HQ3 B;  3MVD A;  1P3B B;  5B31 B;  4JJN C;  4XZQ C;  3MGR C;  4X23 C;  3AL0 C;  5B40 B;  2F8N H;  3LZ0 D;  4WU8 B;  4J8X B;  4WU9 B;  5CPJ B;  1KX5 A;  1P3I C;  3W98 C;  5B0Z C;  1P3P A;  4XUJ B;  2ARO D;  3AV1 B;  4JJN D;  4XZQ D;  4H9N A;  5GT0 C;  1U35 C;  4KGC B;  2Y2O A;  3REI C;  3MGR D;  3C1B A;  1HQ3 C;  4X23 D;  1P3B C;  5B31 C;  5DNM B;  3W98 D;  1P3I D;  5B0Z D;  3A1K A;  3X1S A;  3MGS B;  3W97 B;  4J8X C;  4WU8 C;  3H0L C;  4WU9 C;  5CPJ C;  3NQJ A;  5G49 B;  4XUJ C;  1H3O B;  3AZM A;  3AN2 A;  5GT0 D;  1U35 D;  3REI D;  3AV1 C;  1HQ3 D;  1P3B D;  5B31 D;  3KWQ B;  4KGC C;  3WA9 A;  5CP6 B;  1KX3 B;  5BT1 C;  5GSU A;  5DNM C;  4J8X D;  4WU9 D;  4WU8 D;  5CPJ D;  2HUE B;  4J8W B;  3W96 B;  3B0C T;  4DRB A;  5B32 G;  4XUJ D;  3MGS C;  1P3M A;  3KXB A;  3LJA B;  3AV1 D;  3MNN B;  1S32 B;  5GT3 A;  4KGC D;  3UTB A;  1M18 B;  5BT1 D;  5DNM D;  4QLC D;  3A6N B;  5B24 B;  5FUG B;  5CP6 C;  3MGS D;  3AFA C;  3AYW B;  3X1V A;  4J8W C;  4H9R B;  1AOI B;  3W96 C;  2CV5 A;  3MGP B;  3LJA C;  4YS3 A;  3MNN C;  2BG1 A;  3AZI B;  1S32 C;  5CP6 D;  3WKJ B;  3AFA D;  1M18 C;  3VH5 T;  3A6N C;  5B24 C;  5AVB A;  4J8W D;  4E44 A;  4J8U B;  2BYK B;  5B32 A;  3W96 D;  4HGA C;  1P34 A;  3AYW C;  5AV6 B;  4UUZ B;  3LJA D;  3FDD A;  1AOI C;  5B40 A;  3MNN D;  1PZR A;  3LZ1 A;  1S32 D;  1P3G A;  3R45 B;  4Z5T B;  2F8N G;  1M18 D;  3A6N D;  3AZI C;  5B24 D;  3W99 C;  5AVC A;  3C1C A;  4H9P A;  5BNX A;  3X1T A;  3B0B A;  3WAA C;  1ID3 A;  1ULY A;  1EQZ B;  2F8N K;  3AYW D;  3LEL B;  4J8U C;  3X1U A;  1AOI D;  3AV2 B;  2NQB C;  1W2E A;  3REJ B;  5AV6 C;  3AZK A;  1KU5 A;  5AV8 B;  5C3I B;  4YM6 B;  3AZI D;  1BH9 B;  3W99 D;  3AZL C;  1M19 A;  3B6G A;  3WAA D;  5BNV A;  4KUD B;  5B33 B;  4J8U D;  1N1J B;  3AZE C;  2NQB D;  3KWQ A;  1EQZ C;  1P3A C;  3MVD C;  5JA4 A;  2VQR A;  3LEL C;  5AV6 D;  1KX3 A;  3KFU G;  3UT9 C;  5DNN B;  4H9Q A;  3H0R C;  4LD9 A;  1P3F A;  3LZ0 B;  3AZL D;  2Y2P A;  3REJ C;  2F8N A;  5AV8 C;  5C3I C;  1P3P C;  2JCH A;  1P3O A;  3V9R A;  2Y2J A;  4KHA A;  3AZE D;  1EQZ D;  1P3A D;  3KUY A;  3MVD D;  3LEL D;  4KUD C;  5B33 C;  3UT9 D;  4WJ3 C;  4ZUX B;  2J8P A;  5FUG A;  3W98 B;  3REJ D;  4NE3 A;  5AY8 B;  5AV8 D;  2L5A A;  5B0Z B;  3EPL A;  5DNN C;  1P3P D;  3X1S C;  3AZN A;  1F66 A;  3NQU A;  4KUD D;  5B33 D;  2DF4 C;  2Y2N A;  2IO5 B; 
#chains in the Genus database with same CATH homology
 3VH6 T;  5DNN D;  2F2A C;  4ZUX C;  3X1S D;  4R8P B;  2YFW A;  4NE6 A;  4J8V A;  5AY8 C;  2NZD A;  2W8S A;  4H9O B;  3MGQ A;  3B6F A;  2G5I C;  5JRG A;  3REH A;  2IO5 C;  4ZUX D;  4QLC B;  4H9S C;  2XD1 A;  2RIQ A;  5AV9 B;  3REK A;  5B2J A;  5AY8 D;  3AZG A;  3P5J B;  5F99 B;  5B1L B;  4R8P C;  2G5H C;  1P3K A;  2HIO A;  3UTA B;  2Y2I A;  4YS3 C;  3AZJ A;  5CPI A;  3AFA B;  1BH8 A;  5B0Y B;  1P3L B;  4R8P D;  4QLC C;  5AV9 C;  2YFV B;  5B31 G;  5F99 C;  5B1L C;  1P34 C;  3EPH A;  5E5A A;  4YS3 D;  4CAY A;  4UPK A;  3UTA C;  1TZY B;  3TU4 A;  1JFI B;  2ARO A;  5AV9 D;  4Z66 B;  5AVC C;  3B0C W;  5F99 D;  4HGA B;  4CSR A;  5B0Y C;  4XZQ A;  4JJN A;  5B1L D;  1P3L C;  1ID3 C;  1P34 D;  3AZF A;  5BO0 A;  3MGR A;  4X23 A;  3REL A;  3WTP B;  1P3I A;  4DQY B;  3UTA D;  3O62 B;  2BYM A;  3W99 B;  3EPJ A;  4WNN B;  5CPK B;  5AVC D;  3WAA B;  1P3L D;  1TZY C;  5GT0 A;  5B0Y D;  1U35 A;  1ID3 D;  2PYO B;  3REI A;  3AZH B;  2FJ7 B;  1HQ3 A;  1P3B A;  5B31 A;  2NQB B;  4Z66 C;  5GXQ B;  2Y2G A;  2ZY5 A;  1ZLA B;  5AV5 B;  4J8X A;  5CHL B;  5B1M C;  4WU8 A;  4WU9 A;  3WTP C;  3AZL B;  5CPJ A;  3O62 C;  1T3U A;  2XD5 A;  4XUJ A;  1TZY D;  1HTA A;  2UWX A;  3EPK A;  3AV1 A;  3AZE B;  5B2I B;  1M1A B;  5CPK C;  4Z66 D;  2Y2M A;  1KX4 B;  1P3A B;  4KGC A;  3MVD B;  2PYO C;  3KUY C;  3AZH C;  2FJ7 C;  3UT9 B;  5DNM A;  5B1M D;  5GXQ C;  3WTP D;  3O62 D;  1ZLA C;  4M6B A;  3MGS A;  3W97 A;  5AV5 C;  1P3P B;  2RVQ C;  5G49 A;  5CPK D;  1H3O A;  2PYO D;  2DQN C;  3KUY D;  3AZH D;  2FJ7 D;  1M1A C;  4H9N B;  5B2I C;  4NE5 A;  1KX4 C;  5GXQ D;  3C1B B;  4DRA A;  5CP6 A;  1ZLA D;  3AFA A;  3KSY A;  4Z2M H;  5AV5 D;  1WWS A;  3X1S B;  4J8W A;  2RVQ D;  5KDM B;  3W96 A;  1R4V A;  3B0D B;  1KX5 C;  3NQJ B;  4WV4 B;  3EG5 B;  3LJA A;  3AZM B;  3AN2 B;  1M1A D;  5B2I D;  3MNN A;  2NZD C;  1KX4 D;  1S32 A;  1M18 A;  3WA9 B;  3A6N A;  5B24 A;  3C1B C;  5GSU B;  1KX5 D;  3AYW A;  5B2J C;  1P3M B;  1BFM A;  4H9R A;  3KXB B;  1AOI A;  2NZD D;  3B0D C;  3MGP A;  1B67 A;  3AZM C;  3AN2 C;  5BS7 A;  3AZI A;  3WTP E;  3UTB B;  3C1B D;  2ZM5 A;  3WKJ A;  4G91 B;  3H0M C;  3WA9 C;  5B2J D;  3AZJ C;  4J8U A;  3X1V B;  2BYK A;  5GSU C;  4EO5 B;  5AV6 A;  4UUZ A;  1P3M C;  3AZM D;  2CV5 B;  3AN2 D;  3KXB C;  4YS3 B;  2ZY4 A;  3VH5 A;  3R45 A;  5E5A C;  4Z5T A;  5GT3 C;  3WA9 D;  3AZJ D;  3UTB C;  3TU4 C;  5GSU D;  4G91 C;  1EQZ A;  5AVB B;  1P3A A;  2ZY3 A;  3A1I A;  5B32 B;  2FFF B;  3LEL A;  1P3M D;  2Y2H A;  3X1V C;  1P34 B;  3KXB D;  3UT9 A;  3AV2 A;  3AZF C;  3REL C;  5E5A D;  4EO5 C;  3REJ A;  1Q9C A;  3LZ1 B;  5AV8 A;  2CV5 C;  5GT3 D;  3IP4 C;  1P3G B;  4YM6 A;  1BH9 A;  3UTB D;  3TU4 D;  5AVC B;  3C1C B;  4H9P B;  5BNX B;  3X1T B;  1ID3 B;  4KUD A;  5B33 A;  3X1V D;  1N1J A;  3AZF D;  5AVB C;  3X1U B;  5B32 C;  3REL D;  2CV5 D;  5DNN A;  3AZK B;  3LZ0 A;  5KDM A;  5B40 C;  4Z2M G;  2Y2Q A;  3LZ1 C;  1M19 B;  1P3G C;  3B6G B;  5BNV B;  3F6T A;  5AVB D;  3C1C C;  3X1T C;  2JSS A;  5B32 D;  5JA4 B;  1A7W A;  4ZUX A;  3X1U C;  3W98 A;  5B1M B;  5B40 D;  4LD9 B;  4H9Q B;  3LZ1 D;  5AY8 A;  5B0Z A;  1P3F B;  1P3G D;  2F8N B;  3AZK C;  2ZY2 A;  3W97 C;  1P3O B;  3V9R B;  3C1C D;  4KHA B;  3X1T D;  1M19 C;  3B6G C;  3KUY B;  3X1U D;  4H9S A;  3KWQ C;  1KX3 C;  3AZK D;  4R8P A;  3W97 D;  1TAF B;  4LD9 C;  1P3F C;  2HUE C;  1M19 D;  3B6G D;  3AZN B;  1F66 B;  3NQU B;  3VH5 W;  3VH6 A;  1P3O C;  4H9O A;  3KWQ D;  1KX3 D;  4QLC A;  4WZS B;  4LD9 D;  5AV9 A;  1P3F D;  5F99 A;  2YFW B;  1KX5 B;  2F8N D;  5B1L A;  4J8V B;  4G92 B;  2NZD B;  1P3O D;  3UTA A;  3AZN C;  1F66 C;  3MGQ B;  3MGP C;  3B6F B;  5JRG B;  3REH B;  5BS7 C;  4NFT A;  1P3L A;  5B0Y A;  3WKJ C;  3REK B;  3AZG B;  5B2J B;  2YFV A;  1Z2C B;  1P3K B;  3AZN D;  1F66 D;  4J8V C;  2HIO B;  3MGP D;  4AWL B;  1WWI A;  4G92 C;  2LY8 A;  3MGQ C;  1TZY A;  3WKJ D;  4Z5T C;  4ZBJ B;  3B6F C;  3AZJ B;  1JFI A;  5JRG C;  5CPI B;  3REH C;  1BH8 B;  4Z66 A;  1F1E A;  3REK C;  3AZG C;  4J8V D;  2JE5 A;  5B1M A;  2Y2L A;  3WTP A;  3AV2 C;  1P3K C;  3O62 A;  5E5A B;  2HIO C;  4CAY B;  3MGQ D;  4AWL C;  5GT3 B;  4Z5T D;  2Y2K A;  3B6F D;  5JRG D;  3W99 A;  4YM6 C;  3REH D;  3TU4 B;  4WNN A;  5CPK A;  3WAA A;  2ARO B;  2PYO A;  4ZBJ C;  3REK D;  3AZG D;  3AZH A;  4JJN B;  4XZQ B;  2FJ7 A;  5CPI C;  4CSR B;  2NQB A;  3AZF B;  5BO0 B;  5GXQ A;  3MGR B;  4X23 B;  3AV2 D;  1P3K D;  3REL B;  1ZLA A;  2HIO D;  1P3I B;  5AV5 A;  2BYM B;  1TAF A;  4YM6 D;  3AZL A;  2CWE A;  3LZ0 C;  3VH6 W;  1B6W A;  5CPI D;  1M1A A;  5GT0 B;  5B2I A;  4E45 A;  3AZE A;  1U35 B;  3REI B;  2ARO C;  1KX4 A;  1HQ3 B;  3MVD A;  1P3B B;  5B31 B;  4JJN C;  4XZQ C;  3MGR C;  4X23 C;  3AL0 C;  5B40 B;  2F8N H;  3LZ0 D;  4WU8 B;  4J8X B;  4WU9 B;  5CPJ B;  1KX5 A;  1P3I C;  3W98 C;  5B0Z C;  1P3P A;  4XUJ B;  2ARO D;  3AV1 B;  4JJN D;  4XZQ D;  4H9N A;  5GT0 C;  1U35 C;  4KGC B;  2Y2O A;  3REI C;  3MGR D;  3C1B A;  1HQ3 C;  4X23 D;  1P3B C;  5B31 C;  5DNM B;  3W98 D;  1P3I D;  5B0Z D;  3A1K A;  3X1S A;  3MGS B;  3W97 B;  4J8X C;  4WU8 C;  3H0L C;  4WU9 C;  5CPJ C;  3NQJ A;  5G49 B;  4XUJ C;  1H3O B;  3AZM A;  3AN2 A;  5GT0 D;  1U35 D;  3REI D;  3AV1 C;  1HQ3 D;  1P3B D;  5B31 D;  3KWQ B;  4KGC C;  3WA9 A;  5CP6 B;  1KX3 B;  5BT1 C;  5GSU A;  5DNM C;  4J8X D;  4WU9 D;  4WU8 D;  5CPJ D;  2HUE B;  4J8W B;  3W96 B;  3B0C T;  4DRB A;  5B32 G;  4XUJ D;  3MGS C;  1P3M A;  3KXB A;  3LJA B;  3AV1 D;  3MNN B;  1S32 B;  5GT3 A;  4KGC D;  3UTB A;  1M18 B;  5BT1 D;  5DNM D;  4QLC D;  3A6N B;  5B24 B;  5FUG B;  5CP6 C;  3MGS D;  3AFA C;  3AYW B;  3X1V A;  4J8W C;  4H9R B;  1AOI B;  3W96 C;  2CV5 A;  3MGP B;  3LJA C;  4YS3 A;  3MNN C;  2BG1 A;  3AZI B;  1S32 C;  5CP6 D;  3WKJ B;  3AFA D;  1M18 C;  3VH5 T;  3A6N C;  5B24 C;  5AVB A;  4J8W D;  4E44 A;  4J8U B;  2BYK B;  5B32 A;  3W96 D;  4HGA C;  1P34 A;  3AYW C;  5AV6 B;  4UUZ B;  3LJA D;  3FDD A;  1AOI C;  5B40 A;  3MNN D;  1PZR A;  3LZ1 A;  1S32 D;  1P3G A;  3R45 B;  4Z5T B;  2F8N G;  1M18 D;  3A6N D;  3AZI C;  5B24 D;  3W99 C;  5AVC A;  3C1C A;  4H9P A;  5BNX A;  3X1T A;  3B0B A;  3WAA C;  1ID3 A;  1ULY A;  1EQZ B;  2F8N K;  3AYW D;  3LEL B;  4J8U C;  3X1U A;  1AOI D;  3AV2 B;  2NQB C;  1W2E A;  3REJ B;  5AV6 C;  3AZK A;  1KU5 A;  5AV8 B;  5C3I B;  4YM6 B;  3AZI D;  1BH9 B;  3W99 D;  3AZL C;  1M19 A;  3B6G A;  3WAA D;  5BNV A;  4KUD B;  5B33 B;  4J8U D;  1N1J B;  3AZE C;  2NQB D;  3KWQ A;  1EQZ C;  1P3A C;  3MVD C;  5JA4 A;  2VQR A;  3LEL C;  5AV6 D;  1KX3 A;  3KFU G;  3UT9 C;  5DNN B;  4H9Q A;  3H0R C;  4LD9 A;  1P3F A;  3LZ0 B;  3AZL D;  2Y2P A;  3REJ C;  2F8N A;  5AV8 C;  5C3I C;  1P3P C;  2JCH A;  1P3O A;  3V9R A;  2Y2J A;  4KHA A;  3AZE D;  1EQZ D;  1P3A D;  3KUY A;  3MVD D;  3LEL D;  4KUD C;  5B33 C;  3UT9 D;  4WJ3 C;  4ZUX B;  2J8P A;  5FUG A;  3W98 B;  3REJ D;  4NE3 A;  5AY8 B;  5AV8 D;  2L5A A;  5B0Z B;  3EPL A;  5DNN C;  1P3P D;  3X1S C;  3AZN A;  1F66 A;  3NQU A;  4KUD D;  5B33 D;  2DF4 C;  2Y2N A;  2IO5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...