5AVCB

Human nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcB00
5E5AD 3VH5W 3VH5A 4M6BA 3MGPA 1R4VA 3WKJD 2F8ND 1KX4B 1KX5D 4J8VD 1P3MD 1ZLAB 3W98D 3UT9D 1KX3B 4WNNA 5B0YD 1U35C 3MGSB 1WWIA 5GT3B 3LELD 4CAYA 5B2IC 1M19C 5B31D 1TZYC 4WU9C 5AVCB 4H9OB 3R45A 5AVBB 2F8NH 4J8XC 1TAFB 1U35A 1ZLAD 3V9RB 3REKA 3AZED 3KXBC 5JRGB 3MGSD 4CSRB 5GT3D 5B2IA 1TZYA 1AOIC 1P3FA 3AZFB 5AV8D 5AVCD 1BFMA 4E44A 2BYKB 3AZJB 1HQ3B 3LZ1C 4J8WD 1M1AA 4J8XA 5AVBD 1P3GB 5B32A 3WA9B 3KXBA 4XUJB 5JRGD 3RELC 3VH6A 2RVQD 3B0CW 4NFTA 5B0ZC 5CPKA 1ID3C 1AOIA 4ZUXB 1P3PC 2HIOB 3AZJD 1HQ3D 3B6FB 3MGRA 5GSUB 4WU8C 4J8UA 5DNNC 4JJNC 5CPJB 1P3GD 2FJ7B 4KUDC 2LY8A 5BO0B 4QLCB 5B32G 5B0ZA 5B1LD 3A6NB 4NE6A 4WZSB 3AFAC 4ZUXD 5CPID 2HIOD 1F66D 2NQBD 3AZMC 3C1CA 3REJC 3TU4C 4JJNA 5DNNA 3AZEA 4KUDA 5CPJD 4LD9B 4X23C 3KWQC 5CP6B 4HGAC 4DRBA 2AROD 5AV8A 3LJAC 3UTBA 3AFAA 5B40B 3O62C 2CV5B 3MVDB 3UTAB 3AZMA 1P3IC 3TU4A 1BH9A 5KDMB 3LZ0B 4X23A 3B0DC 3REHD 1BH8B 4YM6B 5G49B 4R8PB 3W97D 3LJAA 3AYWC 2CV5D 1EQZB 3MGPB 5B33A 5BS7C 4YM6D 3X1UB 3AZKA 3AZIC 1P3KC 2NQBA 3WAAD 4CAYB 1M18C 4XZQB 3AZNB 5AV9A 3X1VC 5AV6C 3R45B 4KHAA 1P3AC 5AV5C 3AZIA 3REKB 1P3KA 5B24C 1P3LB 3AZHA 3AN2B 1P34C 1P3BC 3W96A 1P3FB 1KU5A 2YFWA 2YFVA 3C1BC 3AV2A 3W97A 5AV6A 1M1AB 1P3AA 5AV5A 5B32B 3X1TB 5AY8C 1U35D 5BNVA 3REKD 5E5AB 2NZDC 5B2ID 1P3BA 3AV1A 5CPKB 1TZYD 1P3FD 3WKJB 5B1MA 4J8VB 3UT9B 3MGRB 4NE3A 5B0YB 1M1AD 4J8XD 5AY8A 4J8UB 4AWLC 4H9QB 5B32D 3REIA 2PYOC 2L5AA 3LELB 3KXBD 1HTAA 1JFIB 5GT0C 5JA4B 5B31B 1S32C 5CPKD 1AOID 4KGCC 3WTPC 1N1JA 3W99C 3C1CB 3MGRD 3X1SC 2PYOA 4E45A 3AZEB 4J8UD 2HUEC 5DNMC 5GT0A 3AZLC 3RELD 1S32A 5B0ZD 5AV8B 4KGCA 3UTBB 3KUYC 4H9NA 4J8WB 3W99A 1BH9B 3X1SA 3C1CD 4WU8D 4DRAA 5DNND 4JJND 4KUDD 5B2JC 4EO5B 4UUZA 1M19A 3B6GC 4H9RB 1P3OC 4WU9A 3B0BA 4Z66C 3UTBD 3AFAD 5GXQC 2IO5B 3AZMD 3TU4D 4G91C 3MNNC 4X23D 4G92B 5B33B 3B6GA 4YS3C 5B1LB 4H9PA 3LJAD 3AZKB 5CPIB 4ZBJC 3O62D 4Z5TC 1F66B 2NQBB 3LZ1A 1P3ID 3AZGC 5F99C 3RELA 5B33D 5AV9B 2AROB 1ID3A 1KX5C 4KHAB 1P3MC 1H3OA 1P3PA 3W98C 5C3IB 3AZKD 4Z5TA 3MGQC 3AZHB 4WU8A 3WTPE 3AZGA 5F99A 3W96B 2YFVB 3REHB 3AV2B 3W97B 5AV9D 1KX4C 5BNVB 3AZID 1ZLAC 4Z2MH 1P3KD 1KX3C 3MGQA 3REJA 3MGSC 3AZHD 5GT3C 3AV1B 5FUGB 3W96D 3KWQA 5AVCC 5B1MB 3AV2D 3X1VD 5AV6D 1P3AD 5AV5D 5AVBC 3O62A 3REIB 5B24D 1P3IA 3WAAB 4NE5A 1P34D 5JRGC 1P3BD 2RVQC 3AV1D 5BNXA 1Q9CA 3AZFC 3C1BD 5B1MD 3AZJC 1HQ3C 4H9OA 4WNNB 2JSSA 3VH6T 5AY8D 3REID 3AYWA 1P3GC 3WA9C 4XUJC 3AZFA 5BS7A 4H9NB 4ZUXC 2BYKA 2HIOC 1U35B 3B6FC 2PYOD 5GSUC 5CPJC 4Z2MG 2FJ7C 3WA9A 4UUZB 5B2IB 5GT0D 4QLCC 1M18A 1M19B 4XUJA 1S32D 1TZYB 4WU9B 4KGCD 3A6NC 3X1VA 3W99D 4J8XB 3X1SD 5B24A 5GSUA 3KXBB 2FJ7A 5BO0A 1P34A 4LD9C 1M19D 1AOIB 4WU9D 5CP6C 3C1BA 3A6NA 3LZ1B 5B40C 2CV5C 3MVDC 3UTAC 5BT1C 3LZ0C 5B2JD 4LD9A 3RELB 2NZDA 3B6GD 5B0ZB 1ID3B 4YM6C 5CP6A 4R8PC 1P3PB 1H3OB 4Z66D 3LZ1D 4WU8B 3UTAA 4JJNB 5DNNB 1EQZC 3MNND 5KDMA 3LZ0A 4KUDB 3NQUA 3MGPC 1ID3D 1BH8A 4R8PA 3AFAB 1P3PD 3WTPA 4Z5TD 3X1UC 3AZMB 3REJB 3TU4B 1EQZA 3AZGD 4X23B 5DNMA 5F99D 3AZLA 3KWQB 4XZQC 4HGAB 3AZNC 3LJAB 1B6WA 3O62B 3KUYA 3X1UA 3REKC 1P3IB 3MGQD 3REJD 1P3LC 3AN2C 5B2JA 5BNXB 4XZQA 3B0DB 3KWQD 1P3FC 3AZNA 1P3OA 1KX4D 3NQJA 4Z66A 1M1AC 3AYWB 5GXQA 1KX3D 5B32C 3X1TC 1P3LA 3MNNA 5E5AC 3AN2A 5CPKC 4YS3A 3WKJC 4J8VC 3AZIB 3UT9C 3MGRC 1P3KB 5B0YC 2F8NK 3VH5T 3AYWD 3X1TA 4J8UC 1M18B 5E5AA 3LELC 3VH6W 3KSYA 5B31C 2YFWB 3AZFD 3X1VB 3WKJA 5AV6B 2F8NA 1KX5A 2BYMA 1P3AB 4J8VA 5AV5B 1P3MA 3W98A 3UT9A 5B0YA 5B24B 3C1CC 1WWSA 4H9QA 3AZEC 1P34B 3WA9D 1F1EA 3LELA 1P3BB 1JFIA 1M18D 4XUJD 5JA4A 5B31A 3C1BB 5AV8C 3UTBC 1KX4A 4J8WC 5AY8B 3B6FD 1ZLAA 1KX3A 2F8NG 1ULYA 5GSUD 2FJ7D 3MGSA 2NZDB 4QLCD 5GT3A 4EO5C 5AVCA 3A6ND 1N1JB 5B31G 4J8WA 1A7WA 2IO5C 5AVBA 4AWLB 2PYOB 1TAFA 3V9RA 3B0CT 3NQUB 5GT0B 4H9SC 4LD9D 5JRGA 4G92C 1S32B 2NZDD 4CSRA 5B33C 4H9RA 5B1LC 4KGCB 5CP6D 3WTPB 5CPIC 3AZKC 3W99B 3AZJA 1HQ3A 5B40D 1F66C 3X1SB 2NQBC 3MVDD 3UTAD 5BT1D 1P3GA 2HUEB 5DNMB 3LZ0D 3AZLB 4H9SA 5AV9C 5B1LA 2AROC 4R8PD 3KUYB 5CPIA 4ZUXA 3WTPD 2HIOA 5CHLB 5C3IC 1F66A 3B6FA 1EQZD 3AZHC 5B2JB 5DNMD 5CPJA 3W96C 3AZLD 4QLCA 3B6GB 3MGPD 4H9PB 1B67A 3REHC 3AV2C 1P3OB 2AROA 3W97C 3NQJB 4Z66B 3KUYD 5GXQB 3X1UD 4G91B 3MNNB 2CWEA 3AV1C 4YS3B 4XZQD 3REHA 3AZND 1P3OD 5B1MC 4ZBJB 4Z5TB 4WV4B 3REIC 5GXQD 5B40A 2CV5A 3MVDA 3AZGB 3WAAC 1P3LD 5F99B 3AN2D 5FUGA 4YS3D 2F8NB 1KX5B 2BYMB 4YM6A 5G49A 1P3MB 3W98B 3X1TD 3MGQB 3WAAA
chains in the Genus database with same CATH superfamily
5E5AD 3VH5W 3VH5A 4M6BA 3MGPA 1R4VA 3WKJD 2F8ND 1KX4B 1KX5D 4J8VD 1P3MD 1ZLAB 3W98D 3UT9D 1KX3B 4WNNA 5B0YD 1U35C 3EPLA 2BG1A 3MGSB 1WWIA 5GT3B 3LELD 4CAYA 5B2IC 1M19C 5B31D 1TZYC 4WU9C 5AVCB 2FFFB 3EPHA 4H9OB 3R45A 5AVBB 2F8NH 4J8XC 1TAFB 1U35A 1ZLAD 3V9RB 3REKA 3AZED 3KXBC 5JRGB 3MGSD 4CSRB 5GT3D 5B2IA 1TZYA 1AOIC 1P3FA 3AZFB 5AV8D 5AVCD 1BFMA 4E44A 2BYKB 3AZJB 1HQ3B 3LZ1C 4J8WD 1M1AA 4J8XA 5AVBD 1P3GB 5B32A 3WA9B 3KXBA 2Y2HA 4XUJB 5JRGD 3RELC 3VH6A 2RVQD 3B0CW 4NFTA 5B0ZC 5CPKA 1ID3C 1AOIA 4ZUXB 1P3PC 2HIOB 3AZJD 1HQ3D 2UWXA 3B6FB 3MGRA 5GSUB 4WU8C 4J8UA 5DNNC 4JJNC 5CPJB 1P3GD 2ZY5A 2FJ7B 2LY8A 5BO0B 4QLCB 4KUDC 5B32G 5B0ZA 5B1LD 3A6NB 4NE6A 4WZSB 3AFAC 4ZUXD 5CPID 2HIOD 1F66D 2NQBD 3AZMC 3C1CA 3REJC 3TU4C 4JJNA 5DNNA 3AZEA 4KUDA 5CPJD 4LD9B 4X23C 3KWQC 5CP6B 4HGAC 4DRBA 2AROD 2JCHA 2JE5A 5AV8A 3LJAC 3UTBA 1W2EA 3AFAA 5B40B 3O62C 2CV5B 3MVDB 3UTAB 3AZMA 1P3IC 3TU4A 1BH9A 5KDMB 3LZ0B 4X23A 3B0DC 2Y2QA 1BH8B 4YM6B 5G49B 4R8PB 3REHD 3W97D 3LJAA 3AYWC 2CV5D 1EQZB 2RIQA 3MGPB 5B33A 5BS7C 4YM6D 3X1UB 3AZKA 3AZIC 1P3KC 2G5HC 2NQBA 3WAAD 4CAYB 1M18C 4XZQB 3AZNB 5AV9A 3X1VC 5AV6C 3R45B 4KHAA 1P3AC 5AV5C 3AZIA 3REKB 1P3KA 5B24C 2ZM5A 1P3LB 3AZHA 3AN2B 1P34C 1P3BC 3W96A 1P3FB 1KU5A 2YFWA 2YFVA 3C1BC 3AV2A 3W97A 5AV6A 1M1AB 1P3AA 5AV5A 5B32B 3X1TB 5AY8C 1U35D 5BNVA 3REKD 5E5AB 2NZDC 5B2ID 1P3BA 3AV1A 5CPKB 1TZYD 1P3FD 3WKJB 2DQNC 2Y2GA 5B1MA 4J8VB 3UT9B 3MGRB 4NE3A 5B0YB 1M1AD 4J8XD 5AY8A 4J8UB 4AWLC 4H9QB 5B32D 3REIA 2PYOC 2L5AA 3LELB 3KXBD 1HTAA 1JFIB 5GT0C 5JA4B 5B31B 1S32C 5CPKD 1AOID 4KGCC 3WTPC 1N1JA 3W99C 3C1CB 3MGRD 3X1SC 2PYOA 4E45A 3AZEB 4J8UD 2HUEC 5DNMC 4DQYB 5GT0A 3AZLC 3RELD 1S32A 5B0ZD 3A1KA 3EG5B 3FDDA 5AV8B 3UTBB 4KGCA 3KUYC 4H9NA 4J8WB 3W99A 1BH9B 3X1SA 3C1CD 4WU8D 4DRAA 5DNND 4JJND 4KUDD 5B2JC 4EO5B 4UUZA 1M19A 3B6GC 2XD1A 4H9RB 1P3OC 4WU9A 3B0BA 4Z66C 3UTBD 3AFAD 5GXQC 2IO5B 3AZMD 3TU4D 4G91C 3MNNC 4X23D 4G92B 5B33B 3B6GA 4YS3C 5B1LB 4H9PA 3LJAD 3AZKB 5CPIB 4ZBJC 3O62D 4Z5TC 3EPKA 1F66B 3LZ1A 2NQBB 1P3ID 3AZGC 5F99C 3RELA 5B33D 5AV9B 2AROB 1ID3A 1KX5C 4KHAB 1P3MC 1H3OA 1P3PA 3W98C 5C3IB 3AZKD 4Z5TA 2ZY3A 3MGQC 3AZHB 4WU8A 3WTPE 3AZGA 5F99A 3W96B 2YFVB 3REHB 3AV2B 3W97B 5AV9D 1KX4C 3AL0C 5BNVB 3AZID 1ZLAC 4Z2MH 3H0MC 1P3KD 1KX3C 2J8PA 3IP4C 3MGQA 3REJA 3MGSC 3AZHD 5GT3C 3AV1B 2F2AC 5FUGB 2XD5A 3W96D 3KWQA 5B1MB 5AVCC 3AV2D 3X1VD 3KFUG 5AV6D 1P3AD 5AV5D 5AVBC 3O62A 3REIB 5B24D 1P3IA 3WAAB 4NE5A 1P34D 5JRGC 1P3BD 2RVQC 3AV1D 5BNXA 1Q9CA 3AZFC 3C1BD 5B1MD 3AZJC 1HQ3C 4H9OA 4WNNB 2JSSA 2Y2NA 3VH6T 5AY8D 3REID 3AYWA 1P3GC 3WA9C 4XUJC 3AZFA 5BS7A 4H9NB 4ZUXC 2BYKA 2HIOC 1U35B 3B6FC 2PYOD 5GSUC 5CPJC 4Z2MG 2FJ7C 3WA9A 4UUZB 5B2IB 5GT0D 4QLCC 1M18A 1M19B 4XUJA 1S32D 1TZYB 4WU9B 4KGCD 3A6NC 3X1VA 3W99D 4J8XB 3X1SD 5B24A 5GSUA 3KXBB 2FJ7A 5BO0A 1P34A 4LD9C 2ZY2A 1M19D 1AOIB 4WU9D 5CP6C 3C1BA 3A6NA 2Y2KA 3LZ1B 5B40C 2CV5C 3MVDC 1T3UA 3F6TA 3UTAC 5BT1C 2Y2PA 3LZ0C 5B2JD 4LD9A 3RELB 2Y2MA 3B6GD 2NZDA 5B0ZB 1ID3B 4YM6C 5CP6A 4R8PC 1P3PB 1H3OB 4Z66D 3LZ1D 4WU8B 3UTAA 4JJNB 5DNNB 1EQZC 3MNND 5KDMA 3LZ0A 4KUDB 2ZY4A 3NQUA 3H0RC 3MGPC 1ID3D 1BH8A 4R8PA 2G5IC 3AFAB 1P3PD 3WTPA 4Z5TD 3X1UC 3AZMB 3REJB 3TU4B 1EQZA 3AZGD 4X23B 5DNMA 5F99D 3AZLA 3KWQB 4XZQC 4HGAB 3AZNC 3LJAB 1B6WA 3O62B 3KUYA 3X1UA 3REKC 1P3IB 2Y2OA 3MGQD 3REJD 1P3LC 3AN2C 5B2JA 5BNXB 4XZQA 4WJ3C 3A1IA 3B0DB 3KWQD 1P3FC 3AZNA 1P3OA 1KX4D 3NQJA 4Z66A 1M1AC 3AYWB 5GXQA 1KX3D 5B32C 3X1TC 1P3LA 3MNNA 5E5AC 3AN2A 5CPKC 3P5JB 4YS3A 3WKJC 4J8VC 3AZIB 3UT9C 3MGRC 1P3KB 5B0YC 2F8NK 3VH5T 3AYWD 3X1TA 4J8UC 1M18B 5E5AA 3LELC 3VH6W 3KSYA 5B31C 2YFWB 3AZFD 3X1VB 3WKJA 5AV6B 2F8NA 1KX5A 2BYMA 1P3AB 4J8VA 5AV5B 1P3MA 3W98A 3UT9A 5B0YA 5B24B 3C1CC 1WWSA 4H9QA 3AZEC 1P34B 3WA9D 1F1EA 3LELA 1P3BB 1JFIA 1M18D 2W8SA 4XUJD 5JA4A 5B31A 3C1BB 5AV8C 3UTBC 1KX4A 4J8WC 5AY8B 3B6FD 1ZLAA 1KX3A 2F8NG 1ULYA 5GSUD 2FJ7D 3MGSA 2NZDB 4QLCD 5GT3A 4EO5C 5AVCA 3A6ND 1N1JB 4UPKA 5B31G 4J8WA 1PZRA 1A7WA 2IO5C 5AVBA 4AWLB 2PYOB 1TAFA 3V9RA 3B0CT 3NQUB 5GT0B 4H9SC 4LD9D 1Z2CB 5JRGA 4G92C 1S32B 2NZDD 4CSRA 5B33C 4H9RA 5B1LC 4KGCB 5CP6D 3WTPB 5CPIC 3AZKC 3W99B 3AZJA 1HQ3A 5B40D 2Y2IA 3X1SB 1F66C 3MVDD 2NQBC 3UTAD 5BT1D 1P3GA 2HUEB 5DNMB 3LZ0D 3AZLB 4H9SA 5AV9C 5B1LA 2AROC 4R8PD 3KUYB 5CPIA 4ZUXA 3WTPD 2HIOA 5CHLB 5C3IC 1F66A 3B6FA 2Y2LA 3H0LC 1EQZD 2Y2JA 3AZHC 5B2JB 5DNMD 5CPJA 3W96C 3AZLD 4QLCA 3B6GB 3MGPD 4H9PB 1B67A 3REHC 3AV2C 1P3OB 2AROA 3W97C 3NQJB 4Z66B 3KUYD 5GXQB 3X1UD 4G91B 3MNNB 3EPJA 2CWEA 3AV1C 4YS3B 4XZQD 3REHA 3AZND 1P3OD 5B1MC 4ZBJB 4Z5TB 4WV4B 3REIC 5GXQD 5B40A 2CV5A 3MVDA 3AZGB 3WAAC 1P3LD 5F99B 3AN2D 2VQRA 5FUGA 4YS3D 2F8NB 1KX5B 2BYMB 4YM6A 5G49A 1P3MB 3W98B 3X1TD 3MGQB 3WAAA 2DF4C
chains in the Genus database with same CATH topology
5E5AD 3VH5W 3VH5A 4M6BA 3MGPA 1R4VA 3WKJD 2F8ND 1KX4B 1KX5D 4J8VD 1P3MD 1ZLAB 3W98D 3UT9D 1KX3B 4WNNA 5B0YD 1U35C 3EPLA 2BG1A 3MGSB 1WWIA 5GT3B 3LELD 4CAYA 5B2IC 1M19C 5B31D 1TZYC 4WU9C 5AVCB 2FFFB 3EPHA 4H9OB 3R45A 5AVBB 2F8NH 4J8XC 1TAFB 1U35A 1ZLAD 3V9RB 3REKA 3AZED 3KXBC 5JRGB 3MGSD 4CSRB 5GT3D 5B2IA 1TZYA 1AOIC 1P3FA 3AZFB 5AV8D 5AVCD 1BFMA 4E44A 2BYKB 3AZJB 1HQ3B 3LZ1C 4J8WD 1M1AA 4J8XA 5AVBD 1P3GB 5B32A 3WA9B 3KXBA 2Y2HA 4XUJB 5JRGD 3RELC 3VH6A 2RVQD 3B0CW 4NFTA 5B0ZC 5CPKA 1ID3C 1AOIA 4ZUXB 1P3PC 2HIOB 3AZJD 1HQ3D 2UWXA 3B6FB 3MGRA 5GSUB 4WU8C 4J8UA 5DNNC 4JJNC 5CPJB 1P3GD 2ZY5A 2FJ7B 2LY8A 5BO0B 4QLCB 4KUDC 5B32G 5B0ZA 5B1LD 3A6NB 4NE6A 4WZSB 3AFAC 4ZUXD 5CPID 2HIOD 1F66D 2NQBD 3AZMC 3C1CA 3REJC 3TU4C 4JJNA 5DNNA 3AZEA 4KUDA 5CPJD 4LD9B 4X23C 3KWQC 5CP6B 4HGAC 4DRBA 2AROD 2JCHA 2JE5A 5AV8A 3LJAC 3UTBA 1W2EA 3AFAA 5B40B 3O62C 2CV5B 3MVDB 3UTAB 3AZMA 1P3IC 3TU4A 1BH9A 5KDMB 3LZ0B 4X23A 3B0DC 2Y2QA 1BH8B 4YM6B 5G49B 4R8PB 3REHD 3W97D 3LJAA 3AYWC 2CV5D 1EQZB 2RIQA 3MGPB 5B33A 5BS7C 4YM6D 3X1UB 3AZKA 3AZIC 1P3KC 2G5HC 2NQBA 3WAAD 4CAYB 1M18C 4XZQB 3AZNB 5AV9A 3X1VC 5AV6C 3R45B 4KHAA 1P3AC 5AV5C 3AZIA 3REKB 1P3KA 5B24C 2ZM5A 1P3LB 3AZHA 3AN2B 1P34C 1P3BC 3W96A 1P3FB 1KU5A 2YFWA 2YFVA 3C1BC 3AV2A 3W97A 5AV6A 1M1AB 1P3AA 5AV5A 5B32B 3X1TB 5AY8C 1U35D 5BNVA 3REKD 5E5AB 2NZDC 5B2ID 1P3BA 3AV1A 5CPKB 1TZYD 1P3FD 3WKJB 2DQNC 2Y2GA 5B1MA 4J8VB 3UT9B 3MGRB 4NE3A 5B0YB 1M1AD 4J8XD 5AY8A 4J8UB 4AWLC 4H9QB 5B32D 3REIA 2PYOC 2L5AA 3LELB 3KXBD 1HTAA 1JFIB 5GT0C 5JA4B 5B31B 1S32C 5CPKD 1AOID 4KGCC 3WTPC 1N1JA 3W99C 3C1CB 3MGRD 3X1SC 2PYOA 4E45A 3AZEB 4J8UD 2HUEC 5DNMC 4DQYB 5GT0A 3AZLC 3RELD 1S32A 5B0ZD 3A1KA 3EG5B 3FDDA 5AV8B 3UTBB 4KGCA 3KUYC 4H9NA 4J8WB 3W99A 1BH9B 3X1SA 3C1CD 4WU8D 4DRAA 5DNND 4JJND 4KUDD 5B2JC 4EO5B 4UUZA 1M19A 3B6GC 2XD1A 4H9RB 1P3OC 4WU9A 3B0BA 4Z66C 3UTBD 3AFAD 5GXQC 2IO5B 3AZMD 3TU4D 4G91C 3MNNC 4X23D 4G92B 5B33B 3B6GA 4YS3C 5B1LB 4H9PA 3LJAD 3AZKB 5CPIB 4ZBJC 3O62D 4Z5TC 3EPKA 1F66B 3LZ1A 2NQBB 1P3ID 3AZGC 5F99C 3RELA 5B33D 5AV9B 2AROB 1ID3A 1KX5C 4KHAB 1P3MC 1H3OA 1P3PA 3W98C 5C3IB 3AZKD 4Z5TA 2ZY3A 3MGQC 3AZHB 4WU8A 3WTPE 3AZGA 5F99A 3W96B 2YFVB 3REHB 3AV2B 3W97B 5AV9D 1KX4C 3AL0C 5BNVB 3AZID 1ZLAC 4Z2MH 3H0MC 1P3KD 1KX3C 2J8PA 3IP4C 3MGQA 3REJA 3MGSC 3AZHD 5GT3C 3AV1B 2F2AC 5FUGB 2XD5A 3W96D 3KWQA 5B1MB 5AVCC 3AV2D 3X1VD 3KFUG 5AV6D 1P3AD 5AV5D 5AVBC 3O62A 3REIB 5B24D 1P3IA 3WAAB 4NE5A 1P34D 5JRGC 1P3BD 2RVQC 3AV1D 5BNXA 1Q9CA 3AZFC 3C1BD 5B1MD 3AZJC 1HQ3C 4H9OA 4WNNB 2JSSA 2Y2NA 3VH6T 5AY8D 3REID 3AYWA 1P3GC 3WA9C 4XUJC 3AZFA 5BS7A 4H9NB 4ZUXC 2BYKA 2HIOC 1U35B 3B6FC 2PYOD 5GSUC 5CPJC 4Z2MG 2FJ7C 3WA9A 4UUZB 5B2IB 5GT0D 4QLCC 1M18A 1M19B 4XUJA 1S32D 1TZYB 4WU9B 4KGCD 3A6NC 3X1VA 3W99D 4J8XB 3X1SD 5B24A 5GSUA 3KXBB 2FJ7A 5BO0A 1P34A 4LD9C 2ZY2A 1M19D 1AOIB 4WU9D 5CP6C 3C1BA 3A6NA 2Y2KA 3LZ1B 5B40C 2CV5C 3MVDC 1T3UA 3F6TA 3UTAC 5BT1C 2Y2PA 3LZ0C 5B2JD 4LD9A 3RELB 2Y2MA 3B6GD 2NZDA 5B0ZB 1ID3B 4YM6C 5CP6A 4R8PC 1P3PB 1H3OB 4Z66D 3LZ1D 4WU8B 3UTAA 4JJNB 5DNNB 1EQZC 3MNND 5KDMA 3LZ0A 4KUDB 2ZY4A 3NQUA 3H0RC 3MGPC 1ID3D 1BH8A 4R8PA 2G5IC 3AFAB 1P3PD 3WTPA 4Z5TD 3X1UC 3AZMB 3REJB 3TU4B 1EQZA 3AZGD 4X23B 5DNMA 5F99D 3AZLA 3KWQB 4XZQC 4HGAB 3AZNC 3LJAB 1B6WA 3O62B 3KUYA 3X1UA 3REKC 1P3IB 2Y2OA 3MGQD 3REJD 1P3LC 3AN2C 5B2JA 5BNXB 4XZQA 4WJ3C 3A1IA 3B0DB 3KWQD 1P3FC 3AZNA 1P3OA 1KX4D 3NQJA 4Z66A 1M1AC 3AYWB 5GXQA 1KX3D 5B32C 3X1TC 1P3LA 3MNNA 5E5AC 3AN2A 5CPKC 3P5JB 4YS3A 3WKJC 4J8VC 3AZIB 3UT9C 3MGRC 1P3KB 5B0YC 2F8NK 3VH5T 3AYWD 3X1TA 4J8UC 1M18B 5E5AA 3LELC 3VH6W 3KSYA 5B31C 2YFWB 3AZFD 3X1VB 3WKJA 5AV6B 2F8NA 1KX5A 2BYMA 1P3AB 4J8VA 5AV5B 1P3MA 3W98A 3UT9A 5B0YA 5B24B 3C1CC 1WWSA 4H9QA 3AZEC 1P34B 3WA9D 1F1EA 3LELA 1P3BB 1JFIA 1M18D 2W8SA 4XUJD 5JA4A 5B31A 3C1BB 5AV8C 3UTBC 1KX4A 4J8WC 5AY8B 3B6FD 1ZLAA 1KX3A 2F8NG 1ULYA 5GSUD 2FJ7D 3MGSA 2NZDB 4QLCD 5GT3A 4EO5C 5AVCA 3A6ND 1N1JB 4UPKA 5B31G 4J8WA 1PZRA 1A7WA 2IO5C 5AVBA 4AWLB 2PYOB 1TAFA 3V9RA 3B0CT 3NQUB 5GT0B 4H9SC 4LD9D 1Z2CB 5JRGA 4G92C 1S32B 2NZDD 4CSRA 5B33C 4H9RA 5B1LC 4KGCB 5CP6D 3WTPB 5CPIC 3AZKC 3W99B 3AZJA 1HQ3A 5B40D 2Y2IA 3X1SB 1F66C 3MVDD 2NQBC 3UTAD 5BT1D 1P3GA 2HUEB 5DNMB 3LZ0D 3AZLB 4H9SA 5AV9C 5B1LA 2AROC 4R8PD 3KUYB 5CPIA 4ZUXA 3WTPD 2HIOA 5CHLB 5C3IC 1F66A 3B6FA 2Y2LA 3H0LC 1EQZD 2Y2JA 3AZHC 5B2JB 5DNMD 5CPJA 3W96C 3AZLD 4QLCA 3B6GB 3MGPD 4H9PB 1B67A 3REHC 3AV2C 1P3OB 2AROA 3W97C 3NQJB 4Z66B 3KUYD 5GXQB 3X1UD 4G91B 3MNNB 3EPJA 2CWEA 3AV1C 4YS3B 4XZQD 3REHA 3AZND 1P3OD 5B1MC 4ZBJB 4Z5TB 4WV4B 3REIC 5GXQD 5B40A 2CV5A 3MVDA 3AZGB 3WAAC 1P3LD 5F99B 3AN2D 2VQRA 5FUGA 4YS3D 2F8NB 1KX5B 2BYMB 4YM6A 5G49A 1P3MB 3W98B 3X1TD 3MGQB 3WAAA 2DF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A D;  3VH5 W;  3VH5 A;  4M6B A;  3MGP A;  1R4V A;  3WKJ D;  2F8N D;  1KX4 B;  1KX5 D;  4J8V D;  1P3M D;  1ZLA B;  3W98 D;  3UT9 D;  1KX3 B;  4WNN A;  5B0Y D;  1U35 C;  3MGS B;  1WWI A;  5GT3 B;  3LEL D;  4CAY A;  5B2I C;  1M19 C;  5B31 D;  1TZY C;  4WU9 C;  5AVC B;  4H9O B;  3R45 A;  5AVB B;  2F8N H;  4J8X C;  1TAF B;  1U35 A;  1ZLA D;  3V9R B;  3REK A;  3AZE D;  3KXB C;  5JRG B;  3MGS D;  4CSR B;  5GT3 D;  5B2I A;  1TZY A;  1AOI C;  1P3F A;  3AZF B;  5AV8 D;  5AVC D;  1BFM A;  4E44 A;  2BYK B;  3AZJ B;  1HQ3 B;  3LZ1 C;  4J8W D;  1M1A A;  4J8X A;  5AVB D;  1P3G B;  5B32 A;  3WA9 B;  3KXB A;  4XUJ B;  5JRG D;  3REL C;  3VH6 A;  2RVQ D;  3B0C W;  4NFT A;  5B0Z C;  5CPK A;  1ID3 C;  1AOI A;  4ZUX B;  1P3P C;  2HIO B;  3AZJ D;  1HQ3 D;  3B6F B;  3MGR A;  5GSU B;  4WU8 C;  4J8U A;  5DNN C;  4JJN C;  5CPJ B;  1P3G D;  2FJ7 B;  4KUD C;  2LY8 A;  5BO0 B;  4QLC B;  5B32 G;  5B0Z A;  5B1L D;  3A6N B;  4NE6 A;  4WZS B;  3AFA C;  4ZUX D;  5CPI D;  2HIO D;  1F66 D;  2NQB D;  3AZM C;  3C1C A;  3REJ C;  3TU4 C;  4JJN A;  5DNN A;  3AZE A;  4KUD A;  5CPJ D;  4LD9 B;  4X23 C;  3KWQ C;  5CP6 B;  4HGA C;  4DRB A;  2ARO D;  5AV8 A;  3LJA C;  3UTB A;  3AFA A;  5B40 B;  3O62 C;  2CV5 B;  3MVD B;  3UTA B;  3AZM A;  1P3I C;  3TU4 A;  1BH9 A;  5KDM B;  3LZ0 B;  4X23 A;  3B0D C;  3REH D;  1BH8 B;  4YM6 B;  5G49 B;  4R8P B;  3W97 D;  3LJA A;  3AYW C;  2CV5 D;  1EQZ B;  3MGP B;  5B33 A;  5BS7 C;  4YM6 D;  3X1U B;  3AZK A;  3AZI C;  1P3K C;  2NQB A;  3WAA D;  4CAY B;  1M18 C;  4XZQ B;  3AZN B;  5AV9 A;  3X1V C;  5AV6 C;  3R45 B;  4KHA A;  1P3A C;  5AV5 C;  3AZI A;  3REK B;  1P3K A;  5B24 C;  1P3L B;  3AZH A;  3AN2 B;  1P34 C;  1P3B C;  3W96 A;  1P3F B;  1KU5 A;  2YFW A;  2YFV A;  3C1B C;  3AV2 A;  3W97 A;  5AV6 A;  1M1A B;  1P3A A;  5AV5 A;  5B32 B;  3X1T B;  5AY8 C;  1U35 D;  5BNV A;  3REK D;  5E5A B;  2NZD C;  5B2I D;  1P3B A;  3AV1 A;  5CPK B;  1TZY D;  1P3F D;  3WKJ B;  5B1M A;  4J8V B;  3UT9 B;  3MGR B;  4NE3 A;  5B0Y B;  1M1A D;  4J8X D;  5AY8 A;  4J8U B;  4AWL C;  4H9Q B;  5B32 D;  3REI A;  2PYO C;  2L5A A;  3LEL B;  3KXB D;  1HTA A;  1JFI B;  5GT0 C;  5JA4 B;  5B31 B;  1S32 C;  5CPK D;  1AOI D;  4KGC C;  3WTP C;  1N1J A;  3W99 C;  3C1C B;  3MGR D;  3X1S C;  2PYO A;  4E45 A;  3AZE B;  4J8U D;  2HUE C;  5DNM C;  5GT0 A;  3AZL C;  3REL D;  1S32 A;  5B0Z D;  5AV8 B;  4KGC A;  3UTB B;  3KUY C;  4H9N A;  4J8W B;  3W99 A;  1BH9 B;  3X1S A;  3C1C D;  4WU8 D;  4DRA A;  5DNN D;  4JJN D;  4KUD D;  5B2J C;  4EO5 B;  4UUZ A;  1M19 A;  3B6G C;  4H9R B;  1P3O C;  4WU9 A;  3B0B A;  4Z66 C;  3UTB D;  3AFA D;  5GXQ C;  2IO5 B;  3AZM D;  3TU4 D;  4G91 C;  3MNN C;  4X23 D;  4G92 B;  5B33 B;  3B6G A;  4YS3 C;  5B1L B;  4H9P A;  3LJA D;  3AZK B;  5CPI B;  4ZBJ C;  3O62 D;  4Z5T C;  1F66 B;  2NQB B;  3LZ1 A;  1P3I D;  3AZG C;  5F99 C;  3REL A;  5B33 D;  5AV9 B;  2ARO B;  1ID3 A;  1KX5 C;  4KHA B;  1P3M C;  1H3O A;  1P3P A;  3W98 C;  5C3I B;  3AZK D;  4Z5T A;  3MGQ C;  3AZH B;  4WU8 A;  3WTP E;  3AZG A;  5F99 A;  3W96 B;  2YFV B;  3REH B;  3AV2 B;  3W97 B;  5AV9 D;  1KX4 C;  5BNV B;  3AZI D;  1ZLA C;  4Z2M H;  1P3K D;  1KX3 C;  3MGQ A;  3REJ A;  3MGS C;  3AZH D;  5GT3 C;  3AV1 B;  5FUG B;  3W96 D;  3KWQ A;  5AVC C;  5B1M B;  3AV2 D;  3X1V D;  5AV6 D;  1P3A D;  5AV5 D;  5AVB C;  3O62 A;  3REI B;  5B24 D;  1P3I A;  3WAA B;  4NE5 A;  1P34 D;  5JRG C;  1P3B D;  2RVQ C;  3AV1 D;  5BNX A;  1Q9C A;  3AZF C;  3C1B D;  5B1M D;  3AZJ C;  1HQ3 C;  4H9O A;  4WNN B;  2JSS A;  3VH6 T;  5AY8 D;  3REI D;  3AYW A;  1P3G C;  3WA9 C;  4XUJ C;  3AZF A;  5BS7 A;  4H9N B;  4ZUX C;  2BYK A;  2HIO C;  1U35 B;  3B6F C;  2PYO D;  5GSU C;  5CPJ C;  4Z2M G;  2FJ7 C;  3WA9 A;  4UUZ B;  5B2I B;  5GT0 D;  4QLC C;  1M18 A;  1M19 B;  4XUJ A;  1S32 D;  1TZY B;  4WU9 B;  4KGC D;  3A6N C;  3X1V A;  3W99 D;  4J8X B;  3X1S D;  5B24 A;  5GSU A;  3KXB B;  2FJ7 A;  5BO0 A;  1P34 A;  4LD9 C;  1M19 D;  1AOI B;  4WU9 D;  5CP6 C;  3C1B A;  3A6N A;  3LZ1 B;  5B40 C;  2CV5 C;  3MVD C;  3UTA C;  5BT1 C;  3LZ0 C;  5B2J D;  4LD9 A;  3REL B;  2NZD A;  3B6G D;  5B0Z B;  1ID3 B;  4YM6 C;  5CP6 A;  4R8P C;  1P3P B;  1H3O B;  4Z66 D;  3LZ1 D;  4WU8 B;  3UTA A;  4JJN B;  5DNN B;  1EQZ C;  3MNN D;  5KDM A;  3LZ0 A;  4KUD B;  3NQU A;  3MGP C;  1ID3 D;  1BH8 A;  4R8P A;  3AFA B;  1P3P D;  3WTP A;  4Z5T D;  3X1U C;  3AZM B;  3REJ B;  3TU4 B;  1EQZ A;  3AZG D;  4X23 B;  5DNM A;  5F99 D;  3AZL A;  3KWQ B;  4XZQ C;  4HGA B;  3AZN C;  3LJA B;  1B6W A;  3O62 B;  3KUY A;  3X1U A;  3REK C;  1P3I B;  3MGQ D;  3REJ D;  1P3L C;  3AN2 C;  5B2J A;  5BNX B;  4XZQ A;  3B0D B;  3KWQ D;  1P3F C;  3AZN A;  1P3O A;  1KX4 D;  3NQJ A;  4Z66 A;  1M1A C;  3AYW B;  5GXQ A;  1KX3 D;  5B32 C;  3X1T C;  1P3L A;  3MNN A;  5E5A C;  3AN2 A;  5CPK C;  4YS3 A;  3WKJ C;  4J8V C;  3AZI B;  3UT9 C;  3MGR C;  1P3K B;  5B0Y C;  2F8N K;  3VH5 T;  3AYW D;  3X1T A;  4J8U C;  1M18 B;  5E5A A;  3LEL C;  3VH6 W;  3KSY A;  5B31 C;  2YFW B;  3AZF D;  3X1V B;  3WKJ A;  5AV6 B;  2F8N A;  1KX5 A;  2BYM A;  1P3A B;  4J8V A;  5AV5 B;  1P3M A;  3W98 A;  3UT9 A;  5B0Y A;  5B24 B;  3C1C C;  1WWS A;  4H9Q A;  3AZE C;  1P34 B;  3WA9 D;  1F1E A;  3LEL A;  1P3B B;  1JFI A;  1M18 D;  4XUJ D;  5JA4 A;  5B31 A;  3C1B B;  5AV8 C;  3UTB C;  1KX4 A;  4J8W C;  5AY8 B;  3B6F D;  1ZLA A;  1KX3 A;  2F8N G;  1ULY A;  5GSU D;  2FJ7 D;  3MGS A;  2NZD B;  4QLC D;  5GT3 A;  4EO5 C;  5AVC A;  3A6N D;  1N1J B;  5B31 G;  4J8W A;  1A7W A;  2IO5 C;  5AVB A;  4AWL B;  2PYO B;  1TAF A;  3V9R A;  3B0C T;  3NQU B;  5GT0 B;  4H9S C;  4LD9 D;  5JRG A;  4G92 C;  1S32 B;  2NZD D;  4CSR A;  5B33 C;  4H9R A;  5B1L C;  4KGC B;  5CP6 D;  3WTP B;  5CPI C;  3AZK C;  3W99 B;  3AZJ A;  1HQ3 A;  5B40 D;  1F66 C;  3X1S B;  2NQB C;  3MVD D;  3UTA D;  5BT1 D;  1P3G A;  2HUE B;  5DNM B;  3LZ0 D;  3AZL B;  4H9S A;  5AV9 C;  5B1L A;  2ARO C;  4R8P D;  3KUY B;  5CPI A;  4ZUX A;  3WTP D;  2HIO A;  5CHL B;  5C3I C;  1F66 A;  3B6F A;  1EQZ D;  3AZH C;  5B2J B;  5DNM D;  5CPJ A;  3W96 C;  3AZL D;  4QLC A;  3B6G B;  3MGP D;  4H9P B;  1B67 A;  3REH C;  3AV2 C;  1P3O B;  2ARO A;  3W97 C;  3NQJ B;  4Z66 B;  3KUY D;  5GXQ B;  3X1U D;  4G91 B;  3MNN B;  2CWE A;  3AV1 C;  4YS3 B;  4XZQ D;  3REH A;  3AZN D;  1P3O D;  5B1M C;  4ZBJ B;  4Z5T B;  4WV4 B;  3REI C;  5GXQ D;  5B40 A;  2CV5 A;  3MVD A;  3AZG B;  3WAA C;  1P3L D;  5F99 B;  3AN2 D;  5FUG A;  4YS3 D;  2F8N B;  1KX5 B;  2BYM B;  4YM6 A;  5G49 A;  1P3M B;  3W98 B;  3X1T D;  3MGQ B;  3WAA A; 
#chains in the Genus database with same CATH topology
 5E5A D;  3VH5 W;  3VH5 A;  4M6B A;  3MGP A;  1R4V A;  3WKJ D;  2F8N D;  1KX4 B;  1KX5 D;  4J8V D;  1P3M D;  1ZLA B;  3W98 D;  3UT9 D;  1KX3 B;  4WNN A;  5B0Y D;  1U35 C;  3EPL A;  2BG1 A;  3MGS B;  1WWI A;  5GT3 B;  3LEL D;  4CAY A;  5B2I C;  1M19 C;  5B31 D;  1TZY C;  4WU9 C;  5AVC B;  2FFF B;  3EPH A;  4H9O B;  3R45 A;  5AVB B;  2F8N H;  4J8X C;  1TAF B;  1U35 A;  1ZLA D;  3V9R B;  3REK A;  3AZE D;  3KXB C;  5JRG B;  3MGS D;  4CSR B;  5GT3 D;  5B2I A;  1TZY A;  1AOI C;  1P3F A;  3AZF B;  5AV8 D;  5AVC D;  1BFM A;  4E44 A;  2BYK B;  3AZJ B;  1HQ3 B;  3LZ1 C;  4J8W D;  1M1A A;  4J8X A;  5AVB D;  1P3G B;  5B32 A;  3WA9 B;  3KXB A;  2Y2H A;  4XUJ B;  5JRG D;  3REL C;  3VH6 A;  2RVQ D;  3B0C W;  4NFT A;  5B0Z C;  5CPK A;  1ID3 C;  1AOI A;  4ZUX B;  1P3P C;  2HIO B;  3AZJ D;  1HQ3 D;  2UWX A;  3B6F B;  3MGR A;  5GSU B;  4WU8 C;  4J8U A;  5DNN C;  4JJN C;  5CPJ B;  1P3G D;  2ZY5 A;  2FJ7 B;  2LY8 A;  5BO0 B;  4QLC B;  4KUD C;  5B32 G;  5B0Z A;  5B1L D;  3A6N B;  4NE6 A;  4WZS B;  3AFA C;  4ZUX D;  5CPI D;  2HIO D;  1F66 D;  2NQB D;  3AZM C;  3C1C A;  3REJ C;  3TU4 C;  4JJN A;  5DNN A;  3AZE A;  4KUD A;  5CPJ D;  4LD9 B;  4X23 C;  3KWQ C;  5CP6 B;  4HGA C;  4DRB A;  2ARO D;  2JCH A;  2JE5 A;  5AV8 A;  3LJA C;  3UTB A;  1W2E A;  3AFA A;  5B40 B;  3O62 C;  2CV5 B;  3MVD B;  3UTA B;  3AZM A;  1P3I C;  3TU4 A;  1BH9 A;  5KDM B;  3LZ0 B;  4X23 A;  3B0D C;  2Y2Q A;  1BH8 B;  4YM6 B;  5G49 B;  4R8P B;  3REH D;  3W97 D;  3LJA A;  3AYW C;  2CV5 D;  1EQZ B;  2RIQ A;  3MGP B;  5B33 A;  5BS7 C;  4YM6 D;  3X1U B;  3AZK A;  3AZI C;  1P3K C;  2G5H C;  2NQB A;  3WAA D;  4CAY B;  1M18 C;  4XZQ B;  3AZN B;  5AV9 A;  3X1V C;  5AV6 C;  3R45 B;  4KHA A;  1P3A C;  5AV5 C;  3AZI A;  3REK B;  1P3K A;  5B24 C;  2ZM5 A;  1P3L B;  3AZH A;  3AN2 B;  1P34 C;  1P3B C;  3W96 A;  1P3F B;  1KU5 A;  2YFW A;  2YFV A;  3C1B C;  3AV2 A;  3W97 A;  5AV6 A;  1M1A B;  1P3A A;  5AV5 A;  5B32 B;  3X1T B;  5AY8 C;  1U35 D;  5BNV A;  3REK D;  5E5A B;  2NZD C;  5B2I D;  1P3B A;  3AV1 A;  5CPK B;  1TZY D;  1P3F D;  3WKJ B;  2DQN C;  2Y2G A;  5B1M A;  4J8V B;  3UT9 B;  3MGR B;  4NE3 A;  5B0Y B;  1M1A D;  4J8X D;  5AY8 A;  4J8U B;  4AWL C;  4H9Q B;  5B32 D;  3REI A;  2PYO C;  2L5A A;  3LEL B;  3KXB D;  1HTA A;  1JFI B;  5GT0 C;  5JA4 B;  5B31 B;  1S32 C;  5CPK D;  1AOI D;  4KGC C;  3WTP C;  1N1J A;  3W99 C;  3C1C B;  3MGR D;  3X1S C;  2PYO A;  4E45 A;  3AZE B;  4J8U D;  2HUE C;  5DNM C;  4DQY B;  5GT0 A;  3AZL C;  3REL D;  1S32 A;  5B0Z D;  3A1K A;  3EG5 B;  3FDD A;  5AV8 B;  3UTB B;  4KGC A;  3KUY C;  4H9N A;  4J8W B;  3W99 A;  1BH9 B;  3X1S A;  3C1C D;  4WU8 D;  4DRA A;  5DNN D;  4JJN D;  4KUD D;  5B2J C;  4EO5 B;  4UUZ A;  1M19 A;  3B6G C;  2XD1 A;  4H9R B;  1P3O C;  4WU9 A;  3B0B A;  4Z66 C;  3UTB D;  3AFA D;  5GXQ C;  2IO5 B;  3AZM D;  3TU4 D;  4G91 C;  3MNN C;  4X23 D;  4G92 B;  5B33 B;  3B6G A;  4YS3 C;  5B1L B;  4H9P A;  3LJA D;  3AZK B;  5CPI B;  4ZBJ C;  3O62 D;  4Z5T C;  3EPK A;  1F66 B;  3LZ1 A;  2NQB B;  1P3I D;  3AZG C;  5F99 C;  3REL A;  5B33 D;  5AV9 B;  2ARO B;  1ID3 A;  1KX5 C;  4KHA B;  1P3M C;  1H3O A;  1P3P A;  3W98 C;  5C3I B;  3AZK D;  4Z5T A;  2ZY3 A;  3MGQ C;  3AZH B;  4WU8 A;  3WTP E;  3AZG A;  5F99 A;  3W96 B;  2YFV B;  3REH B;  3AV2 B;  3W97 B;  5AV9 D;  1KX4 C;  3AL0 C;  5BNV B;  3AZI D;  1ZLA C;  4Z2M H;  3H0M C;  1P3K D;  1KX3 C;  2J8P A;  3IP4 C;  3MGQ A;  3REJ A;  3MGS C;  3AZH D;  5GT3 C;  3AV1 B;  2F2A C;  5FUG B;  2XD5 A;  3W96 D;  3KWQ A;  5B1M B;  5AVC C;  3AV2 D;  3X1V D;  3KFU G;  5AV6 D;  1P3A D;  5AV5 D;  5AVB C;  3O62 A;  3REI B;  5B24 D;  1P3I A;  3WAA B;  4NE5 A;  1P34 D;  5JRG C;  1P3B D;  2RVQ C;  3AV1 D;  5BNX A;  1Q9C A;  3AZF C;  3C1B D;  5B1M D;  3AZJ C;  1HQ3 C;  4H9O A;  4WNN B;  2JSS A;  2Y2N A;  3VH6 T;  5AY8 D;  3REI D;  3AYW A;  1P3G C;  3WA9 C;  4XUJ C;  3AZF A;  5BS7 A;  4H9N B;  4ZUX C;  2BYK A;  2HIO C;  1U35 B;  3B6F C;  2PYO D;  5GSU C;  5CPJ C;  4Z2M G;  2FJ7 C;  3WA9 A;  4UUZ B;  5B2I B;  5GT0 D;  4QLC C;  1M18 A;  1M19 B;  4XUJ A;  1S32 D;  1TZY B;  4WU9 B;  4KGC D;  3A6N C;  3X1V A;  3W99 D;  4J8X B;  3X1S D;  5B24 A;  5GSU A;  3KXB B;  2FJ7 A;  5BO0 A;  1P34 A;  4LD9 C;  2ZY2 A;  1M19 D;  1AOI B;  4WU9 D;  5CP6 C;  3C1B A;  3A6N A;  2Y2K A;  3LZ1 B;  5B40 C;  2CV5 C;  3MVD C;  1T3U A;  3F6T A;  3UTA C;  5BT1 C;  2Y2P A;  3LZ0 C;  5B2J D;  4LD9 A;  3REL B;  2Y2M A;  3B6G D;  2NZD A;  5B0Z B;  1ID3 B;  4YM6 C;  5CP6 A;  4R8P C;  1P3P B;  1H3O B;  4Z66 D;  3LZ1 D;  4WU8 B;  3UTA A;  4JJN B;  5DNN B;  1EQZ C;  3MNN D;  5KDM A;  3LZ0 A;  4KUD B;  2ZY4 A;  3NQU A;  3H0R C;  3MGP C;  1ID3 D;  1BH8 A;  4R8P A;  2G5I C;  3AFA B;  1P3P D;  3WTP A;  4Z5T D;  3X1U C;  3AZM B;  3REJ B;  3TU4 B;  1EQZ A;  3AZG D;  4X23 B;  5DNM A;  5F99 D;  3AZL A;  3KWQ B;  4XZQ C;  4HGA B;  3AZN C;  3LJA B;  1B6W A;  3O62 B;  3KUY A;  3X1U A;  3REK C;  1P3I B;  2Y2O A;  3MGQ D;  3REJ D;  1P3L C;  3AN2 C;  5B2J A;  5BNX B;  4XZQ A;  4WJ3 C;  3A1I A;  3B0D B;  3KWQ D;  1P3F C;  3AZN A;  1P3O A;  1KX4 D;  3NQJ A;  4Z66 A;  1M1A C;  3AYW B;  5GXQ A;  1KX3 D;  5B32 C;  3X1T C;  1P3L A;  3MNN A;  5E5A C;  3AN2 A;  5CPK C;  3P5J B;  4YS3 A;  3WKJ C;  4J8V C;  3AZI B;  3UT9 C;  3MGR C;  1P3K B;  5B0Y C;  2F8N K;  3VH5 T;  3AYW D;  3X1T A;  4J8U C;  1M18 B;  5E5A A;  3LEL C;  3VH6 W;  3KSY A;  5B31 C;  2YFW B;  3AZF D;  3X1V B;  3WKJ A;  5AV6 B;  2F8N A;  1KX5 A;  2BYM A;  1P3A B;  4J8V A;  5AV5 B;  1P3M A;  3W98 A;  3UT9 A;  5B0Y A;  5B24 B;  3C1C C;  1WWS A;  4H9Q A;  3AZE C;  1P34 B;  3WA9 D;  1F1E A;  3LEL A;  1P3B B;  1JFI A;  1M18 D;  2W8S A;  4XUJ D;  5JA4 A;  5B31 A;  3C1B B;  5AV8 C;  3UTB C;  1KX4 A;  4J8W C;  5AY8 B;  3B6F D;  1ZLA A;  1KX3 A;  2F8N G;  1ULY A;  5GSU D;  2FJ7 D;  3MGS A;  2NZD B;  4QLC D;  5GT3 A;  4EO5 C;  5AVC A;  3A6N D;  1N1J B;  4UPK A;  5B31 G;  4J8W A;  1PZR A;  1A7W A;  2IO5 C;  5AVB A;  4AWL B;  2PYO B;  1TAF A;  3V9R A;  3B0C T;  3NQU B;  5GT0 B;  4H9S C;  4LD9 D;  1Z2C B;  5JRG A;  4G92 C;  1S32 B;  2NZD D;  4CSR A;  5B33 C;  4H9R A;  5B1L C;  4KGC B;  5CP6 D;  3WTP B;  5CPI C;  3AZK C;  3W99 B;  3AZJ A;  1HQ3 A;  5B40 D;  2Y2I A;  3X1S B;  1F66 C;  3MVD D;  2NQB C;  3UTA D;  5BT1 D;  1P3G A;  2HUE B;  5DNM B;  3LZ0 D;  3AZL B;  4H9S A;  5AV9 C;  5B1L A;  2ARO C;  4R8P D;  3KUY B;  5CPI A;  4ZUX A;  3WTP D;  2HIO A;  5CHL B;  5C3I C;  1F66 A;  3B6F A;  2Y2L A;  3H0L C;  1EQZ D;  2Y2J A;  3AZH C;  5B2J B;  5DNM D;  5CPJ A;  3W96 C;  3AZL D;  4QLC A;  3B6G B;  3MGP D;  4H9P B;  1B67 A;  3REH C;  3AV2 C;  1P3O B;  2ARO A;  3W97 C;  3NQJ B;  4Z66 B;  3KUY D;  5GXQ B;  3X1U D;  4G91 B;  3MNN B;  3EPJ A;  2CWE A;  3AV1 C;  4YS3 B;  4XZQ D;  3REH A;  3AZN D;  1P3O D;  5B1M C;  4ZBJ B;  4Z5T B;  4WV4 B;  3REI C;  5GXQ D;  5B40 A;  2CV5 A;  3MVD A;  3AZG B;  3WAA C;  1P3L D;  5F99 B;  3AN2 D;  2VQR A;  5FUG A;  4YS3 D;  2F8N B;  1KX5 B;  2BYM B;  4YM6 A;  5G49 A;  1P3M B;  3W98 B;  3X1T D;  3MGQ B;  3WAA A;  2DF4 C; 
#chains in the Genus database with same CATH homology
 5E5A D;  3VH5 W;  3VH5 A;  4M6B A;  3MGP A;  1R4V A;  3WKJ D;  2F8N D;  1KX4 B;  1KX5 D;  4J8V D;  1P3M D;  1ZLA B;  3W98 D;  3UT9 D;  1KX3 B;  4WNN A;  5B0Y D;  1U35 C;  3EPL A;  2BG1 A;  3MGS B;  1WWI A;  5GT3 B;  3LEL D;  4CAY A;  5B2I C;  1M19 C;  5B31 D;  1TZY C;  4WU9 C;  5AVC B;  2FFF B;  3EPH A;  4H9O B;  3R45 A;  5AVB B;  2F8N H;  4J8X C;  1TAF B;  1U35 A;  1ZLA D;  3V9R B;  3REK A;  3AZE D;  3KXB C;  5JRG B;  3MGS D;  4CSR B;  5GT3 D;  5B2I A;  1TZY A;  1AOI C;  1P3F A;  3AZF B;  5AV8 D;  5AVC D;  1BFM A;  4E44 A;  2BYK B;  3AZJ B;  1HQ3 B;  3LZ1 C;  4J8W D;  1M1A A;  4J8X A;  5AVB D;  1P3G B;  5B32 A;  3WA9 B;  3KXB A;  2Y2H A;  4XUJ B;  5JRG D;  3REL C;  3VH6 A;  2RVQ D;  3B0C W;  4NFT A;  5B0Z C;  5CPK A;  1ID3 C;  1AOI A;  4ZUX B;  1P3P C;  2HIO B;  3AZJ D;  1HQ3 D;  2UWX A;  3B6F B;  3MGR A;  5GSU B;  4WU8 C;  4J8U A;  5DNN C;  4JJN C;  5CPJ B;  1P3G D;  2ZY5 A;  2FJ7 B;  2LY8 A;  5BO0 B;  4QLC B;  4KUD C;  5B32 G;  5B0Z A;  5B1L D;  3A6N B;  4NE6 A;  4WZS B;  3AFA C;  4ZUX D;  5CPI D;  2HIO D;  1F66 D;  2NQB D;  3AZM C;  3C1C A;  3REJ C;  3TU4 C;  4JJN A;  5DNN A;  3AZE A;  4KUD A;  5CPJ D;  4LD9 B;  4X23 C;  3KWQ C;  5CP6 B;  4HGA C;  4DRB A;  2ARO D;  2JCH A;  2JE5 A;  5AV8 A;  3LJA C;  3UTB A;  1W2E A;  3AFA A;  5B40 B;  3O62 C;  2CV5 B;  3MVD B;  3UTA B;  3AZM A;  1P3I C;  3TU4 A;  1BH9 A;  5KDM B;  3LZ0 B;  4X23 A;  3B0D C;  2Y2Q A;  1BH8 B;  4YM6 B;  5G49 B;  4R8P B;  3REH D;  3W97 D;  3LJA A;  3AYW C;  2CV5 D;  1EQZ B;  2RIQ A;  3MGP B;  5B33 A;  5BS7 C;  4YM6 D;  3X1U B;  3AZK A;  3AZI C;  1P3K C;  2G5H C;  2NQB A;  3WAA D;  4CAY B;  1M18 C;  4XZQ B;  3AZN B;  5AV9 A;  3X1V C;  5AV6 C;  3R45 B;  4KHA A;  1P3A C;  5AV5 C;  3AZI A;  3REK B;  1P3K A;  5B24 C;  2ZM5 A;  1P3L B;  3AZH A;  3AN2 B;  1P34 C;  1P3B C;  3W96 A;  1P3F B;  1KU5 A;  2YFW A;  2YFV A;  3C1B C;  3AV2 A;  3W97 A;  5AV6 A;  1M1A B;  1P3A A;  5AV5 A;  5B32 B;  3X1T B;  5AY8 C;  1U35 D;  5BNV A;  3REK D;  5E5A B;  2NZD C;  5B2I D;  1P3B A;  3AV1 A;  5CPK B;  1TZY D;  1P3F D;  3WKJ B;  2DQN C;  2Y2G A;  5B1M A;  4J8V B;  3UT9 B;  3MGR B;  4NE3 A;  5B0Y B;  1M1A D;  4J8X D;  5AY8 A;  4J8U B;  4AWL C;  4H9Q B;  5B32 D;  3REI A;  2PYO C;  2L5A A;  3LEL B;  3KXB D;  1HTA A;  1JFI B;  5GT0 C;  5JA4 B;  5B31 B;  1S32 C;  5CPK D;  1AOI D;  4KGC C;  3WTP C;  1N1J A;  3W99 C;  3C1C B;  3MGR D;  3X1S C;  2PYO A;  4E45 A;  3AZE B;  4J8U D;  2HUE C;  5DNM C;  4DQY B;  5GT0 A;  3AZL C;  3REL D;  1S32 A;  5B0Z D;  3A1K A;  3EG5 B;  3FDD A;  5AV8 B;  3UTB B;  4KGC A;  3KUY C;  4H9N A;  4J8W B;  3W99 A;  1BH9 B;  3X1S A;  3C1C D;  4WU8 D;  4DRA A;  5DNN D;  4JJN D;  4KUD D;  5B2J C;  4EO5 B;  4UUZ A;  1M19 A;  3B6G C;  2XD1 A;  4H9R B;  1P3O C;  4WU9 A;  3B0B A;  4Z66 C;  3UTB D;  3AFA D;  5GXQ C;  2IO5 B;  3AZM D;  3TU4 D;  4G91 C;  3MNN C;  4X23 D;  4G92 B;  5B33 B;  3B6G A;  4YS3 C;  5B1L B;  4H9P A;  3LJA D;  3AZK B;  5CPI B;  4ZBJ C;  3O62 D;  4Z5T C;  3EPK A;  1F66 B;  3LZ1 A;  2NQB B;  1P3I D;  3AZG C;  5F99 C;  3REL A;  5B33 D;  5AV9 B;  2ARO B;  1ID3 A;  1KX5 C;  4KHA B;  1P3M C;  1H3O A;  1P3P A;  3W98 C;  5C3I B;  3AZK D;  4Z5T A;  2ZY3 A;  3MGQ C;  3AZH B;  4WU8 A;  3WTP E;  3AZG A;  5F99 A;  3W96 B;  2YFV B;  3REH B;  3AV2 B;  3W97 B;  5AV9 D;  1KX4 C;  3AL0 C;  5BNV B;  3AZI D;  1ZLA C;  4Z2M H;  3H0M C;  1P3K D;  1KX3 C;  2J8P A;  3IP4 C;  3MGQ A;  3REJ A;  3MGS C;  3AZH D;  5GT3 C;  3AV1 B;  2F2A C;  5FUG B;  2XD5 A;  3W96 D;  3KWQ A;  5B1M B;  5AVC C;  3AV2 D;  3X1V D;  3KFU G;  5AV6 D;  1P3A D;  5AV5 D;  5AVB C;  3O62 A;  3REI B;  5B24 D;  1P3I A;  3WAA B;  4NE5 A;  1P34 D;  5JRG C;  1P3B D;  2RVQ C;  3AV1 D;  5BNX A;  1Q9C A;  3AZF C;  3C1B D;  5B1M D;  3AZJ C;  1HQ3 C;  4H9O A;  4WNN B;  2JSS A;  2Y2N A;  3VH6 T;  5AY8 D;  3REI D;  3AYW A;  1P3G C;  3WA9 C;  4XUJ C;  3AZF A;  5BS7 A;  4H9N B;  4ZUX C;  2BYK A;  2HIO C;  1U35 B;  3B6F C;  2PYO D;  5GSU C;  5CPJ C;  4Z2M G;  2FJ7 C;  3WA9 A;  4UUZ B;  5B2I B;  5GT0 D;  4QLC C;  1M18 A;  1M19 B;  4XUJ A;  1S32 D;  1TZY B;  4WU9 B;  4KGC D;  3A6N C;  3X1V A;  3W99 D;  4J8X B;  3X1S D;  5B24 A;  5GSU A;  3KXB B;  2FJ7 A;  5BO0 A;  1P34 A;  4LD9 C;  2ZY2 A;  1M19 D;  1AOI B;  4WU9 D;  5CP6 C;  3C1B A;  3A6N A;  2Y2K A;  3LZ1 B;  5B40 C;  2CV5 C;  3MVD C;  1T3U A;  3F6T A;  3UTA C;  5BT1 C;  2Y2P A;  3LZ0 C;  5B2J D;  4LD9 A;  3REL B;  2Y2M A;  3B6G D;  2NZD A;  5B0Z B;  1ID3 B;  4YM6 C;  5CP6 A;  4R8P C;  1P3P B;  1H3O B;  4Z66 D;  3LZ1 D;  4WU8 B;  3UTA A;  4JJN B;  5DNN B;  1EQZ C;  3MNN D;  5KDM A;  3LZ0 A;  4KUD B;  2ZY4 A;  3NQU A;  3H0R C;  3MGP C;  1ID3 D;  1BH8 A;  4R8P A;  2G5I C;  3AFA B;  1P3P D;  3WTP A;  4Z5T D;  3X1U C;  3AZM B;  3REJ B;  3TU4 B;  1EQZ A;  3AZG D;  4X23 B;  5DNM A;  5F99 D;  3AZL A;  3KWQ B;  4XZQ C;  4HGA B;  3AZN C;  3LJA B;  1B6W A;  3O62 B;  3KUY A;  3X1U A;  3REK C;  1P3I B;  2Y2O A;  3MGQ D;  3REJ D;  1P3L C;  3AN2 C;  5B2J A;  5BNX B;  4XZQ A;  4WJ3 C;  3A1I A;  3B0D B;  3KWQ D;  1P3F C;  3AZN A;  1P3O A;  1KX4 D;  3NQJ A;  4Z66 A;  1M1A C;  3AYW B;  5GXQ A;  1KX3 D;  5B32 C;  3X1T C;  1P3L A;  3MNN A;  5E5A C;  3AN2 A;  5CPK C;  3P5J B;  4YS3 A;  3WKJ C;  4J8V C;  3AZI B;  3UT9 C;  3MGR C;  1P3K B;  5B0Y C;  2F8N K;  3VH5 T;  3AYW D;  3X1T A;  4J8U C;  1M18 B;  5E5A A;  3LEL C;  3VH6 W;  3KSY A;  5B31 C;  2YFW B;  3AZF D;  3X1V B;  3WKJ A;  5AV6 B;  2F8N A;  1KX5 A;  2BYM A;  1P3A B;  4J8V A;  5AV5 B;  1P3M A;  3W98 A;  3UT9 A;  5B0Y A;  5B24 B;  3C1C C;  1WWS A;  4H9Q A;  3AZE C;  1P34 B;  3WA9 D;  1F1E A;  3LEL A;  1P3B B;  1JFI A;  1M18 D;  2W8S A;  4XUJ D;  5JA4 A;  5B31 A;  3C1B B;  5AV8 C;  3UTB C;  1KX4 A;  4J8W C;  5AY8 B;  3B6F D;  1ZLA A;  1KX3 A;  2F8N G;  1ULY A;  5GSU D;  2FJ7 D;  3MGS A;  2NZD B;  4QLC D;  5GT3 A;  4EO5 C;  5AVC A;  3A6N D;  1N1J B;  4UPK A;  5B31 G;  4J8W A;  1PZR A;  1A7W A;  2IO5 C;  5AVB A;  4AWL B;  2PYO B;  1TAF A;  3V9R A;  3B0C T;  3NQU B;  5GT0 B;  4H9S C;  4LD9 D;  1Z2C B;  5JRG A;  4G92 C;  1S32 B;  2NZD D;  4CSR A;  5B33 C;  4H9R A;  5B1L C;  4KGC B;  5CP6 D;  3WTP B;  5CPI C;  3AZK C;  3W99 B;  3AZJ A;  1HQ3 A;  5B40 D;  2Y2I A;  3X1S B;  1F66 C;  3MVD D;  2NQB C;  3UTA D;  5BT1 D;  1P3G A;  2HUE B;  5DNM B;  3LZ0 D;  3AZL B;  4H9S A;  5AV9 C;  5B1L A;  2ARO C;  4R8P D;  3KUY B;  5CPI A;  4ZUX A;  3WTP D;  2HIO A;  5CHL B;  5C3I C;  1F66 A;  3B6F A;  2Y2L A;  3H0L C;  1EQZ D;  2Y2J A;  3AZH C;  5B2J B;  5DNM D;  5CPJ A;  3W96 C;  3AZL D;  4QLC A;  3B6G B;  3MGP D;  4H9P B;  1B67 A;  3REH C;  3AV2 C;  1P3O B;  2ARO A;  3W97 C;  3NQJ B;  4Z66 B;  3KUY D;  5GXQ B;  3X1U D;  4G91 B;  3MNN B;  3EPJ A;  2CWE A;  3AV1 C;  4YS3 B;  4XZQ D;  3REH A;  3AZN D;  1P3O D;  5B1M C;  4ZBJ B;  4Z5T B;  4WV4 B;  3REI C;  5GXQ D;  5B40 A;  2CV5 A;  3MVD A;  3AZG B;  3WAA C;  1P3L D;  5F99 B;  3AN2 D;  2VQR A;  5FUG A;  4YS3 D;  2F8N B;  1KX5 B;  2BYM B;  4YM6 A;  5G49 A;  1P3M B;  3W98 B;  3X1T D;  3MGQ B;  3WAA A;  2DF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...