5AVCB

Human nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 26
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcB00
4H9PB 5B31C 5B1LA 5BO0B 2AROA 5B31G 2BYMB 4KUDD 1AOIC 3AZNA 3B0DB 3RELA 5B2IC 5B40A 3X1UB 5BT1D 4WU9D 5F99A 1P3GA 3MGSA 1B6WA 5CPJB 5B0ZC 3UTAB 4HGAC 1BFMA 4CSRA 5B31B 3AFAC 1TAFA 5CP6C 2CV5D 2FJ7D 5B33D 3AZGD 2BYMA 4KGCD 2HIOD 5B2JC 1AOIB 3KUYC 1H3OB 5B2IB 4H9OB 4YS3A 3MNNC 3NQUB 4KHAB 1P3KD 3MGPD 1ZLAC 3A6NC 5AY8D 4J8WB 1M19C 3VH6W 5B0ZB 1S32C 4HGAB 3LJAC 5AV6C 3AFAB 3AZJC 5CP6B 5B31A 3VH6T 1P3BB 5GXQD 4H9NA 5B1MA 5B2JB 3X1VC 3KWQA 5DNNC 3KUYB 1AOIA 4QLCC 3MNNB 5B0YD 1EQZD 1H3OA 1KX3D 1ZLAB 5CPKC 3NQUA 5KDMB 1M18C 5E5AD 5CPID 3AV2D 5B24D 3REJD 1HQ3C 4R8PC 3LELC 3REHD 1S32B 3LZ1D 5B0ZA 3UT9C 3LJAB 3W96C 1ULYA 3AZLC 5AV6B 3WTPC 3AZIC 3AZJB 1U35D 3AZMC 1B67A 3WAAC 3AFAA 3C1BD 4X23D 3X1VB 5DNNB 5B1LD 2AROD 4QLCB 5AVCB 3MNNA 5CPKB 3R45B 3AZND 3WKJA 1M18B 1ZLAA 3RELD 5KDMA 5B32C 4ZUXC 3A6NA 1HQ3B 5B32G 5G49B 5B40D 4R8PB 3LELB 1M19A 4NE6A 4G92B 1S32A 3UT9B 3REKC 4JJNC 3AZFC 3X1TC 5F99D 3B0BA 3MGSD 1P3GD 3W96B 3WTPB 4AWLC 3AZIB 3LJAA 3AZMB 4UUZB 3MGRD 5AV6A 3WAAB 4J8VD 1JFIB 3B0CW 4H9RB 1P3OC 4XZQC 4NE5A 5AVBC 4J8UC 4EO5C 1KX4C 3X1VA 5DNNA 1ID3A 5GT0C 4QLCA 3B0CT 4NFTA 3W99C 5CPKA 4Z2MG 5B32B 3WA9C 1F66C 1M18A 4ZUXB 3KSYA 4YS3D 3W98C 4WZSB 1BH9A 3MVDC 1HQ3A 3LELA 3REKB 4JJNB 3AZFB 3X1TB 4Z66C 4AWLB 2F8NG 2RVQD 4H9QB 2BYKB 2LY8A 3W96A 3AZLA 1P3MC 5CPJC 3B6GC 4UUZA 4XZQB 5AVBB 3WTPE 4J8UB 1JFIA 4EO5B 5AV8C 1KX4B 5B31D 3MGQB 5GSUD 2JSSA 1R4VA 5BNVB 5GT0B 5B1MD 3KWQD 3W99B 1P3LC 4Z5TC 3WA9B 1AOID 4CAYB 4DRBA 1F66B 3X1SA 3W98B 1F1EA 1TZYD 2NQBC 5B32A 3MVDB 1P34C 3REIC 2F8NB 5BNXA 4Z66B 4XUJC 4J8WC 3REKA 4JJNA 3AZFA 3X1TA 1P3MB 3AZEC 3W97B 3B6GB 2BYKA 3AV1A 4YM6A 1A7WA 5B0ZD 3LZ0B 5AV8B 4WU8C 2YFWB 1P3PA 4XZQA 1P3OA 3AN2C 3AZHC 4H9PA 1KX4A 3VH5W 5BO0A 1P3BC 5GT0A 4H9SC 1P3IC 1P3LB 4Z5TB 2NQBB 3B6FB 4CAYA 1F66A 1P34B 3REIB 4DRAA 3VH5T 3WKJD 3MVDA 4XUJB 3X1UA 4Z2MH 2F8NA 3A6ND 4Z66A 5JRGD 3AZEB 1M19D 3C1CC 4LD9C 5BS7C 1P3MA 5CPJA 3B6GA 4J8XD 3UTAA 4WU8B 3AN2B 5C3IC 3AZHB 5AV8A 3AZGC 2YFWA 1Q9CA 2L5AA 1P3IB 2PYOD 5DNND 3AYWC 1ID3D 1P3LA 4Z5TA 3MGPC 1M1AD 5B2IA 2NQBA 4H9OA 5AY8C 5AVCC 3REIA 4KHAA 1P3FD 5CPKD 1M18D 4XUJA 3C1CB 4J8WA 4LD9B 1HQ3D 3LELD 4G92C 5AV9C 2CV5B 2FJ7B 1N1JB 3UTBD 5C3IB 5AV5C 3AZLD 4WU8A 3AZGB 5GXQC 3AN2A 3AZHA 5CP6A 1P3BA 3AZKC 1EQZC 4H9SA 1KX3C 3AYWB 1P3IA 5B2JA 1P3KB 3MGPB 3KUYA 5CPIC 5AY8B 3X1SD 3LZ1C 5B32D 3C1CA 4LD9A 5AV9B 5BS7A 5DNMC 3REKD 3X1TD 3AZFD 5AV5B 5GXQB 1N1JA 3AV1D 4YM6D 3AZJA 3AZGA 2AROC 3AZKB 1P3OD 4XZQD 1P3PD 1EQZB 1KX3B 3MGQC 1KX4D 1P3AC 3KXBC 3AZNC 3AYWA 1BH8B 5GT0D 5CPIB 3MGPA 5B24B 5GT3C 4NE3A 5AY8A 5AVCA 1HTAA 3LZ1B 3R45A 1F66D 5F99C 1P3GC 3TU4C 2NZDC 4R8PA 5G49A 5DNMB 1U35B 3X1UD 3MGRC 2F8ND 4WNNB 4J8VC 5AV9A 3UT9A 4M6BA 3V9RB 5AV5A 3WTPA 3AZIA 1P3MD 3W97C 5CPJD 3AZMA 2AROB 3UTAD 3WAAA 3LZ0C 3O62C 4H9RA 3AZKA 1KX5C 1P3AB 2YFVB 3KXBB 1EQZA 3AZNB 1KX3A 4E45A 5GT3B 1BH8A 5B40B 1P3LD 4Z5TD 5B2ID 3LZ1A 2NQBD 3B6FC 5F99B 1P3GB 4ZUXA 3MGSB 3TU4B 2NZDB 3REID 2RVQC 3MGRB 4J8VB 5DNMA 4XUJD 4J8WD 4H9QA 2HUEC 5GSUC 3VH6A 3O62B 4WU8D 4KUDC 1KX5B 5AVBA 4J8UA 5B1MC 3AN2D 3AFAD 3KWQC 3AZHD 5CP6D 3MGQA 1P3AA 2YFVA 3KXBA 5BNVA 1P3BD 4YS3B 1TZYC 5GT3A 1P3ID 5B2JD 3W99A 3KUYD 4G91C 3WA9A 5BT1C 4WU9C 3MNND 3W98A 5CHLB 2NZDA 3TU4A 1ZLAD 1KU5A 3MGRA 4J8VA 2F8NK 2HUEB 3C1CD 4LD9D 1S32D 5GSUB 3W97A 2CV5C 3LZ0A 3LJAD 3O62A 5B33C 4H9NB 2F8NH 5B1MB 2FJ7C 5AV6D 3KWQB 3AZJD 4KGCC 1KX5A 2HIOC 3NQJB 1TZYB 3X1VD 4G91B 3AYWD 1P3KC 3WKJC 4QLCD 4WU9B 4E44A 5JA4B 2CWEA 3B6FA 5AVCD 1P34A 5JRGC 4J8XC 4R8PD 3AZEA 5AV9D 3UT9D 5GSUA 5B33B 3W96D 5AV5D 3WTPD 3AZID 4KGCB 4KUDA 2HIOB 3AZMD 3WAAD 2PYOC 1ID3C 3NQJA 1M1AC 3AZKD 5B0YC 1TZYA 3WKJB 1P3FC 5E5AC 3AV2C 5B24C 3A6NB 4WU9A 5JRGB 1M19B 5JA4A 3REJC 3REHC 4J8XB 4ZUXD 3UTBC 1U35C 5DNMD 4JJND 3C1BC 4X23C 2CV5A 2FJ7A 5B33A 2PYOB 5B1LC 4ZBJC 1ID3B 4KGCA 2HIOA 1M1AB 2IO5C 5B0YB 5AVBD 4J8UD 1P3FB 3MGQD 1P3AD 3KXBD 5E5AB 3AV2B 1P3KA 3X1SC 3RELC 5GT3D 1BH9B 3REJB 3REHB 5B40C 1WWSA 3W99D 5JRGA 5FUGB 3WA9D 3W98D 4WV4B 3UTBB 3MVDD 3MGSC 4J8XA 3AZLB 3TU4D 2NZDD 3AV1C 4YM6C 4Z66D 3C1BB 4X23B 1P3PC 4KUDB 5B1LB 4ZBJB 5GXQA 3B6GD 3W97D 2PYOA 2IO5B 3LZ0D 3O62D 1WWIA 5AV8D 1M1AA 5B0YA 1KX5D 3X1SB 3RELB 1P3FA 3B0DC 5E5AA 4YS3C 3AV2A 5CPIA 5B24A 3VH5A 3REJA 5BNXB 3REHA 5FUGA 3X1UC 3B6FD 1P34D 3AV1B 3UTBA 4YM6B 1U35A 3UTAC 4WNNA 4CSRB 1P3PB 1P3OB 3C1BA 4X23A 3AZED 1TAFB 3V9RA
chains in the Genus database with same CATH superfamily
4H9PB 5B31C 3IP4C 5B1LA 5BO0B 2AROA 5B31G 2BYMB 4KUDD 1AOIC 3AZNA 2XD5A 3B0DB 3RELA 5B2IC 5B40A 3X1UB 5BT1D 4WU9D 5F99A 1P3GA 3MGSA 2Y2OA 1B6WA 5CPJB 5B0ZC 3UTAB 2ZY3A 4HGAC 1BFMA 4CSRA 5B31B 2G5HC 3AFAC 1TAFA 5CP6C 2CV5D 2FJ7D 5B33D 2F2AC 3AZGD 2BYMA 4KGCD 2HIOD 5B2JC 1AOIB 3KUYC 1H3OB 5B2IB 4H9OB 4YS3A 3MNNC 3NQUB 4KHAB 3H0RC 1P3KD 3MGPD 1ZLAC 3A6NC 2XD1A 5AY8D 4J8WB 1M19C 2Y2PA 3VH6W 5B0ZB 1S32C 4HGAB 3LJAC 5AV6C 3AFAB 3AZJC 5CP6B 5B31A 3VH6T 1P3BB 5GXQD 4H9NA 5B1MA 5B2JB 3X1VC 3KWQA 5DNNC 3KUYB 3EPKA 1AOIA 4QLCC 4DQYB 2Y2NA 3MNNB 5B0YD 1EQZD 1H3OA 1KX3D 1ZLAB 5CPKC 3NQUA 5KDMB 1M18C 5E5AD 5CPID 3AV2D 5B24D 3REJD 1HQ3C 4R8PC 3LELC 2BG1A 3REHD 1S32B 3LZ1D 2ZY2A 5B0ZA 3UT9C 3LJAB 3W96C 1ULYA 3AZLC 5AV6B 3WTPC 3AZIC 3AZJB 1U35D 3AZMC 1B67A 2DF4C 3WAAC 3AFAA 3C1BD 4X23D 3X1VB 5DNNB 5B1LD 2AROD 4QLCB 2Y2GA 5AVCB 3MNNA 5CPKB 3R45B 3AZND 3WKJA 1M18B 1ZLAA 3RELD 5KDMA 5B32C 4ZUXC 3A6NA 1HQ3B 5B32G 5G49B 5B40D 4R8PB 3LELB 1M19A 4NE6A 4G92B 2ZY4A 1S32A 3UT9B 3REKC 4JJNC 3AZFC 3X1TC 5F99D 3B0BA 3MGSD 1P3GD 3W96B 3WTPB 4AWLC 3AZIB 3LJAA 3AZMB 4UUZB 3MGRD 5AV6A 3WAAB 4J8VD 1JFIB 3B0CW 4H9RB 1P3OC 4XZQC 4NE5A 5AVBC 4J8UC 4EO5C 1KX4C 3X1VA 5DNNA 1ID3A 5GT0C 4QLCA 3B0CT 4NFTA 3W99C 5CPKA 4Z2MG 5B32B 3WA9C 1F66C 1M18A 4ZUXB 3KSYA 4YS3D 3W98C 4WZSB 1BH9A 3MVDC 1HQ3A 3LELA 3REKB 4JJNB 3AZFB 3X1TB 4Z66C 4AWLB 2F8NG 2RVQD 4H9QB 2BYKB 2LY8A 3W96A 3AZLA 1P3MC 5CPJC 3B6GC 4UUZA 4XZQB 5AVBB 3WTPE 2Y2MA 4J8UB 4EO5B 5AV8C 1JFIA 1KX4B 5B31D 3MGQB 5GSUD 2JSSA 1R4VA 5BNVB 5GT0B 2JE5A 5B1MD 3KWQD 3W99B 1P3LC 4Z5TC 3WA9B 1AOID 4CAYB 4DRBA 1F66B 3X1SA 3EPLA 3W98B 1F1EA 1TZYD 2Y2JA 5B32A 2NQBC 3MVDB 1P34C 3REIC 2F8NB 5BNXA 4Z66B 4XUJC 4J8WC 3REKA 4JJNA 3AZFA 3X1TA 1P3MB 3AZEC 3W97B 3B6GB 2BYKA 3AV1A 4YM6A 1A7WA 5B0ZD 3LZ0B 3P5JB 5AV8B 4WU8C 2YFWB 1P3PA 4XZQA 1P3OA 3AN2C 3AZHC 4H9PA 1KX4A 3VH5W 3FDDA 5BO0A 5GT0A 1P3BC 4H9SC 1P3IC 1P3LB 4Z5TB 2NQBB 3B6FB 4CAYA 1F66A 1P34B 3REIB 3EPHA 4DRAA 3VH5T 3WKJD 3MVDA 3H0LC 4XUJB 3X1UA 4Z2MH 2F8NA 3A6ND 4WJ3C 4Z66A 5JRGD 3AZEB 1M19D 3C1CC 4LD9C 5BS7C 1P3MA 5CPJA 3B6GA 4J8XD 3UTAA 4WU8B 3AN2B 5C3IC 2RIQA 3AZHB 5AV8A 3AZGC 2YFWA 2DQNC 1Q9CA 2L5AA 1P3IB 2PYOD 5DNND 3A1KA 3AYWC 1P3LA 1ID3D 4Z5TA 3MGPC 1M1AD 2Y2KA 5B2IA 2NQBA 4H9OA 5AY8C 5AVCC 3REIA 4KHAA 1P3FD 5CPKD 1M18D 4XUJA 3C1CB 4J8WA 4LD9B 1HQ3D 3LELD 4G92C 3A1IA 5AV9C 2CV5B 2FJ7B 1N1JB 3UTBD 5C3IB 5AV5C 3AZLD 4WU8A 3AZGB 5GXQC 3AN2A 3AZHA 5CP6A 1P3BA 3KFUG 2FFFB 3AZKC 1EQZC 4H9SA 1KX3C 3AYWB 1P3IA 5B2JA 1P3KB 3MGPB 3KUYA 5CPIC 5AY8B 3X1SD 3LZ1C 3EPJA 5B32D 3C1CA 4LD9A 5AV9B 5BS7A 5DNMC 3REKD 3X1TD 3AZFD 5AV5B 4UPKA 2Y2QA 5GXQB 1N1JA 3AV1D 4YM6D 3AZJA 3AZGA 2AROC 2G5IC 3AZKB 1P3OD 4XZQD 1P3PD 1EQZB 1KX3B 3MGQC 1KX4D 1P3AC 3KXBC 3AZNC 3AYWA 1BH8B 5GT0D 5CPIB 3MGPA 5B24B 5GT3C 4NE3A 5AY8A 5AVCA 1HTAA 3LZ1B 3R45A 1F66D 5F99C 1P3GC 3TU4C 2NZDC 4R8PA 5G49A 5DNMB 1U35B 3X1UD 3MGRC 2F8ND 4WNNB 4J8VC 5AV9A 3UT9A 4M6BA 3V9RB 5AV5A 3WTPA 3AZIA 1P3MD 3W97C 5CPJD 3AZMA 2AROB 3UTAD 3WAAA 3LZ0C 3O62C 4H9RA 3AZKA 1KX5C 1P3AB 2YFVB 3KXBB 1EQZA 3AZNB 1KX3A 4E45A 5GT3B 1BH8A 5B40B 1P3LD 4Z5TD 1T3UA 5B2ID 3LZ1A 2NQBD 3B6FC 5F99B 1P3GB 4ZUXA 3MGSB 3TU4B 2NZDB 3REID 2RVQC 3MGRB 4J8VB 5DNMA 4XUJD 3AL0C 1W2EA 4J8WD 4H9QA 2HUEC 5GSUC 3VH6A 3O62B 4WU8D 4KUDC 1KX5B 2UWXA 5AVBA 4J8UA 5B1MC 3AN2D 3AFAD 3KWQC 3AZHD 5CP6D 3MGQA 1P3AA 2YFVA 3KXBA 5BNVA 1P3BD 4YS3B 1TZYC 5GT3A 1P3ID 5B2JD 3W99A 3KUYD 4G91C 3WA9A 5BT1C 4WU9C 3MNND 3W98A 5CHLB 2NZDA 3TU4A 1ZLAD 1KU5A 3MGRA 4J8VA 2F8NK 2HUEB 3C1CD 4LD9D 1S32D 5GSUB 3W97A 1Z2CB 3EG5B 2CV5C 3LZ0A 3LJAD 3O62A 5B33C 4H9NB 2F8NH 5B1MB 2FJ7C 5AV6D 3KWQB 3AZJD 1PZRA 4KGCC 1KX5A 2HIOC 3NQJB 2JCHA 1TZYB 3X1VD 2Y2HA 4G91B 3AYWD 1P3KC 4QLCD 3WKJC 4WU9B 2W8SA 4E44A 2Y2LA 5JA4B 2CWEA 3B6FA 5AVCD 1P34A 5JRGC 4J8XC 4R8PD 3AZEA 5AV9D 3UT9D 5GSUA 5B33B 3W96D 5AV5D 3WTPD 3AZID 4KGCB 4KUDA 2HIOB 3AZMD 3WAAD 2PYOC 1ID3C 3H0MC 3NQJA 1M1AC 3AZKD 5B0YC 1TZYA 3WKJB 1P3FC 5E5AC 3AV2C 5B24C 2Y2IA 3A6NB 4WU9A 2VQRA 5JRGB 1M19B 5JA4A 3REJC 3REHC 4J8XB 4ZUXD 3UTBC 1U35C 5DNMD 4JJND 3C1BC 3F6TA 4X23C 2ZM5A 2CV5A 2FJ7A 5B33A 2J8PA 2PYOB 5B1LC 4ZBJC 1ID3B 4KGCA 2HIOA 1M1AB 2IO5C 5B0YB 5AVBD 4J8UD 1P3FB 3MGQD 1P3AD 3KXBD 5E5AB 3AV2B 1P3KA 3X1SC 3RELC 5GT3D 1BH9B 3REJB 3REHB 5B40C 1WWSA 3W99D 5JRGA 5FUGB 3WA9D 3W98D 4WV4B 3UTBB 3MVDD 3MGSC 4J8XA 3AZLB 3TU4D 2NZDD 3AV1C 2ZY5A 4YM6C 4Z66D 3C1BB 4X23B 1P3PC 4KUDB 5B1LB 4ZBJB 5GXQA 3B6GD 3W97D 2PYOA 2IO5B 3LZ0D 3O62D 1WWIA 5AV8D 1M1AA 5B0YA 1KX5D 3X1SB 3RELB 1P3FA 3B0DC 5E5AA 4YS3C 3AV2A 5CPIA 5B24A 3VH5A 3REJA 5BNXB 3REHA 5FUGA 3X1UC 3B6FD 1P34D 3AV1B 3UTBA 4YM6B 1U35A 3UTAC 4WNNA 4CSRB 1P3PB 1P3OB 3C1BA 4X23A 3AZED 1TAFB 3V9RA
chains in the Genus database with same CATH topology
4H9PB 5B31C 3IP4C 5B1LA 5BO0B 2AROA 5B31G 2BYMB 4KUDD 1AOIC 3AZNA 2XD5A 3B0DB 3RELA 5B2IC 5B40A 3X1UB 5BT1D 4WU9D 5F99A 1P3GA 3MGSA 2Y2OA 1B6WA 5CPJB 5B0ZC 3UTAB 2ZY3A 4HGAC 1BFMA 4CSRA 5B31B 2G5HC 3AFAC 1TAFA 5CP6C 2CV5D 2FJ7D 5B33D 2F2AC 3AZGD 2BYMA 4KGCD 2HIOD 5B2JC 1AOIB 3KUYC 1H3OB 5B2IB 4H9OB 4YS3A 3MNNC 3NQUB 4KHAB 3H0RC 1P3KD 3MGPD 1ZLAC 3A6NC 2XD1A 5AY8D 4J8WB 1M19C 2Y2PA 3VH6W 5B0ZB 1S32C 4HGAB 3LJAC 5AV6C 3AFAB 3AZJC 5CP6B 5B31A 3VH6T 1P3BB 5GXQD 4H9NA 5B1MA 5B2JB 3X1VC 3KWQA 5DNNC 3KUYB 3EPKA 1AOIA 4QLCC 4DQYB 2Y2NA 3MNNB 5B0YD 1EQZD 1H3OA 1KX3D 1ZLAB 5CPKC 3NQUA 5KDMB 1M18C 5E5AD 5CPID 3AV2D 5B24D 3REJD 1HQ3C 4R8PC 3LELC 2BG1A 3REHD 1S32B 3LZ1D 2ZY2A 5B0ZA 3UT9C 3LJAB 3W96C 1ULYA 3AZLC 5AV6B 3WTPC 3AZIC 3AZJB 1U35D 3AZMC 1B67A 2DF4C 3WAAC 3AFAA 3C1BD 4X23D 3X1VB 5DNNB 5B1LD 2AROD 4QLCB 2Y2GA 5AVCB 3MNNA 5CPKB 3R45B 3AZND 3WKJA 1M18B 1ZLAA 3RELD 5KDMA 5B32C 4ZUXC 3A6NA 1HQ3B 5B32G 5G49B 5B40D 4R8PB 3LELB 1M19A 4NE6A 4G92B 2ZY4A 1S32A 3UT9B 3REKC 4JJNC 3AZFC 3X1TC 5F99D 3B0BA 3MGSD 1P3GD 3W96B 3WTPB 4AWLC 3AZIB 3LJAA 3AZMB 4UUZB 3MGRD 5AV6A 3WAAB 4J8VD 1JFIB 3B0CW 4H9RB 1P3OC 4XZQC 4NE5A 5AVBC 4J8UC 4EO5C 1KX4C 3X1VA 5DNNA 1ID3A 5GT0C 4QLCA 3B0CT 4NFTA 3W99C 5CPKA 4Z2MG 5B32B 3WA9C 1F66C 1M18A 4ZUXB 3KSYA 4YS3D 3W98C 4WZSB 1BH9A 3MVDC 1HQ3A 3LELA 3REKB 4JJNB 3AZFB 3X1TB 4Z66C 4AWLB 2F8NG 2RVQD 4H9QB 2BYKB 2LY8A 3W96A 3AZLA 1P3MC 5CPJC 3B6GC 4UUZA 4XZQB 5AVBB 3WTPE 2Y2MA 4J8UB 4EO5B 5AV8C 1JFIA 1KX4B 5B31D 3MGQB 5GSUD 2JSSA 1R4VA 5BNVB 5GT0B 2JE5A 5B1MD 3KWQD 3W99B 1P3LC 4Z5TC 3WA9B 1AOID 4CAYB 4DRBA 1F66B 3X1SA 3EPLA 3W98B 1F1EA 1TZYD 2Y2JA 5B32A 2NQBC 3MVDB 1P34C 3REIC 2F8NB 5BNXA 4Z66B 4XUJC 4J8WC 3REKA 4JJNA 3AZFA 3X1TA 1P3MB 3AZEC 3W97B 3B6GB 2BYKA 3AV1A 4YM6A 1A7WA 5B0ZD 3LZ0B 3P5JB 5AV8B 4WU8C 2YFWB 1P3PA 4XZQA 1P3OA 3AN2C 3AZHC 4H9PA 1KX4A 3VH5W 3FDDA 5BO0A 5GT0A 1P3BC 4H9SC 1P3IC 1P3LB 4Z5TB 2NQBB 3B6FB 4CAYA 1F66A 1P34B 3REIB 3EPHA 4DRAA 3VH5T 3WKJD 3MVDA 3H0LC 4XUJB 3X1UA 4Z2MH 2F8NA 3A6ND 4WJ3C 4Z66A 5JRGD 3AZEB 1M19D 3C1CC 4LD9C 5BS7C 1P3MA 5CPJA 3B6GA 4J8XD 3UTAA 4WU8B 3AN2B 5C3IC 2RIQA 3AZHB 5AV8A 3AZGC 2YFWA 2DQNC 1Q9CA 2L5AA 1P3IB 2PYOD 5DNND 3A1KA 3AYWC 1P3LA 1ID3D 4Z5TA 3MGPC 1M1AD 2Y2KA 5B2IA 2NQBA 4H9OA 5AY8C 5AVCC 3REIA 4KHAA 1P3FD 5CPKD 1M18D 4XUJA 3C1CB 4J8WA 4LD9B 1HQ3D 3LELD 4G92C 3A1IA 5AV9C 2CV5B 2FJ7B 1N1JB 3UTBD 5C3IB 5AV5C 3AZLD 4WU8A 3AZGB 5GXQC 3AN2A 3AZHA 5CP6A 1P3BA 3KFUG 2FFFB 3AZKC 1EQZC 4H9SA 1KX3C 3AYWB 1P3IA 5B2JA 1P3KB 3MGPB 3KUYA 5CPIC 5AY8B 3X1SD 3LZ1C 3EPJA 5B32D 3C1CA 4LD9A 5AV9B 5BS7A 5DNMC 3REKD 3X1TD 3AZFD 5AV5B 4UPKA 2Y2QA 5GXQB 1N1JA 3AV1D 4YM6D 3AZJA 3AZGA 2AROC 2G5IC 3AZKB 1P3OD 4XZQD 1P3PD 1EQZB 1KX3B 3MGQC 1KX4D 1P3AC 3KXBC 3AZNC 3AYWA 1BH8B 5GT0D 5CPIB 3MGPA 5B24B 5GT3C 4NE3A 5AY8A 5AVCA 1HTAA 3LZ1B 3R45A 1F66D 5F99C 1P3GC 3TU4C 2NZDC 4R8PA 5G49A 5DNMB 1U35B 3X1UD 3MGRC 2F8ND 4WNNB 4J8VC 5AV9A 3UT9A 4M6BA 3V9RB 5AV5A 3WTPA 3AZIA 1P3MD 3W97C 5CPJD 3AZMA 2AROB 3UTAD 3WAAA 3LZ0C 3O62C 4H9RA 3AZKA 1KX5C 1P3AB 2YFVB 3KXBB 1EQZA 3AZNB 1KX3A 4E45A 5GT3B 1BH8A 5B40B 1P3LD 4Z5TD 1T3UA 5B2ID 3LZ1A 2NQBD 3B6FC 5F99B 1P3GB 4ZUXA 3MGSB 3TU4B 2NZDB 3REID 2RVQC 3MGRB 4J8VB 5DNMA 4XUJD 3AL0C 1W2EA 4J8WD 4H9QA 2HUEC 5GSUC 3VH6A 3O62B 4WU8D 4KUDC 1KX5B 2UWXA 5AVBA 4J8UA 5B1MC 3AN2D 3AFAD 3KWQC 3AZHD 5CP6D 3MGQA 1P3AA 2YFVA 3KXBA 5BNVA 1P3BD 4YS3B 1TZYC 5GT3A 1P3ID 5B2JD 3W99A 3KUYD 4G91C 3WA9A 5BT1C 4WU9C 3MNND 3W98A 5CHLB 2NZDA 3TU4A 1ZLAD 1KU5A 3MGRA 4J8VA 2F8NK 2HUEB 3C1CD 4LD9D 1S32D 5GSUB 3W97A 1Z2CB 3EG5B 2CV5C 3LZ0A 3LJAD 3O62A 5B33C 4H9NB 2F8NH 5B1MB 2FJ7C 5AV6D 3KWQB 3AZJD 1PZRA 4KGCC 1KX5A 2HIOC 3NQJB 2JCHA 1TZYB 3X1VD 2Y2HA 4G91B 3AYWD 1P3KC 4QLCD 3WKJC 4WU9B 2W8SA 4E44A 2Y2LA 5JA4B 2CWEA 3B6FA 5AVCD 1P34A 5JRGC 4J8XC 4R8PD 3AZEA 5AV9D 3UT9D 5GSUA 5B33B 3W96D 5AV5D 3WTPD 3AZID 4KGCB 4KUDA 2HIOB 3AZMD 3WAAD 2PYOC 1ID3C 3H0MC 3NQJA 1M1AC 3AZKD 5B0YC 1TZYA 3WKJB 1P3FC 5E5AC 3AV2C 5B24C 2Y2IA 3A6NB 4WU9A 2VQRA 5JRGB 1M19B 5JA4A 3REJC 3REHC 4J8XB 4ZUXD 3UTBC 1U35C 5DNMD 4JJND 3C1BC 3F6TA 4X23C 2ZM5A 2CV5A 2FJ7A 5B33A 2J8PA 2PYOB 5B1LC 4ZBJC 1ID3B 4KGCA 2HIOA 1M1AB 2IO5C 5B0YB 5AVBD 4J8UD 1P3FB 3MGQD 1P3AD 3KXBD 5E5AB 3AV2B 1P3KA 3X1SC 3RELC 5GT3D 1BH9B 3REJB 3REHB 5B40C 1WWSA 3W99D 5JRGA 5FUGB 3WA9D 3W98D 4WV4B 3UTBB 3MVDD 3MGSC 4J8XA 3AZLB 3TU4D 2NZDD 3AV1C 2ZY5A 4YM6C 4Z66D 3C1BB 4X23B 1P3PC 4KUDB 5B1LB 4ZBJB 5GXQA 3B6GD 3W97D 2PYOA 2IO5B 3LZ0D 3O62D 1WWIA 5AV8D 1M1AA 5B0YA 1KX5D 3X1SB 3RELB 1P3FA 3B0DC 5E5AA 4YS3C 3AV2A 5CPIA 5B24A 3VH5A 3REJA 5BNXB 3REHA 5FUGA 3X1UC 3B6FD 1P34D 3AV1B 3UTBA 4YM6B 1U35A 3UTAC 4WNNA 4CSRB 1P3PB 1P3OB 3C1BA 4X23A 3AZED 1TAFB 3V9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P B;  5B31 C;  5B1L A;  5BO0 B;  2ARO A;  5B31 G;  2BYM B;  4KUD D;  1AOI C;  3AZN A;  3B0D B;  3REL A;  5B2I C;  5B40 A;  3X1U B;  5BT1 D;  4WU9 D;  5F99 A;  1P3G A;  3MGS A;  1B6W A;  5CPJ B;  5B0Z C;  3UTA B;  4HGA C;  1BFM A;  4CSR A;  5B31 B;  3AFA C;  1TAF A;  5CP6 C;  2CV5 D;  2FJ7 D;  5B33 D;  3AZG D;  2BYM A;  4KGC D;  2HIO D;  5B2J C;  1AOI B;  3KUY C;  1H3O B;  5B2I B;  4H9O B;  4YS3 A;  3MNN C;  3NQU B;  4KHA B;  1P3K D;  3MGP D;  1ZLA C;  3A6N C;  5AY8 D;  4J8W B;  1M19 C;  3VH6 W;  5B0Z B;  1S32 C;  4HGA B;  3LJA C;  5AV6 C;  3AFA B;  3AZJ C;  5CP6 B;  5B31 A;  3VH6 T;  1P3B B;  5GXQ D;  4H9N A;  5B1M A;  5B2J B;  3X1V C;  3KWQ A;  5DNN C;  3KUY B;  1AOI A;  4QLC C;  3MNN B;  5B0Y D;  1EQZ D;  1H3O A;  1KX3 D;  1ZLA B;  5CPK C;  3NQU A;  5KDM B;  1M18 C;  5E5A D;  5CPI D;  3AV2 D;  5B24 D;  3REJ D;  1HQ3 C;  4R8P C;  3LEL C;  3REH D;  1S32 B;  3LZ1 D;  5B0Z A;  3UT9 C;  3LJA B;  3W96 C;  1ULY A;  3AZL C;  5AV6 B;  3WTP C;  3AZI C;  3AZJ B;  1U35 D;  3AZM C;  1B67 A;  3WAA C;  3AFA A;  3C1B D;  4X23 D;  3X1V B;  5DNN B;  5B1L D;  2ARO D;  4QLC B;  5AVC B;  3MNN A;  5CPK B;  3R45 B;  3AZN D;  3WKJ A;  1M18 B;  1ZLA A;  3REL D;  5KDM A;  5B32 C;  4ZUX C;  3A6N A;  1HQ3 B;  5B32 G;  5G49 B;  5B40 D;  4R8P B;  3LEL B;  1M19 A;  4NE6 A;  4G92 B;  1S32 A;  3UT9 B;  3REK C;  4JJN C;  3AZF C;  3X1T C;  5F99 D;  3B0B A;  3MGS D;  1P3G D;  3W96 B;  3WTP B;  4AWL C;  3AZI B;  3LJA A;  3AZM B;  4UUZ B;  3MGR D;  5AV6 A;  3WAA B;  4J8V D;  1JFI B;  3B0C W;  4H9R B;  1P3O C;  4XZQ C;  4NE5 A;  5AVB C;  4J8U C;  4EO5 C;  1KX4 C;  3X1V A;  5DNN A;  1ID3 A;  5GT0 C;  4QLC A;  3B0C T;  4NFT A;  3W99 C;  5CPK A;  4Z2M G;  5B32 B;  3WA9 C;  1F66 C;  1M18 A;  4ZUX B;  3KSY A;  4YS3 D;  3W98 C;  4WZS B;  1BH9 A;  3MVD C;  1HQ3 A;  3LEL A;  3REK B;  4JJN B;  3AZF B;  3X1T B;  4Z66 C;  4AWL B;  2F8N G;  2RVQ D;  4H9Q B;  2BYK B;  2LY8 A;  3W96 A;  3AZL A;  1P3M C;  5CPJ C;  3B6G C;  4UUZ A;  4XZQ B;  5AVB B;  3WTP E;  4J8U B;  1JFI A;  4EO5 B;  5AV8 C;  1KX4 B;  5B31 D;  3MGQ B;  5GSU D;  2JSS A;  1R4V A;  5BNV B;  5GT0 B;  5B1M D;  3KWQ D;  3W99 B;  1P3L C;  4Z5T C;  3WA9 B;  1AOI D;  4CAY B;  4DRB A;  1F66 B;  3X1S A;  3W98 B;  1F1E A;  1TZY D;  2NQB C;  5B32 A;  3MVD B;  1P34 C;  3REI C;  2F8N B;  5BNX A;  4Z66 B;  4XUJ C;  4J8W C;  3REK A;  4JJN A;  3AZF A;  3X1T A;  1P3M B;  3AZE C;  3W97 B;  3B6G B;  2BYK A;  3AV1 A;  4YM6 A;  1A7W A;  5B0Z D;  3LZ0 B;  5AV8 B;  4WU8 C;  2YFW B;  1P3P A;  4XZQ A;  1P3O A;  3AN2 C;  3AZH C;  4H9P A;  1KX4 A;  3VH5 W;  5BO0 A;  1P3B C;  5GT0 A;  4H9S C;  1P3I C;  1P3L B;  4Z5T B;  2NQB B;  3B6F B;  4CAY A;  1F66 A;  1P34 B;  3REI B;  4DRA A;  3VH5 T;  3WKJ D;  3MVD A;  4XUJ B;  3X1U A;  4Z2M H;  2F8N A;  3A6N D;  4Z66 A;  5JRG D;  3AZE B;  1M19 D;  3C1C C;  4LD9 C;  5BS7 C;  1P3M A;  5CPJ A;  3B6G A;  4J8X D;  3UTA A;  4WU8 B;  3AN2 B;  5C3I C;  3AZH B;  5AV8 A;  3AZG C;  2YFW A;  1Q9C A;  2L5A A;  1P3I B;  2PYO D;  5DNN D;  3AYW C;  1ID3 D;  1P3L A;  4Z5T A;  3MGP C;  1M1A D;  5B2I A;  2NQB A;  4H9O A;  5AY8 C;  5AVC C;  3REI A;  4KHA A;  1P3F D;  5CPK D;  1M18 D;  4XUJ A;  3C1C B;  4J8W A;  4LD9 B;  1HQ3 D;  3LEL D;  4G92 C;  5AV9 C;  2CV5 B;  2FJ7 B;  1N1J B;  3UTB D;  5C3I B;  5AV5 C;  3AZL D;  4WU8 A;  3AZG B;  5GXQ C;  3AN2 A;  3AZH A;  5CP6 A;  1P3B A;  3AZK C;  1EQZ C;  4H9S A;  1KX3 C;  3AYW B;  1P3I A;  5B2J A;  1P3K B;  3MGP B;  3KUY A;  5CPI C;  5AY8 B;  3X1S D;  3LZ1 C;  5B32 D;  3C1C A;  4LD9 A;  5AV9 B;  5BS7 A;  5DNM C;  3REK D;  3X1T D;  3AZF D;  5AV5 B;  5GXQ B;  1N1J A;  3AV1 D;  4YM6 D;  3AZJ A;  3AZG A;  2ARO C;  3AZK B;  1P3O D;  4XZQ D;  1P3P D;  1EQZ B;  1KX3 B;  3MGQ C;  1KX4 D;  1P3A C;  3KXB C;  3AZN C;  3AYW A;  1BH8 B;  5GT0 D;  5CPI B;  3MGP A;  5B24 B;  5GT3 C;  4NE3 A;  5AY8 A;  5AVC A;  1HTA A;  3LZ1 B;  3R45 A;  1F66 D;  5F99 C;  1P3G C;  3TU4 C;  2NZD C;  4R8P A;  5G49 A;  5DNM B;  1U35 B;  3X1U D;  3MGR C;  2F8N D;  4WNN B;  4J8V C;  5AV9 A;  3UT9 A;  4M6B A;  3V9R B;  5AV5 A;  3WTP A;  3AZI A;  1P3M D;  3W97 C;  5CPJ D;  3AZM A;  2ARO B;  3UTA D;  3WAA A;  3LZ0 C;  3O62 C;  4H9R A;  3AZK A;  1KX5 C;  1P3A B;  2YFV B;  3KXB B;  1EQZ A;  3AZN B;  1KX3 A;  4E45 A;  5GT3 B;  1BH8 A;  5B40 B;  1P3L D;  4Z5T D;  5B2I D;  3LZ1 A;  2NQB D;  3B6F C;  5F99 B;  1P3G B;  4ZUX A;  3MGS B;  3TU4 B;  2NZD B;  3REI D;  2RVQ C;  3MGR B;  4J8V B;  5DNM A;  4XUJ D;  4J8W D;  4H9Q A;  2HUE C;  5GSU C;  3VH6 A;  3O62 B;  4WU8 D;  4KUD C;  1KX5 B;  5AVB A;  4J8U A;  5B1M C;  3AN2 D;  3AFA D;  3KWQ C;  3AZH D;  5CP6 D;  3MGQ A;  1P3A A;  2YFV A;  3KXB A;  5BNV A;  1P3B D;  4YS3 B;  1TZY C;  5GT3 A;  1P3I D;  5B2J D;  3W99 A;  3KUY D;  4G91 C;  3WA9 A;  5BT1 C;  4WU9 C;  3MNN D;  3W98 A;  5CHL B;  2NZD A;  3TU4 A;  1ZLA D;  1KU5 A;  3MGR A;  4J8V A;  2F8N K;  2HUE B;  3C1C D;  4LD9 D;  1S32 D;  5GSU B;  3W97 A;  2CV5 C;  3LZ0 A;  3LJA D;  3O62 A;  5B33 C;  4H9N B;  2F8N H;  5B1M B;  2FJ7 C;  5AV6 D;  3KWQ B;  3AZJ D;  4KGC C;  1KX5 A;  2HIO C;  3NQJ B;  1TZY B;  3X1V D;  4G91 B;  3AYW D;  1P3K C;  3WKJ C;  4QLC D;  4WU9 B;  4E44 A;  5JA4 B;  2CWE A;  3B6F A;  5AVC D;  1P34 A;  5JRG C;  4J8X C;  4R8P D;  3AZE A;  5AV9 D;  3UT9 D;  5GSU A;  5B33 B;  3W96 D;  5AV5 D;  3WTP D;  3AZI D;  4KGC B;  4KUD A;  2HIO B;  3AZM D;  3WAA D;  2PYO C;  1ID3 C;  3NQJ A;  1M1A C;  3AZK D;  5B0Y C;  1TZY A;  3WKJ B;  1P3F C;  5E5A C;  3AV2 C;  5B24 C;  3A6N B;  4WU9 A;  5JRG B;  1M19 B;  5JA4 A;  3REJ C;  3REH C;  4J8X B;  4ZUX D;  3UTB C;  1U35 C;  5DNM D;  4JJN D;  3C1B C;  4X23 C;  2CV5 A;  2FJ7 A;  5B33 A;  2PYO B;  5B1L C;  4ZBJ C;  1ID3 B;  4KGC A;  2HIO A;  1M1A B;  2IO5 C;  5B0Y B;  5AVB D;  4J8U D;  1P3F B;  3MGQ D;  1P3A D;  3KXB D;  5E5A B;  3AV2 B;  1P3K A;  3X1S C;  3REL C;  5GT3 D;  1BH9 B;  3REJ B;  3REH B;  5B40 C;  1WWS A;  3W99 D;  5JRG A;  5FUG B;  3WA9 D;  3W98 D;  4WV4 B;  3UTB B;  3MVD D;  3MGS C;  4J8X A;  3AZL B;  3TU4 D;  2NZD D;  3AV1 C;  4YM6 C;  4Z66 D;  3C1B B;  4X23 B;  1P3P C;  4KUD B;  5B1L B;  4ZBJ B;  5GXQ A;  3B6G D;  3W97 D;  2PYO A;  2IO5 B;  3LZ0 D;  3O62 D;  1WWI A;  5AV8 D;  1M1A A;  5B0Y A;  1KX5 D;  3X1S B;  3REL B;  1P3F A;  3B0D C;  5E5A A;  4YS3 C;  3AV2 A;  5CPI A;  5B24 A;  3VH5 A;  3REJ A;  5BNX B;  3REH A;  5FUG A;  3X1U C;  3B6F D;  1P34 D;  3AV1 B;  3UTB A;  4YM6 B;  1U35 A;  3UTA C;  4WNN A;  4CSR B;  1P3P B;  1P3O B;  3C1B A;  4X23 A;  3AZE D;  1TAF B;  3V9R A; 
#chains in the Genus database with same CATH topology
 4H9P B;  5B31 C;  3IP4 C;  5B1L A;  5BO0 B;  2ARO A;  5B31 G;  2BYM B;  4KUD D;  1AOI C;  3AZN A;  2XD5 A;  3B0D B;  3REL A;  5B2I C;  5B40 A;  3X1U B;  5BT1 D;  4WU9 D;  5F99 A;  1P3G A;  3MGS A;  2Y2O A;  1B6W A;  5CPJ B;  5B0Z C;  3UTA B;  2ZY3 A;  4HGA C;  1BFM A;  4CSR A;  5B31 B;  2G5H C;  3AFA C;  1TAF A;  5CP6 C;  2CV5 D;  2FJ7 D;  5B33 D;  2F2A C;  3AZG D;  2BYM A;  4KGC D;  2HIO D;  5B2J C;  1AOI B;  3KUY C;  1H3O B;  5B2I B;  4H9O B;  4YS3 A;  3MNN C;  3NQU B;  4KHA B;  3H0R C;  1P3K D;  3MGP D;  1ZLA C;  3A6N C;  2XD1 A;  5AY8 D;  4J8W B;  1M19 C;  2Y2P A;  3VH6 W;  5B0Z B;  1S32 C;  4HGA B;  3LJA C;  5AV6 C;  3AFA B;  3AZJ C;  5CP6 B;  5B31 A;  3VH6 T;  1P3B B;  5GXQ D;  4H9N A;  5B1M A;  5B2J B;  3X1V C;  3KWQ A;  5DNN C;  3KUY B;  3EPK A;  1AOI A;  4QLC C;  4DQY B;  2Y2N A;  3MNN B;  5B0Y D;  1EQZ D;  1H3O A;  1KX3 D;  1ZLA B;  5CPK C;  3NQU A;  5KDM B;  1M18 C;  5E5A D;  5CPI D;  3AV2 D;  5B24 D;  3REJ D;  1HQ3 C;  4R8P C;  3LEL C;  2BG1 A;  3REH D;  1S32 B;  3LZ1 D;  2ZY2 A;  5B0Z A;  3UT9 C;  3LJA B;  3W96 C;  1ULY A;  3AZL C;  5AV6 B;  3WTP C;  3AZI C;  3AZJ B;  1U35 D;  3AZM C;  1B67 A;  2DF4 C;  3WAA C;  3AFA A;  3C1B D;  4X23 D;  3X1V B;  5DNN B;  5B1L D;  2ARO D;  4QLC B;  2Y2G A;  5AVC B;  3MNN A;  5CPK B;  3R45 B;  3AZN D;  3WKJ A;  1M18 B;  1ZLA A;  3REL D;  5KDM A;  5B32 C;  4ZUX C;  3A6N A;  1HQ3 B;  5B32 G;  5G49 B;  5B40 D;  4R8P B;  3LEL B;  1M19 A;  4NE6 A;  4G92 B;  2ZY4 A;  1S32 A;  3UT9 B;  3REK C;  4JJN C;  3AZF C;  3X1T C;  5F99 D;  3B0B A;  3MGS D;  1P3G D;  3W96 B;  3WTP B;  4AWL C;  3AZI B;  3LJA A;  3AZM B;  4UUZ B;  3MGR D;  5AV6 A;  3WAA B;  4J8V D;  1JFI B;  3B0C W;  4H9R B;  1P3O C;  4XZQ C;  4NE5 A;  5AVB C;  4J8U C;  4EO5 C;  1KX4 C;  3X1V A;  5DNN A;  1ID3 A;  5GT0 C;  4QLC A;  3B0C T;  4NFT A;  3W99 C;  5CPK A;  4Z2M G;  5B32 B;  3WA9 C;  1F66 C;  1M18 A;  4ZUX B;  3KSY A;  4YS3 D;  3W98 C;  4WZS B;  1BH9 A;  3MVD C;  1HQ3 A;  3LEL A;  3REK B;  4JJN B;  3AZF B;  3X1T B;  4Z66 C;  4AWL B;  2F8N G;  2RVQ D;  4H9Q B;  2BYK B;  2LY8 A;  3W96 A;  3AZL A;  1P3M C;  5CPJ C;  3B6G C;  4UUZ A;  4XZQ B;  5AVB B;  3WTP E;  2Y2M A;  4J8U B;  4EO5 B;  5AV8 C;  1JFI A;  1KX4 B;  5B31 D;  3MGQ B;  5GSU D;  2JSS A;  1R4V A;  5BNV B;  5GT0 B;  2JE5 A;  5B1M D;  3KWQ D;  3W99 B;  1P3L C;  4Z5T C;  3WA9 B;  1AOI D;  4CAY B;  4DRB A;  1F66 B;  3X1S A;  3EPL A;  3W98 B;  1F1E A;  1TZY D;  2Y2J A;  5B32 A;  2NQB C;  3MVD B;  1P34 C;  3REI C;  2F8N B;  5BNX A;  4Z66 B;  4XUJ C;  4J8W C;  3REK A;  4JJN A;  3AZF A;  3X1T A;  1P3M B;  3AZE C;  3W97 B;  3B6G B;  2BYK A;  3AV1 A;  4YM6 A;  1A7W A;  5B0Z D;  3LZ0 B;  3P5J B;  5AV8 B;  4WU8 C;  2YFW B;  1P3P A;  4XZQ A;  1P3O A;  3AN2 C;  3AZH C;  4H9P A;  1KX4 A;  3VH5 W;  3FDD A;  5BO0 A;  5GT0 A;  1P3B C;  4H9S C;  1P3I C;  1P3L B;  4Z5T B;  2NQB B;  3B6F B;  4CAY A;  1F66 A;  1P34 B;  3REI B;  3EPH A;  4DRA A;  3VH5 T;  3WKJ D;  3MVD A;  3H0L C;  4XUJ B;  3X1U A;  4Z2M H;  2F8N A;  3A6N D;  4WJ3 C;  4Z66 A;  5JRG D;  3AZE B;  1M19 D;  3C1C C;  4LD9 C;  5BS7 C;  1P3M A;  5CPJ A;  3B6G A;  4J8X D;  3UTA A;  4WU8 B;  3AN2 B;  5C3I C;  2RIQ A;  3AZH B;  5AV8 A;  3AZG C;  2YFW A;  2DQN C;  1Q9C A;  2L5A A;  1P3I B;  2PYO D;  5DNN D;  3A1K A;  3AYW C;  1P3L A;  1ID3 D;  4Z5T A;  3MGP C;  1M1A D;  2Y2K A;  5B2I A;  2NQB A;  4H9O A;  5AY8 C;  5AVC C;  3REI A;  4KHA A;  1P3F D;  5CPK D;  1M18 D;  4XUJ A;  3C1C B;  4J8W A;  4LD9 B;  1HQ3 D;  3LEL D;  4G92 C;  3A1I A;  5AV9 C;  2CV5 B;  2FJ7 B;  1N1J B;  3UTB D;  5C3I B;  5AV5 C;  3AZL D;  4WU8 A;  3AZG B;  5GXQ C;  3AN2 A;  3AZH A;  5CP6 A;  1P3B A;  3KFU G;  2FFF B;  3AZK C;  1EQZ C;  4H9S A;  1KX3 C;  3AYW B;  1P3I A;  5B2J A;  1P3K B;  3MGP B;  3KUY A;  5CPI C;  5AY8 B;  3X1S D;  3LZ1 C;  3EPJ A;  5B32 D;  3C1C A;  4LD9 A;  5AV9 B;  5BS7 A;  5DNM C;  3REK D;  3X1T D;  3AZF D;  5AV5 B;  4UPK A;  2Y2Q A;  5GXQ B;  1N1J A;  3AV1 D;  4YM6 D;  3AZJ A;  3AZG A;  2ARO C;  2G5I C;  3AZK B;  1P3O D;  4XZQ D;  1P3P D;  1EQZ B;  1KX3 B;  3MGQ C;  1KX4 D;  1P3A C;  3KXB C;  3AZN C;  3AYW A;  1BH8 B;  5GT0 D;  5CPI B;  3MGP A;  5B24 B;  5GT3 C;  4NE3 A;  5AY8 A;  5AVC A;  1HTA A;  3LZ1 B;  3R45 A;  1F66 D;  5F99 C;  1P3G C;  3TU4 C;  2NZD C;  4R8P A;  5G49 A;  5DNM B;  1U35 B;  3X1U D;  3MGR C;  2F8N D;  4WNN B;  4J8V C;  5AV9 A;  3UT9 A;  4M6B A;  3V9R B;  5AV5 A;  3WTP A;  3AZI A;  1P3M D;  3W97 C;  5CPJ D;  3AZM A;  2ARO B;  3UTA D;  3WAA A;  3LZ0 C;  3O62 C;  4H9R A;  3AZK A;  1KX5 C;  1P3A B;  2YFV B;  3KXB B;  1EQZ A;  3AZN B;  1KX3 A;  4E45 A;  5GT3 B;  1BH8 A;  5B40 B;  1P3L D;  4Z5T D;  1T3U A;  5B2I D;  3LZ1 A;  2NQB D;  3B6F C;  5F99 B;  1P3G B;  4ZUX A;  3MGS B;  3TU4 B;  2NZD B;  3REI D;  2RVQ C;  3MGR B;  4J8V B;  5DNM A;  4XUJ D;  3AL0 C;  1W2E A;  4J8W D;  4H9Q A;  2HUE C;  5GSU C;  3VH6 A;  3O62 B;  4WU8 D;  4KUD C;  1KX5 B;  2UWX A;  5AVB A;  4J8U A;  5B1M C;  3AN2 D;  3AFA D;  3KWQ C;  3AZH D;  5CP6 D;  3MGQ A;  1P3A A;  2YFV A;  3KXB A;  5BNV A;  1P3B D;  4YS3 B;  1TZY C;  5GT3 A;  1P3I D;  5B2J D;  3W99 A;  3KUY D;  4G91 C;  3WA9 A;  5BT1 C;  4WU9 C;  3MNN D;  3W98 A;  5CHL B;  2NZD A;  3TU4 A;  1ZLA D;  1KU5 A;  3MGR A;  4J8V A;  2F8N K;  2HUE B;  3C1C D;  4LD9 D;  1S32 D;  5GSU B;  3W97 A;  1Z2C B;  3EG5 B;  2CV5 C;  3LZ0 A;  3LJA D;  3O62 A;  5B33 C;  4H9N B;  2F8N H;  5B1M B;  2FJ7 C;  5AV6 D;  3KWQ B;  3AZJ D;  1PZR A;  4KGC C;  1KX5 A;  2HIO C;  3NQJ B;  2JCH A;  1TZY B;  3X1V D;  2Y2H A;  4G91 B;  3AYW D;  1P3K C;  4QLC D;  3WKJ C;  4WU9 B;  2W8S A;  4E44 A;  2Y2L A;  5JA4 B;  2CWE A;  3B6F A;  5AVC D;  1P34 A;  5JRG C;  4J8X C;  4R8P D;  3AZE A;  5AV9 D;  3UT9 D;  5GSU A;  5B33 B;  3W96 D;  5AV5 D;  3WTP D;  3AZI D;  4KGC B;  4KUD A;  2HIO B;  3AZM D;  3WAA D;  2PYO C;  1ID3 C;  3H0M C;  3NQJ A;  1M1A C;  3AZK D;  5B0Y C;  1TZY A;  3WKJ B;  1P3F C;  5E5A C;  3AV2 C;  5B24 C;  2Y2I A;  3A6N B;  4WU9 A;  2VQR A;  5JRG B;  1M19 B;  5JA4 A;  3REJ C;  3REH C;  4J8X B;  4ZUX D;  3UTB C;  1U35 C;  5DNM D;  4JJN D;  3C1B C;  3F6T A;  4X23 C;  2ZM5 A;  2CV5 A;  2FJ7 A;  5B33 A;  2J8P A;  2PYO B;  5B1L C;  4ZBJ C;  1ID3 B;  4KGC A;  2HIO A;  1M1A B;  2IO5 C;  5B0Y B;  5AVB D;  4J8U D;  1P3F B;  3MGQ D;  1P3A D;  3KXB D;  5E5A B;  3AV2 B;  1P3K A;  3X1S C;  3REL C;  5GT3 D;  1BH9 B;  3REJ B;  3REH B;  5B40 C;  1WWS A;  3W99 D;  5JRG A;  5FUG B;  3WA9 D;  3W98 D;  4WV4 B;  3UTB B;  3MVD D;  3MGS C;  4J8X A;  3AZL B;  3TU4 D;  2NZD D;  3AV1 C;  2ZY5 A;  4YM6 C;  4Z66 D;  3C1B B;  4X23 B;  1P3P C;  4KUD B;  5B1L B;  4ZBJ B;  5GXQ A;  3B6G D;  3W97 D;  2PYO A;  2IO5 B;  3LZ0 D;  3O62 D;  1WWI A;  5AV8 D;  1M1A A;  5B0Y A;  1KX5 D;  3X1S B;  3REL B;  1P3F A;  3B0D C;  5E5A A;  4YS3 C;  3AV2 A;  5CPI A;  5B24 A;  3VH5 A;  3REJ A;  5BNX B;  3REH A;  5FUG A;  3X1U C;  3B6F D;  1P34 D;  3AV1 B;  3UTB A;  4YM6 B;  1U35 A;  3UTA C;  4WNN A;  4CSR B;  1P3P B;  1P3O B;  3C1B A;  4X23 A;  3AZE D;  1TAF B;  3V9R A; 
#chains in the Genus database with same CATH homology
 4H9P B;  5B31 C;  3IP4 C;  5B1L A;  5BO0 B;  2ARO A;  5B31 G;  2BYM B;  4KUD D;  1AOI C;  3AZN A;  2XD5 A;  3B0D B;  3REL A;  5B2I C;  5B40 A;  3X1U B;  5BT1 D;  4WU9 D;  5F99 A;  1P3G A;  3MGS A;  2Y2O A;  1B6W A;  5CPJ B;  5B0Z C;  3UTA B;  2ZY3 A;  4HGA C;  1BFM A;  4CSR A;  5B31 B;  2G5H C;  3AFA C;  1TAF A;  5CP6 C;  2CV5 D;  2FJ7 D;  5B33 D;  2F2A C;  3AZG D;  2BYM A;  4KGC D;  2HIO D;  5B2J C;  1AOI B;  3KUY C;  1H3O B;  5B2I B;  4H9O B;  4YS3 A;  3MNN C;  3NQU B;  4KHA B;  3H0R C;  1P3K D;  3MGP D;  1ZLA C;  3A6N C;  2XD1 A;  5AY8 D;  4J8W B;  1M19 C;  2Y2P A;  3VH6 W;  5B0Z B;  1S32 C;  4HGA B;  3LJA C;  5AV6 C;  3AFA B;  3AZJ C;  5CP6 B;  5B31 A;  3VH6 T;  1P3B B;  5GXQ D;  4H9N A;  5B1M A;  5B2J B;  3X1V C;  3KWQ A;  5DNN C;  3KUY B;  3EPK A;  1AOI A;  4QLC C;  4DQY B;  2Y2N A;  3MNN B;  5B0Y D;  1EQZ D;  1H3O A;  1KX3 D;  1ZLA B;  5CPK C;  3NQU A;  5KDM B;  1M18 C;  5E5A D;  5CPI D;  3AV2 D;  5B24 D;  3REJ D;  1HQ3 C;  4R8P C;  3LEL C;  2BG1 A;  3REH D;  1S32 B;  3LZ1 D;  2ZY2 A;  5B0Z A;  3UT9 C;  3LJA B;  3W96 C;  1ULY A;  3AZL C;  5AV6 B;  3WTP C;  3AZI C;  3AZJ B;  1U35 D;  3AZM C;  1B67 A;  2DF4 C;  3WAA C;  3AFA A;  3C1B D;  4X23 D;  3X1V B;  5DNN B;  5B1L D;  2ARO D;  4QLC B;  2Y2G A;  5AVC B;  3MNN A;  5CPK B;  3R45 B;  3AZN D;  3WKJ A;  1M18 B;  1ZLA A;  3REL D;  5KDM A;  5B32 C;  4ZUX C;  3A6N A;  1HQ3 B;  5B32 G;  5G49 B;  5B40 D;  4R8P B;  3LEL B;  1M19 A;  4NE6 A;  4G92 B;  2ZY4 A;  1S32 A;  3UT9 B;  3REK C;  4JJN C;  3AZF C;  3X1T C;  5F99 D;  3B0B A;  3MGS D;  1P3G D;  3W96 B;  3WTP B;  4AWL C;  3AZI B;  3LJA A;  3AZM B;  4UUZ B;  3MGR D;  5AV6 A;  3WAA B;  4J8V D;  1JFI B;  3B0C W;  4H9R B;  1P3O C;  4XZQ C;  4NE5 A;  5AVB C;  4J8U C;  4EO5 C;  1KX4 C;  3X1V A;  5DNN A;  1ID3 A;  5GT0 C;  4QLC A;  3B0C T;  4NFT A;  3W99 C;  5CPK A;  4Z2M G;  5B32 B;  3WA9 C;  1F66 C;  1M18 A;  4ZUX B;  3KSY A;  4YS3 D;  3W98 C;  4WZS B;  1BH9 A;  3MVD C;  1HQ3 A;  3LEL A;  3REK B;  4JJN B;  3AZF B;  3X1T B;  4Z66 C;  4AWL B;  2F8N G;  2RVQ D;  4H9Q B;  2BYK B;  2LY8 A;  3W96 A;  3AZL A;  1P3M C;  5CPJ C;  3B6G C;  4UUZ A;  4XZQ B;  5AVB B;  3WTP E;  2Y2M A;  4J8U B;  4EO5 B;  5AV8 C;  1JFI A;  1KX4 B;  5B31 D;  3MGQ B;  5GSU D;  2JSS A;  1R4V A;  5BNV B;  5GT0 B;  2JE5 A;  5B1M D;  3KWQ D;  3W99 B;  1P3L C;  4Z5T C;  3WA9 B;  1AOI D;  4CAY B;  4DRB A;  1F66 B;  3X1S A;  3EPL A;  3W98 B;  1F1E A;  1TZY D;  2Y2J A;  5B32 A;  2NQB C;  3MVD B;  1P34 C;  3REI C;  2F8N B;  5BNX A;  4Z66 B;  4XUJ C;  4J8W C;  3REK A;  4JJN A;  3AZF A;  3X1T A;  1P3M B;  3AZE C;  3W97 B;  3B6G B;  2BYK A;  3AV1 A;  4YM6 A;  1A7W A;  5B0Z D;  3LZ0 B;  3P5J B;  5AV8 B;  4WU8 C;  2YFW B;  1P3P A;  4XZQ A;  1P3O A;  3AN2 C;  3AZH C;  4H9P A;  1KX4 A;  3VH5 W;  3FDD A;  5BO0 A;  5GT0 A;  1P3B C;  4H9S C;  1P3I C;  1P3L B;  4Z5T B;  2NQB B;  3B6F B;  4CAY A;  1F66 A;  1P34 B;  3REI B;  3EPH A;  4DRA A;  3VH5 T;  3WKJ D;  3MVD A;  3H0L C;  4XUJ B;  3X1U A;  4Z2M H;  2F8N A;  3A6N D;  4WJ3 C;  4Z66 A;  5JRG D;  3AZE B;  1M19 D;  3C1C C;  4LD9 C;  5BS7 C;  1P3M A;  5CPJ A;  3B6G A;  4J8X D;  3UTA A;  4WU8 B;  3AN2 B;  5C3I C;  2RIQ A;  3AZH B;  5AV8 A;  3AZG C;  2YFW A;  2DQN C;  1Q9C A;  2L5A A;  1P3I B;  2PYO D;  5DNN D;  3A1K A;  3AYW C;  1P3L A;  1ID3 D;  4Z5T A;  3MGP C;  1M1A D;  2Y2K A;  5B2I A;  2NQB A;  4H9O A;  5AY8 C;  5AVC C;  3REI A;  4KHA A;  1P3F D;  5CPK D;  1M18 D;  4XUJ A;  3C1C B;  4J8W A;  4LD9 B;  1HQ3 D;  3LEL D;  4G92 C;  3A1I A;  5AV9 C;  2CV5 B;  2FJ7 B;  1N1J B;  3UTB D;  5C3I B;  5AV5 C;  3AZL D;  4WU8 A;  3AZG B;  5GXQ C;  3AN2 A;  3AZH A;  5CP6 A;  1P3B A;  3KFU G;  2FFF B;  3AZK C;  1EQZ C;  4H9S A;  1KX3 C;  3AYW B;  1P3I A;  5B2J A;  1P3K B;  3MGP B;  3KUY A;  5CPI C;  5AY8 B;  3X1S D;  3LZ1 C;  3EPJ A;  5B32 D;  3C1C A;  4LD9 A;  5AV9 B;  5BS7 A;  5DNM C;  3REK D;  3X1T D;  3AZF D;  5AV5 B;  4UPK A;  2Y2Q A;  5GXQ B;  1N1J A;  3AV1 D;  4YM6 D;  3AZJ A;  3AZG A;  2ARO C;  2G5I C;  3AZK B;  1P3O D;  4XZQ D;  1P3P D;  1EQZ B;  1KX3 B;  3MGQ C;  1KX4 D;  1P3A C;  3KXB C;  3AZN C;  3AYW A;  1BH8 B;  5GT0 D;  5CPI B;  3MGP A;  5B24 B;  5GT3 C;  4NE3 A;  5AY8 A;  5AVC A;  1HTA A;  3LZ1 B;  3R45 A;  1F66 D;  5F99 C;  1P3G C;  3TU4 C;  2NZD C;  4R8P A;  5G49 A;  5DNM B;  1U35 B;  3X1U D;  3MGR C;  2F8N D;  4WNN B;  4J8V C;  5AV9 A;  3UT9 A;  4M6B A;  3V9R B;  5AV5 A;  3WTP A;  3AZI A;  1P3M D;  3W97 C;  5CPJ D;  3AZM A;  2ARO B;  3UTA D;  3WAA A;  3LZ0 C;  3O62 C;  4H9R A;  3AZK A;  1KX5 C;  1P3A B;  2YFV B;  3KXB B;  1EQZ A;  3AZN B;  1KX3 A;  4E45 A;  5GT3 B;  1BH8 A;  5B40 B;  1P3L D;  4Z5T D;  1T3U A;  5B2I D;  3LZ1 A;  2NQB D;  3B6F C;  5F99 B;  1P3G B;  4ZUX A;  3MGS B;  3TU4 B;  2NZD B;  3REI D;  2RVQ C;  3MGR B;  4J8V B;  5DNM A;  4XUJ D;  3AL0 C;  1W2E A;  4J8W D;  4H9Q A;  2HUE C;  5GSU C;  3VH6 A;  3O62 B;  4WU8 D;  4KUD C;  1KX5 B;  2UWX A;  5AVB A;  4J8U A;  5B1M C;  3AN2 D;  3AFA D;  3KWQ C;  3AZH D;  5CP6 D;  3MGQ A;  1P3A A;  2YFV A;  3KXB A;  5BNV A;  1P3B D;  4YS3 B;  1TZY C;  5GT3 A;  1P3I D;  5B2J D;  3W99 A;  3KUY D;  4G91 C;  3WA9 A;  5BT1 C;  4WU9 C;  3MNN D;  3W98 A;  5CHL B;  2NZD A;  3TU4 A;  1ZLA D;  1KU5 A;  3MGR A;  4J8V A;  2F8N K;  2HUE B;  3C1C D;  4LD9 D;  1S32 D;  5GSU B;  3W97 A;  1Z2C B;  3EG5 B;  2CV5 C;  3LZ0 A;  3LJA D;  3O62 A;  5B33 C;  4H9N B;  2F8N H;  5B1M B;  2FJ7 C;  5AV6 D;  3KWQ B;  3AZJ D;  1PZR A;  4KGC C;  1KX5 A;  2HIO C;  3NQJ B;  2JCH A;  1TZY B;  3X1V D;  2Y2H A;  4G91 B;  3AYW D;  1P3K C;  4QLC D;  3WKJ C;  4WU9 B;  2W8S A;  4E44 A;  2Y2L A;  5JA4 B;  2CWE A;  3B6F A;  5AVC D;  1P34 A;  5JRG C;  4J8X C;  4R8P D;  3AZE A;  5AV9 D;  3UT9 D;  5GSU A;  5B33 B;  3W96 D;  5AV5 D;  3WTP D;  3AZI D;  4KGC B;  4KUD A;  2HIO B;  3AZM D;  3WAA D;  2PYO C;  1ID3 C;  3H0M C;  3NQJ A;  1M1A C;  3AZK D;  5B0Y C;  1TZY A;  3WKJ B;  1P3F C;  5E5A C;  3AV2 C;  5B24 C;  2Y2I A;  3A6N B;  4WU9 A;  2VQR A;  5JRG B;  1M19 B;  5JA4 A;  3REJ C;  3REH C;  4J8X B;  4ZUX D;  3UTB C;  1U35 C;  5DNM D;  4JJN D;  3C1B C;  3F6T A;  4X23 C;  2ZM5 A;  2CV5 A;  2FJ7 A;  5B33 A;  2J8P A;  2PYO B;  5B1L C;  4ZBJ C;  1ID3 B;  4KGC A;  2HIO A;  1M1A B;  2IO5 C;  5B0Y B;  5AVB D;  4J8U D;  1P3F B;  3MGQ D;  1P3A D;  3KXB D;  5E5A B;  3AV2 B;  1P3K A;  3X1S C;  3REL C;  5GT3 D;  1BH9 B;  3REJ B;  3REH B;  5B40 C;  1WWS A;  3W99 D;  5JRG A;  5FUG B;  3WA9 D;  3W98 D;  4WV4 B;  3UTB B;  3MVD D;  3MGS C;  4J8X A;  3AZL B;  3TU4 D;  2NZD D;  3AV1 C;  2ZY5 A;  4YM6 C;  4Z66 D;  3C1B B;  4X23 B;  1P3P C;  4KUD B;  5B1L B;  4ZBJ B;  5GXQ A;  3B6G D;  3W97 D;  2PYO A;  2IO5 B;  3LZ0 D;  3O62 D;  1WWI A;  5AV8 D;  1M1A A;  5B0Y A;  1KX5 D;  3X1S B;  3REL B;  1P3F A;  3B0D C;  5E5A A;  4YS3 C;  3AV2 A;  5CPI A;  5B24 A;  3VH5 A;  3REJ A;  5BNX B;  3REH A;  5FUG A;  3X1U C;  3B6F D;  1P34 D;  3AV1 B;  3UTB A;  4YM6 B;  1U35 A;  3UTA C;  4WNN A;  4CSR B;  1P3P B;  1P3O B;  3C1B A;  4X23 A;  3AZE D;  1TAF B;  3V9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...