3AV2D

The human nucleosome structure containing the histone variant h3.3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2D00
3MGQC 5B1LD 4Z5TB 2HUEB 5AVCA 1P3FB 5B33D 1A7WA 4QLCD 5B40C 1M19C 1EQZB 3KXBA 4J8UB 5F99B 3O62B 3X1UD 4CAYA 3WA9C 5JA4A 3AZMC 5B31A 3AZKC 5B1MC 2FJ7A 3AZHC 2PYOC 4H9QB 3LZ1A 3B0DC 5BNVB 4NE6A 3AYWC 4R8PA 4H9SA 3W99A 5DNND 1U35B 3AZGA 5CPJA 3AZFD 2F8NG 2AROA 4LD9C 4KGCB 3X1VA 1P34B 3W97A 3MGPD 1P3PD 1H3OA 4Z66B 2IO5B 3R45B 5AV9C 3MGSA 2HIOB 2NQBA 3VH5T 2CWEA 3MGRD 5B24B 4ZBJC 3RELC 1P3GA 1P3OB 1KX5A 3NQUB 1KX3B 4J8VB 1ZLAB 5BO0A 3AZJD 4AWLB 3REJA 4M6BA 3AZED 4G91B 4KUDA 5B0YA 4WU8D 3TU4B 3C1BD 3UTBD 3A6NB 1KU5A 1P3MA 5CP6D 1M1AD 3W96B 5GT0A 5GT3A 1P3IA 3UT9A 4X23B 3LJAC 3WTPD 4UUZA 5AVBC 4WU9A 3W98A 1P3LC 3B6FB 5JRGB 5DNMA 1S32D 3AZIC 5B32D 3AZFA 3AV1B 3REHB 3REIB 3C1CD 3WKJD 5AY8C 4WNNA 5GXQA 4NE3A 4YS3D 4H9NA 3X1SA 1TZYC 2NZDD 1KX4A 3KSYA 3REKC 2BYMA 4Z5TC 2HUEC 3WA9B 1EQZC 3AZKB 1P3BD 4JJNB 3LZ0B 3AZHB 5F99C 2PYOB 4XUJA 3O62C 4J8WD 3B6GB 5AV8C 3MGQA 2JSSA 5B40A 4YM6D 1M19A 5B2JB 3AZLC 3MNNB 4LD9B 1P3AD 5B32A 5GSUD 4ZUXC 5E5AC 3UTAA 3AZMA 1U35C 5BT1C 5B1MA 1M18D 5B2IA 5AVCD 4Z66C 3KXBD 3AYWA 2F8NH 3WAAA 5C3IB 5FUGA 1HQ3B 3VH6W 4E44A 2CV5B 1P3KB 5B31D 1F66B 1BH9A 1ZLAC 2FJ7D 5B0ZA 3V9RA 4AWLC 1P3LB 2F8NB 3LZ1D 4G91C 3AN2A 3AZIB 4YM6A 4XZQB 3RELA 4Z2MG 4J8XA 1P3AA 4R8PD 3W99D 3AZNA 5CPJD 3AZGD 5CPIB 2AROD 1TZYB 3X1VD 3W97D 3REIC 3X1TA 3REKB 3MGSD 3KUYB 1ID3B 1P3PC 3LELB 2NQBD 3LJAA 1P3GD 5AVBA 1KX5D 5CPKB 4HGAC 5AV8B 5AV5A 3KWQA 3REJD 1AOID 4KUDD 5B0YD 3LZ0C 4JJNC 3AZEC 5AY8A 1P3MD 3AZLB 3C1BC 5GT0D 5GT3D 3UTBC 1P3ID 5KDMB 3UT9D 3B6GC 4WU9D 3W98D 4ZUXB 5E5AB 4H9RB 4H9OB 4Z5TA 5DNMD 1P3FA 5BS7A 1EQZA 4J8UA 5B2JC 5AV6B 3MNNC 3O62A 4NE5A 5B1LB 3MVDD 1TAFA 5GXQD 3WKJC 5B33B 4QLCB 3X1SD 4YS3C 1KX4D 2NZDC 3B0BA 4H9QA 3X1UB 3VH5W 2LY8A 3AV2D 2RVQD 5BNVA 1AOIA 1P3BC 4XUJD 5C3IC 1HQ3C 1U35A 3AFAD 3MGQD 2CV5C 1P3KC 4KGCA 1F66C 1P34A 5B40D 4Z66A 1M19D 3R45A 2HIOA 5DNNB 3AZFB 4XZQC 5B24A 3MGPB 1P3PB 2YFVB 1P3OA 3MVDA 3NQUA 3UTAD 3AZMD 1N1JB 3NQJB 1KX3A 4J8VA 5B1MD 5CPIC 1ZLAA 3WTPE 5B2ID 1M18C 3MGRB 4Z2MH 3TU4A 3A6NA 5AVCC 4HGAB 5G49B 3KUYC 1ID3C 3W96A 3AYWD 3LELC 4E45A 3AV2A 3AZJB 4X23A 3AZEB 3WAAD 3B6FA 4WU8B 5JRGA 3C1BB 3UTBB 4CSRB 5CP6B 5CPKC 1M1AB 3AFAA 3AV1A 5B0ZD 3REHA 3REIA 3WTPB 5AV9D 4H9PB 4KHAB 5BNXA 3AN2D 3LZ1C 1BH8A 1S32B 3RELD 5B32B 4J8XD 3C1CB 3WKJB 2BYKB 3AZND 4DRAA 3WA9A 3AZGC 4YS3B 5CPJC 3AZKA 2AROC 3B0CT 4JJNA 3LZ0A 5AV6C 2NZDB 3AZHA 3X1TD 3X1VC 2PYOA 4G92B 3W97C 5B1LC 3B0CW 3LJAD 3B6GA 4WV4B 5B33C 4QLCC 5AVBD 1P3BB 1JFIB 4J8WB 1KX5C 5B2JA 3X1UC 5AV5D 3KWQD 4LD9A 3REJC 5AY8D 5AV9A 4YM6B 1P3MC 1BFMA 1P3AB 2YFWB 5GSUB 3UT9C 4Z5TD 1P3FD 1EQZD 5DNMC 4J8UD 5F99D 5DNNC 1M18B 3AZFC 3O62D 5B32G 1HQ3A 5AVCB 3MGPC 3KXBB 1P3KA 3AV1C 1P3LA 2F8NA 1KX4C 4CAYB 3MGRC 1R4VA 3AZIA 5JA4B 4XZQA 5B31B 2FJ7B 3AZJC 4XUJC 3LZ1B 1U35D 5BT1D 5CPIA 4WU8C 1TZYA 4KGCD 5CP6C 1P34D 1M1AC 4Z66D 3REKA 4R8PB 3WTPC 3W99B 3KUYA 4WZSB 1ID3A 2HIOD 3LELA 3AZGB 5CPJB 2AROB 1S32C 5F99A 5B24D 3X1VB 5B32C 3W97B 1H3OB 1P3OD 1TAFB 3C1CC 3MGSB 1WWIA 5CPKA 1KX3D 4J8VD 1ZLAD 3UTAC 5AV8A 2NQBB 1P3GB 5B2IC 3TU4D 3A6ND 4G92C 1KX5B 3AZLA 3W96D 5BO0B 5KDMA 4X23D 3REJB 1AOIB 4KUDB 3WAAC 5B0YB 4ZUXA 5JRGD 5E5AA 3B6FD 4H9RA 4H9OA 1P3MB 1F1EA 4J8WC 5GT0B 5GT3B 3AV1D 5AV6A 3REHD 1P3IB 3REID 3UT9B 4UUZB 5B0ZC 4WU9B 3W98B 5B1LA 4EO5B 5B31G 5DNMB 5B33A 3AN2C 4QLCA 4YM6C 4J8XC 1P3AC 5GSUC 3X1UA 4WNNB 3MVDB 5GXQB 3WA9D 3AZNC 4H9NB 3AZKD 3X1SB 4JJND 3LZ0D 3AZHD 2PYOD 1KX4B 1B67A 3X1TC 2BYMB 3B6GD 3AV2B 3KXBC 4XUJB 5B2JD 5DNNA 3MNND 4LD9D 3AFAB 5AV5C 3KWQC 3MGQB 5B31C 3VH6A 5BNXB 2FJ7C 3MGPA 1P3PA 2YFVA 5B40B 1M19B 1BH8B 1N1JA 3NQJA 3MGRA 4R8PC 1WWSA 4H9SC 3W99C 5G49A 3UTAB 3AZMB 5BS7C 1P3FC 5B1MB 4J8UC 3AZJA 5B2IB 3AZEA 4DRBA 3B0DB 1HQ3D 4NFTA 4WU8A 3C1BA 3UTBA 3MGSC 2CV5D 1P3KD 4CSRA 5CP6A 1M1AA 1F66D 3AYWB 1ULYA 2NQBC 3WAAB 1P3LD 2F8ND 3WTPA 1P3GC 5FUGB 4H9PA 4KHAA 3AZID 1S32A 4XZQD 3MNNA 1BH9B 5B0ZB 3V9RB 1AOIC 3C1CA 3WKJA 5AV9B 2BYKA 4KUDC 5B0YC 3AN2B 5CPID 1TZYD 2F8NK 2L5AA 3RELB 4YS3A 4ZBJB 5GT0C 5GT3C 4J8XB 1P3IC 2NZDA 4KGCC 3REKD 1P34C 3KUYD 1ID3D 3AZNB 4WU9C 1Q9CA 3LELD 2IO5C 4EO5C 3W98C 2HIOC 3VH6T 1P3BA 1JFIA 5B24C 1HTAA 3X1TB 1B6WA 4J8WA 5CPKD 1P3OC 3MVDC 5AV8D 5GXQC 3LJAB 2CV5A 4J8VC 1KX3C 1F66A 3X1SC 5AVBB 3TU4C 3AZLD 3A6NC 5AV5B 3KWQB 3W96C 3AV2C 2YFWA 2RVQC 5GSUA 4X23C 3VH5A 4ZUXD 5CHLB 5E5AD 5AY8B 3B6FC 5JRGC 5AV6D 1M18A 3AFAC 3REHC
chains in the Genus database with same CATH superfamily
3MGQC 5B1LD 4Z5TB 2HUEB 5AVCA 1P3FB 5B33D 1A7WA 2VQRA 4QLCD 5B40C 1M19C 1EQZB 3KXBA 4J8UB 5F99B 3O62B 3X1UD 4CAYA 3WA9C 5JA4A 3AZMC 5B31A 3AZKC 5B1MC 2FJ7A 3AZHC 2PYOC 4H9QB 3LZ1A 3B0DC 3A1KA 5BNVB 4NE6A 3AYWC 4R8PA 2FFFB 4H9SA 3W99A 5DNND 1U35B 3AZGA 5CPJA 3AZFD 2F8NG 2AROA 4LD9C 4KGCB 3X1VA 1P34B 3W97A 3MGPD 1P3PD 1H3OA 4Z66B 2IO5B 3R45B 5AV9C 3MGSA 2HIOB 2NQBA 3VH5T 2CWEA 3MGRD 5B24B 4ZBJC 3RELC 1P3GA 1P3OB 1KX5A 3NQUB 1KX3B 4J8VB 1ZLAB 5BO0A 3AZJD 4AWLB 3REJA 4M6BA 3AZED 4G91B 4KUDA 5B0YA 2BG1A 3TU4B 3C1BD 3UTBD 3A6NB 4WU8D 2ZY4A 1KU5A 1P3MA 5CP6D 1M1AD 3W96B 5GT0A 5GT3A 1P3IA 3UT9A 4X23B 3LJAC 3WTPD 4UUZA 5AVBC 4WU9A 2DQNC 3W98A 1P3LC 3B6FB 5JRGB 5DNMA 2G5HC 2JCHA 1S32D 3AZIC 5B32D 3AZFA 3AV1B 3REHB 3REIB 3C1CD 3WKJD 5AY8C 4WNNA 5GXQA 1T3UA 4NE3A 4YS3D 4H9NA 3X1SA 1TZYC 2NZDD 1KX4A 3KSYA 3REKC 2BYMA 4Z5TC 2HUEC 3WA9B 1EQZC 3AZKB 1P3BD 4JJNB 3LZ0B 3H0LC 5F99C 3AZHB 2PYOB 4XUJA 2ZY3A 3O62C 4J8WD 3B6GB 5AV8C 3MGQA 2JSSA 3IP4C 3AL0C 5B40A 4YM6D 1M19A 2UWXA 5B2JB 3AZLC 3MNNB 4LD9B 1P3AD 2Y2JA 5GSUD 5B32A 3EPJA 4ZUXC 3F6TA 5E5AC 3UTAA 3AZMA 1PZRA 1U35C 5BT1C 5B1MA 1M18D 5B2IA 5AVCD 4Z66C 3KXBD 3AYWA 2F8NH 2ZY5A 3WAAA 5C3IB 5FUGA 1HQ3B 3VH6W 4E44A 2CV5B 1P3KB 5B31D 1F66B 1BH9A 1ZLAC 2FJ7D 5B0ZA 3V9RA 4AWLC 1P3LB 2F8NB 3LZ1D 4G91C 4DQYB 3AN2A 3AZIB 4YM6A 4XZQB 2Y2HA 4Z2MG 3RELA 4J8XA 1P3AA 4R8PD 3W99D 2Y2LA 3AZNA 5CPJD 3AZGD 5CPIB 2AROD 2Y2KA 1TZYB 3EPKA 3X1VD 3W97D 3REIC 3X1TA 3REKB 3MGSD 3KUYB 1ID3B 1P3PC 3LELB 2NQBD 3LJAA 1P3GD 5AVBA 2RIQA 1KX5D 5CPKB 4HGAC 5AV8B 5AV5A 3KWQA 3REJD 1AOID 4KUDD 5B0YD 3LZ0C 4JJNC 3AZEC 5AY8A 3EPLA 1P3MD 2Y2OA 3AZLB 3C1BC 5GT0D 5GT3D 3UTBC 1P3ID 2XD1A 5KDMB 3UT9D 3B6GC 4WU9D 3W98D 4ZUXB 5E5AB 4H9RB 4H9OB 4Z5TA 5DNMD 1P3FA 5BS7A 1EQZA 4J8UA 5B2JC 5AV6B 3MNNC 3O62A 4NE5A 5B1LB 3MVDD 1TAFA 5GXQD 3WKJC 5B33B 4QLCB 3X1SD 4YS3C 1KX4D 2NZDC 3B0BA 4H9QA 3X1UB 2Y2QA 3VH5W 2LY8A 3AV2D 2RVQD 3EG5B 5BNVA 1AOIA 1P3BC 4XUJD 4WJ3C 5C3IC 2Y2IA 1HQ3C 1U35A 3AFAD 3MGQD 2CV5C 1P3KC 4KGCA 1F66C 1P34A 5B40D 4Z66A 1M19D 3R45A 2HIOA 5DNNB 3AZFB 4XZQC 5B24A 3MGPB 1P3PB 2YFVB 1P3OA 3MVDA 3NQUA 1Z2CB 3UTAD 1N1JB 3AZMD 3NQJB 1KX3A 4J8VA 5B1MD 5CPIC 1ZLAA 2DF4C 3WTPE 5B2ID 1M18C 3MGRB 4Z2MH 3TU4A 3A6NA 5AVCC 4HGAB 5G49B 3KUYC 1ID3C 3W96A 3AYWD 3LELC 4E45A 3AV2A 3AZJB 4X23A 3AZEB 3WAAD 3B6FA 4WU8B 5JRGA 3C1BB 3UTBB 4CSRB 5CP6B 5CPKC 1M1AB 3AFAA 3AV1A 5B0ZD 3REHA 3REIA 2XD5A 3WTPB 5AV9D 4H9PB 4KHAB 5BNXA 3AN2D 2Y2MA 3LZ1C 1BH8A 1S32B 3RELD 5B32B 4J8XD 3C1CB 3WKJB 2BYKB 3AZND 4DRAA 3WA9A 3AZGC 4YS3B 5CPJC 3AZKA 2AROC 3B0CT 4JJNA 3LZ0A 5AV6C 2NZDB 3AZHA 3X1TD 3X1VC 2PYOA 4UPKA 4G92B 3W97C 5B1LC 3B0CW 3LJAD 3B6GA 4WV4B 5B33C 4QLCC 5AVBD 1P3BB 1JFIB 4J8WB 1KX5C 5B2JA 3X1UC 5AV5D 3KWQD 4LD9A 3FDDA 3REJC 5AY8D 5AV9A 4YM6B 1P3MC 1BFMA 1P3AB 2YFWB 5GSUB 3UT9C 4Z5TD 1P3FD 1EQZD 5DNMC 4J8UD 5F99D 5DNNC 1M18B 3AZFC 3O62D 5B32G 1HQ3A 5AVCB 3MGPC 3KXBB 1P3KA 3AV1C 1P3LA 2F8NA 1KX4C 4CAYB 3MGRC 2Y2NA 1R4VA 3AZIA 5JA4B 4XZQA 5B31B 2FJ7B 3AZJC 4XUJC 3LZ1B 1U35D 5BT1D 5CPIA 4WU8C 1TZYA 3KFUG 4KGCD 5CP6C 1P34D 1M1AC 4Z66D 3REKA 4R8PB 3WTPC 3W99B 3KUYA 4WZSB 1ID3A 2HIOD 3LELA 3AZGB 5CPJB 2AROB 1S32C 5F99A 5B24D 3X1VB 5B32C 3W97B 2ZY2A 1H3OB 1P3OD 1TAFB 3C1CC 3MGSB 1WWIA 5CPKA 1KX3D 4J8VD 1ZLAD 3UTAC 5AV8A 2NQBB 3P5JB 1P3GB 5B2IC 3TU4D 3A6ND 4G92C 1KX5B 3AZLA 3W96D 5BO0B 2Y2PA 5KDMA 4X23D 3REJB 1AOIB 2G5IC 4KUDB 3WAAC 5B0YB 4ZUXA 5JRGD 5E5AA 3B6FD 4H9RA 4H9OA 1P3MB 1F1EA 4J8WC 5GT0B 5GT3B 3AV1D 5AV6A 3REHD 1P3IB 3REID 3UT9B 2ZM5A 4UUZB 5B0ZC 4WU9B 3W98B 5B1LA 4EO5B 5B31G 5DNMB 5B33A 3AN2C 4QLCA 4YM6C 4J8XC 1P3AC 5GSUC 3X1UA 4WNNB 3MVDB 5GXQB 3WA9D 3AZNC 4H9NB 3AZKD 3X1SB 4JJND 3LZ0D 3AZHD 2PYOD 1KX4B 2J8PA 1B67A 3X1TC 2BYMB 3B6GD 3AV2B 3KXBC 4XUJB 3H0MC 5B2JD 5DNNA 3MNND 4LD9D 3AFAB 5AV5C 3KWQC 3MGQB 5B31C 3VH6A 5BNXB 2FJ7C 3MGPA 1P3PA 2YFVA 5B40B 1M19B 1BH8B 3EPHA 1N1JA 3NQJA 2F2AC 3MGRA 4R8PC 1WWSA 4H9SC 3W99C 5G49A 3UTAB 3AZMB 5BS7C 1P3FC 5B1MB 4J8UC 3AZJA 5B2IB 3AZEA 4DRBA 1HQ3D 3B0DB 2JE5A 4NFTA 4WU8A 3C1BA 3UTBA 3MGSC 2CV5D 1P3KD 4CSRA 5CP6A 1M1AA 1F66D 3AYWB 1ULYA 2NQBC 3WAAB 1P3LD 2F8ND 3WTPA 1P3GC 5FUGB 4H9PA 4KHAA 3AZID 1S32A 4XZQD 3MNNA 1BH9B 3H0RC 5B0ZB 3V9RB 1AOIC 3C1CA 3WKJA 5AV9B 2BYKA 4KUDC 3A1IA 2Y2GA 5B0YC 3AN2B 5CPID 1TZYD 2F8NK 2L5AA 3RELB 4YS3A 4ZBJB 5GT0C 5GT3C 4J8XB 1P3IC 2NZDA 4KGCC 3REKD 1P34C 3KUYD 1ID3D 3AZNB 4WU9C 1Q9CA 3LELD 2IO5C 4EO5C 3W98C 2HIOC 3VH6T 1P3BA 1JFIA 5B24C 1HTAA 3X1TB 1B6WA 4J8WA 2W8SA 5CPKD 1P3OC 3MVDC 5AV8D 5GXQC 3LJAB 2CV5A 4J8VC 1KX3C 1F66A 3X1SC 5AVBB 3TU4C 3AZLD 3A6NC 5AV5B 3KWQB 3W96C 3AV2C 1W2EA 2YFWA 2RVQC 5GSUA 4X23C 3VH5A 4ZUXD 5CHLB 5E5AD 5AY8B 3B6FC 5JRGC 5AV6D 1M18A 3AFAC 3REHC
chains in the Genus database with same CATH topology
3MGQC 5B1LD 4Z5TB 2HUEB 5AVCA 1P3FB 5B33D 1A7WA 2VQRA 4QLCD 5B40C 1M19C 1EQZB 3KXBA 4J8UB 5F99B 3O62B 3X1UD 4CAYA 3WA9C 5JA4A 3AZMC 5B31A 3AZKC 5B1MC 2FJ7A 3AZHC 2PYOC 4H9QB 3LZ1A 3B0DC 3A1KA 5BNVB 4NE6A 3AYWC 4R8PA 2FFFB 4H9SA 3W99A 5DNND 1U35B 3AZGA 5CPJA 3AZFD 2F8NG 2AROA 4LD9C 4KGCB 3X1VA 1P34B 3W97A 3MGPD 1P3PD 1H3OA 4Z66B 2IO5B 3R45B 5AV9C 3MGSA 2HIOB 2NQBA 3VH5T 2CWEA 3MGRD 5B24B 4ZBJC 3RELC 1P3GA 1P3OB 1KX5A 3NQUB 1KX3B 4J8VB 1ZLAB 5BO0A 3AZJD 4AWLB 3REJA 4M6BA 3AZED 4G91B 4KUDA 5B0YA 2BG1A 3TU4B 3C1BD 3UTBD 3A6NB 4WU8D 2ZY4A 1KU5A 1P3MA 5CP6D 1M1AD 3W96B 5GT0A 5GT3A 1P3IA 3UT9A 4X23B 3LJAC 3WTPD 4UUZA 5AVBC 4WU9A 2DQNC 3W98A 1P3LC 3B6FB 5JRGB 5DNMA 2G5HC 2JCHA 1S32D 3AZIC 5B32D 3AZFA 3AV1B 3REHB 3REIB 3C1CD 3WKJD 5AY8C 4WNNA 5GXQA 1T3UA 4NE3A 4YS3D 4H9NA 3X1SA 1TZYC 2NZDD 1KX4A 3KSYA 3REKC 2BYMA 4Z5TC 2HUEC 3WA9B 1EQZC 3AZKB 1P3BD 4JJNB 3LZ0B 3H0LC 5F99C 3AZHB 2PYOB 4XUJA 2ZY3A 3O62C 4J8WD 3B6GB 5AV8C 3MGQA 2JSSA 3IP4C 3AL0C 5B40A 4YM6D 1M19A 2UWXA 5B2JB 3AZLC 3MNNB 4LD9B 1P3AD 2Y2JA 5GSUD 5B32A 3EPJA 4ZUXC 3F6TA 5E5AC 3UTAA 3AZMA 1PZRA 1U35C 5BT1C 5B1MA 1M18D 5B2IA 5AVCD 4Z66C 3KXBD 3AYWA 2F8NH 2ZY5A 3WAAA 5C3IB 5FUGA 1HQ3B 3VH6W 4E44A 2CV5B 1P3KB 5B31D 1F66B 1BH9A 1ZLAC 2FJ7D 5B0ZA 3V9RA 4AWLC 1P3LB 2F8NB 3LZ1D 4G91C 4DQYB 3AN2A 3AZIB 4YM6A 4XZQB 2Y2HA 4Z2MG 3RELA 4J8XA 1P3AA 4R8PD 3W99D 2Y2LA 3AZNA 5CPJD 3AZGD 5CPIB 2AROD 2Y2KA 1TZYB 3EPKA 3X1VD 3W97D 3REIC 3X1TA 3REKB 3MGSD 3KUYB 1ID3B 1P3PC 3LELB 2NQBD 3LJAA 1P3GD 5AVBA 2RIQA 1KX5D 5CPKB 4HGAC 5AV8B 5AV5A 3KWQA 3REJD 1AOID 4KUDD 5B0YD 3LZ0C 4JJNC 3AZEC 5AY8A 3EPLA 1P3MD 2Y2OA 3AZLB 3C1BC 5GT0D 5GT3D 3UTBC 1P3ID 2XD1A 5KDMB 3UT9D 3B6GC 4WU9D 3W98D 4ZUXB 5E5AB 4H9RB 4H9OB 4Z5TA 5DNMD 1P3FA 5BS7A 1EQZA 4J8UA 5B2JC 5AV6B 3MNNC 3O62A 4NE5A 5B1LB 3MVDD 1TAFA 5GXQD 3WKJC 5B33B 4QLCB 3X1SD 4YS3C 1KX4D 2NZDC 3B0BA 4H9QA 3X1UB 2Y2QA 3VH5W 2LY8A 3AV2D 2RVQD 3EG5B 5BNVA 1AOIA 1P3BC 4XUJD 4WJ3C 5C3IC 2Y2IA 1HQ3C 1U35A 3AFAD 3MGQD 2CV5C 1P3KC 4KGCA 1F66C 1P34A 5B40D 4Z66A 1M19D 3R45A 2HIOA 5DNNB 3AZFB 4XZQC 5B24A 3MGPB 1P3PB 2YFVB 1P3OA 3MVDA 3NQUA 1Z2CB 3UTAD 1N1JB 3AZMD 3NQJB 1KX3A 4J8VA 5B1MD 5CPIC 1ZLAA 2DF4C 3WTPE 5B2ID 1M18C 3MGRB 4Z2MH 3TU4A 3A6NA 5AVCC 4HGAB 5G49B 3KUYC 1ID3C 3W96A 3AYWD 3LELC 4E45A 3AV2A 3AZJB 4X23A 3AZEB 3WAAD 3B6FA 4WU8B 5JRGA 3C1BB 3UTBB 4CSRB 5CP6B 5CPKC 1M1AB 3AFAA 3AV1A 5B0ZD 3REHA 3REIA 2XD5A 3WTPB 5AV9D 4H9PB 4KHAB 5BNXA 3AN2D 2Y2MA 3LZ1C 1BH8A 1S32B 3RELD 5B32B 4J8XD 3C1CB 3WKJB 2BYKB 3AZND 4DRAA 3WA9A 3AZGC 4YS3B 5CPJC 3AZKA 2AROC 3B0CT 4JJNA 3LZ0A 5AV6C 2NZDB 3AZHA 3X1TD 3X1VC 2PYOA 4UPKA 4G92B 3W97C 5B1LC 3B0CW 3LJAD 3B6GA 4WV4B 5B33C 4QLCC 5AVBD 1P3BB 1JFIB 4J8WB 1KX5C 5B2JA 3X1UC 5AV5D 3KWQD 4LD9A 3FDDA 3REJC 5AY8D 5AV9A 4YM6B 1P3MC 1BFMA 1P3AB 2YFWB 5GSUB 3UT9C 4Z5TD 1P3FD 1EQZD 5DNMC 4J8UD 5F99D 5DNNC 1M18B 3AZFC 3O62D 5B32G 1HQ3A 5AVCB 3MGPC 3KXBB 1P3KA 3AV1C 1P3LA 2F8NA 1KX4C 4CAYB 3MGRC 2Y2NA 1R4VA 3AZIA 5JA4B 4XZQA 5B31B 2FJ7B 3AZJC 4XUJC 3LZ1B 1U35D 5BT1D 5CPIA 4WU8C 1TZYA 3KFUG 4KGCD 5CP6C 1P34D 1M1AC 4Z66D 3REKA 4R8PB 3WTPC 3W99B 3KUYA 4WZSB 1ID3A 2HIOD 3LELA 3AZGB 5CPJB 2AROB 1S32C 5F99A 5B24D 3X1VB 5B32C 3W97B 2ZY2A 1H3OB 1P3OD 1TAFB 3C1CC 3MGSB 1WWIA 5CPKA 1KX3D 4J8VD 1ZLAD 3UTAC 5AV8A 2NQBB 3P5JB 1P3GB 5B2IC 3TU4D 3A6ND 4G92C 1KX5B 3AZLA 3W96D 5BO0B 2Y2PA 5KDMA 4X23D 3REJB 1AOIB 2G5IC 4KUDB 3WAAC 5B0YB 4ZUXA 5JRGD 5E5AA 3B6FD 4H9RA 4H9OA 1P3MB 1F1EA 4J8WC 5GT0B 5GT3B 3AV1D 5AV6A 3REHD 1P3IB 3REID 3UT9B 2ZM5A 4UUZB 5B0ZC 4WU9B 3W98B 5B1LA 4EO5B 5B31G 5DNMB 5B33A 3AN2C 4QLCA 4YM6C 4J8XC 1P3AC 5GSUC 3X1UA 4WNNB 3MVDB 5GXQB 3WA9D 3AZNC 4H9NB 3AZKD 3X1SB 4JJND 3LZ0D 3AZHD 2PYOD 1KX4B 2J8PA 1B67A 3X1TC 2BYMB 3B6GD 3AV2B 3KXBC 4XUJB 3H0MC 5B2JD 5DNNA 3MNND 4LD9D 3AFAB 5AV5C 3KWQC 3MGQB 5B31C 3VH6A 5BNXB 2FJ7C 3MGPA 1P3PA 2YFVA 5B40B 1M19B 1BH8B 3EPHA 1N1JA 3NQJA 2F2AC 3MGRA 4R8PC 1WWSA 4H9SC 3W99C 5G49A 3UTAB 3AZMB 5BS7C 1P3FC 5B1MB 4J8UC 3AZJA 5B2IB 3AZEA 4DRBA 1HQ3D 3B0DB 2JE5A 4NFTA 4WU8A 3C1BA 3UTBA 3MGSC 2CV5D 1P3KD 4CSRA 5CP6A 1M1AA 1F66D 3AYWB 1ULYA 2NQBC 3WAAB 1P3LD 2F8ND 3WTPA 1P3GC 5FUGB 4H9PA 4KHAA 3AZID 1S32A 4XZQD 3MNNA 1BH9B 3H0RC 5B0ZB 3V9RB 1AOIC 3C1CA 3WKJA 5AV9B 2BYKA 4KUDC 3A1IA 2Y2GA 5B0YC 3AN2B 5CPID 1TZYD 2F8NK 2L5AA 3RELB 4YS3A 4ZBJB 5GT0C 5GT3C 4J8XB 1P3IC 2NZDA 4KGCC 3REKD 1P34C 3KUYD 1ID3D 3AZNB 4WU9C 1Q9CA 3LELD 2IO5C 4EO5C 3W98C 2HIOC 3VH6T 1P3BA 1JFIA 5B24C 1HTAA 3X1TB 1B6WA 4J8WA 2W8SA 5CPKD 1P3OC 3MVDC 5AV8D 5GXQC 3LJAB 2CV5A 4J8VC 1KX3C 1F66A 3X1SC 5AVBB 3TU4C 3AZLD 3A6NC 5AV5B 3KWQB 3W96C 3AV2C 1W2EA 2YFWA 2RVQC 5GSUA 4X23C 3VH5A 4ZUXD 5CHLB 5E5AD 5AY8B 3B6FC 5JRGC 5AV6D 1M18A 3AFAC 3REHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ C;  5B1L D;  4Z5T B;  2HUE B;  5AVC A;  1P3F B;  5B33 D;  1A7W A;  4QLC D;  5B40 C;  1M19 C;  1EQZ B;  3KXB A;  4J8U B;  5F99 B;  3O62 B;  3X1U D;  4CAY A;  3WA9 C;  5JA4 A;  3AZM C;  5B31 A;  3AZK C;  5B1M C;  2FJ7 A;  3AZH C;  2PYO C;  4H9Q B;  3LZ1 A;  3B0D C;  5BNV B;  4NE6 A;  3AYW C;  4R8P A;  4H9S A;  3W99 A;  5DNN D;  1U35 B;  3AZG A;  5CPJ A;  3AZF D;  2F8N G;  2ARO A;  4LD9 C;  4KGC B;  3X1V A;  1P34 B;  3W97 A;  3MGP D;  1P3P D;  1H3O A;  4Z66 B;  2IO5 B;  3R45 B;  5AV9 C;  3MGS A;  2HIO B;  2NQB A;  3VH5 T;  2CWE A;  3MGR D;  5B24 B;  4ZBJ C;  3REL C;  1P3G A;  1P3O B;  1KX5 A;  3NQU B;  1KX3 B;  4J8V B;  1ZLA B;  5BO0 A;  3AZJ D;  4AWL B;  3REJ A;  4M6B A;  3AZE D;  4G91 B;  4KUD A;  5B0Y A;  4WU8 D;  3TU4 B;  3C1B D;  3UTB D;  3A6N B;  1KU5 A;  1P3M A;  5CP6 D;  1M1A D;  3W96 B;  5GT0 A;  5GT3 A;  1P3I A;  3UT9 A;  4X23 B;  3LJA C;  3WTP D;  4UUZ A;  5AVB C;  4WU9 A;  3W98 A;  1P3L C;  3B6F B;  5JRG B;  5DNM A;  1S32 D;  3AZI C;  5B32 D;  3AZF A;  3AV1 B;  3REH B;  3REI B;  3C1C D;  3WKJ D;  5AY8 C;  4WNN A;  5GXQ A;  4NE3 A;  4YS3 D;  4H9N A;  3X1S A;  1TZY C;  2NZD D;  1KX4 A;  3KSY A;  3REK C;  2BYM A;  4Z5T C;  2HUE C;  3WA9 B;  1EQZ C;  3AZK B;  1P3B D;  4JJN B;  3LZ0 B;  3AZH B;  5F99 C;  2PYO B;  4XUJ A;  3O62 C;  4J8W D;  3B6G B;  5AV8 C;  3MGQ A;  2JSS A;  5B40 A;  4YM6 D;  1M19 A;  5B2J B;  3AZL C;  3MNN B;  4LD9 B;  1P3A D;  5B32 A;  5GSU D;  4ZUX C;  5E5A C;  3UTA A;  3AZM A;  1U35 C;  5BT1 C;  5B1M A;  1M18 D;  5B2I A;  5AVC D;  4Z66 C;  3KXB D;  3AYW A;  2F8N H;  3WAA A;  5C3I B;  5FUG A;  1HQ3 B;  3VH6 W;  4E44 A;  2CV5 B;  1P3K B;  5B31 D;  1F66 B;  1BH9 A;  1ZLA C;  2FJ7 D;  5B0Z A;  3V9R A;  4AWL C;  1P3L B;  2F8N B;  3LZ1 D;  4G91 C;  3AN2 A;  3AZI B;  4YM6 A;  4XZQ B;  3REL A;  4Z2M G;  4J8X A;  1P3A A;  4R8P D;  3W99 D;  3AZN A;  5CPJ D;  3AZG D;  5CPI B;  2ARO D;  1TZY B;  3X1V D;  3W97 D;  3REI C;  3X1T A;  3REK B;  3MGS D;  3KUY B;  1ID3 B;  1P3P C;  3LEL B;  2NQB D;  3LJA A;  1P3G D;  5AVB A;  1KX5 D;  5CPK B;  4HGA C;  5AV8 B;  5AV5 A;  3KWQ A;  3REJ D;  1AOI D;  4KUD D;  5B0Y D;  3LZ0 C;  4JJN C;  3AZE C;  5AY8 A;  1P3M D;  3AZL B;  3C1B C;  5GT0 D;  5GT3 D;  3UTB C;  1P3I D;  5KDM B;  3UT9 D;  3B6G C;  4WU9 D;  3W98 D;  4ZUX B;  5E5A B;  4H9R B;  4H9O B;  4Z5T A;  5DNM D;  1P3F A;  5BS7 A;  1EQZ A;  4J8U A;  5B2J C;  5AV6 B;  3MNN C;  3O62 A;  4NE5 A;  5B1L B;  3MVD D;  1TAF A;  5GXQ D;  3WKJ C;  5B33 B;  4QLC B;  3X1S D;  4YS3 C;  1KX4 D;  2NZD C;  3B0B A;  4H9Q A;  3X1U B;  3VH5 W;  2LY8 A;  3AV2 D;  2RVQ D;  5BNV A;  1AOI A;  1P3B C;  4XUJ D;  5C3I C;  1HQ3 C;  1U35 A;  3AFA D;  3MGQ D;  2CV5 C;  1P3K C;  4KGC A;  1F66 C;  1P34 A;  5B40 D;  4Z66 A;  1M19 D;  3R45 A;  2HIO A;  5DNN B;  3AZF B;  4XZQ C;  5B24 A;  3MGP B;  1P3P B;  2YFV B;  1P3O A;  3MVD A;  3NQU A;  3UTA D;  3AZM D;  1N1J B;  3NQJ B;  1KX3 A;  4J8V A;  5B1M D;  5CPI C;  1ZLA A;  3WTP E;  5B2I D;  1M18 C;  3MGR B;  4Z2M H;  3TU4 A;  3A6N A;  5AVC C;  4HGA B;  5G49 B;  3KUY C;  1ID3 C;  3W96 A;  3AYW D;  3LEL C;  4E45 A;  3AV2 A;  3AZJ B;  4X23 A;  3AZE B;  3WAA D;  3B6F A;  4WU8 B;  5JRG A;  3C1B B;  3UTB B;  4CSR B;  5CP6 B;  5CPK C;  1M1A B;  3AFA A;  3AV1 A;  5B0Z D;  3REH A;  3REI A;  3WTP B;  5AV9 D;  4H9P B;  4KHA B;  5BNX A;  3AN2 D;  3LZ1 C;  1BH8 A;  1S32 B;  3REL D;  5B32 B;  4J8X D;  3C1C B;  3WKJ B;  2BYK B;  3AZN D;  4DRA A;  3WA9 A;  3AZG C;  4YS3 B;  5CPJ C;  3AZK A;  2ARO C;  3B0C T;  4JJN A;  3LZ0 A;  5AV6 C;  2NZD B;  3AZH A;  3X1T D;  3X1V C;  2PYO A;  4G92 B;  3W97 C;  5B1L C;  3B0C W;  3LJA D;  3B6G A;  4WV4 B;  5B33 C;  4QLC C;  5AVB D;  1P3B B;  1JFI B;  4J8W B;  1KX5 C;  5B2J A;  3X1U C;  5AV5 D;  3KWQ D;  4LD9 A;  3REJ C;  5AY8 D;  5AV9 A;  4YM6 B;  1P3M C;  1BFM A;  1P3A B;  2YFW B;  5GSU B;  3UT9 C;  4Z5T D;  1P3F D;  1EQZ D;  5DNM C;  4J8U D;  5F99 D;  5DNN C;  1M18 B;  3AZF C;  3O62 D;  5B32 G;  1HQ3 A;  5AVC B;  3MGP C;  3KXB B;  1P3K A;  3AV1 C;  1P3L A;  2F8N A;  1KX4 C;  4CAY B;  3MGR C;  1R4V A;  3AZI A;  5JA4 B;  4XZQ A;  5B31 B;  2FJ7 B;  3AZJ C;  4XUJ C;  3LZ1 B;  1U35 D;  5BT1 D;  5CPI A;  4WU8 C;  1TZY A;  4KGC D;  5CP6 C;  1P34 D;  1M1A C;  4Z66 D;  3REK A;  4R8P B;  3WTP C;  3W99 B;  3KUY A;  4WZS B;  1ID3 A;  2HIO D;  3LEL A;  3AZG B;  5CPJ B;  2ARO B;  1S32 C;  5F99 A;  5B24 D;  3X1V B;  5B32 C;  3W97 B;  1H3O B;  1P3O D;  1TAF B;  3C1C C;  3MGS B;  1WWI A;  5CPK A;  1KX3 D;  4J8V D;  1ZLA D;  3UTA C;  5AV8 A;  2NQB B;  1P3G B;  5B2I C;  3TU4 D;  3A6N D;  4G92 C;  1KX5 B;  3AZL A;  3W96 D;  5BO0 B;  5KDM A;  4X23 D;  3REJ B;  1AOI B;  4KUD B;  3WAA C;  5B0Y B;  4ZUX A;  5JRG D;  5E5A A;  3B6F D;  4H9R A;  4H9O A;  1P3M B;  1F1E A;  4J8W C;  5GT0 B;  5GT3 B;  3AV1 D;  5AV6 A;  3REH D;  1P3I B;  3REI D;  3UT9 B;  4UUZ B;  5B0Z C;  4WU9 B;  3W98 B;  5B1L A;  4EO5 B;  5B31 G;  5DNM B;  5B33 A;  3AN2 C;  4QLC A;  4YM6 C;  4J8X C;  1P3A C;  5GSU C;  3X1U A;  4WNN B;  3MVD B;  5GXQ B;  3WA9 D;  3AZN C;  4H9N B;  3AZK D;  3X1S B;  4JJN D;  3LZ0 D;  3AZH D;  2PYO D;  1KX4 B;  1B67 A;  3X1T C;  2BYM B;  3B6G D;  3AV2 B;  3KXB C;  4XUJ B;  5B2J D;  5DNN A;  3MNN D;  4LD9 D;  3AFA B;  5AV5 C;  3KWQ C;  3MGQ B;  5B31 C;  3VH6 A;  5BNX B;  2FJ7 C;  3MGP A;  1P3P A;  2YFV A;  5B40 B;  1M19 B;  1BH8 B;  1N1J A;  3NQJ A;  3MGR A;  4R8P C;  1WWS A;  4H9S C;  3W99 C;  5G49 A;  3UTA B;  3AZM B;  5BS7 C;  1P3F C;  5B1M B;  4J8U C;  3AZJ A;  5B2I B;  3AZE A;  4DRB A;  3B0D B;  1HQ3 D;  4NFT A;  4WU8 A;  3C1B A;  3UTB A;  3MGS C;  2CV5 D;  1P3K D;  4CSR A;  5CP6 A;  1M1A A;  1F66 D;  3AYW B;  1ULY A;  2NQB C;  3WAA B;  1P3L D;  2F8N D;  3WTP A;  1P3G C;  5FUG B;  4H9P A;  4KHA A;  3AZI D;  1S32 A;  4XZQ D;  3MNN A;  1BH9 B;  5B0Z B;  3V9R B;  1AOI C;  3C1C A;  3WKJ A;  5AV9 B;  2BYK A;  4KUD C;  5B0Y C;  3AN2 B;  5CPI D;  1TZY D;  2F8N K;  2L5A A;  3REL B;  4YS3 A;  4ZBJ B;  5GT0 C;  5GT3 C;  4J8X B;  1P3I C;  2NZD A;  4KGC C;  3REK D;  1P34 C;  3KUY D;  1ID3 D;  3AZN B;  4WU9 C;  1Q9C A;  3LEL D;  2IO5 C;  4EO5 C;  3W98 C;  2HIO C;  3VH6 T;  1P3B A;  1JFI A;  5B24 C;  1HTA A;  3X1T B;  1B6W A;  4J8W A;  5CPK D;  1P3O C;  3MVD C;  5AV8 D;  5GXQ C;  3LJA B;  2CV5 A;  4J8V C;  1KX3 C;  1F66 A;  3X1S C;  5AVB B;  3TU4 C;  3AZL D;  3A6N C;  5AV5 B;  3KWQ B;  3W96 C;  3AV2 C;  2YFW A;  2RVQ C;  5GSU A;  4X23 C;  3VH5 A;  4ZUX D;  5CHL B;  5E5A D;  5AY8 B;  3B6F C;  5JRG C;  5AV6 D;  1M18 A;  3AFA C;  3REH C; 
#chains in the Genus database with same CATH topology
 3MGQ C;  5B1L D;  4Z5T B;  2HUE B;  5AVC A;  1P3F B;  5B33 D;  1A7W A;  2VQR A;  4QLC D;  5B40 C;  1M19 C;  1EQZ B;  3KXB A;  4J8U B;  5F99 B;  3O62 B;  3X1U D;  4CAY A;  3WA9 C;  5JA4 A;  3AZM C;  5B31 A;  3AZK C;  5B1M C;  2FJ7 A;  3AZH C;  2PYO C;  4H9Q B;  3LZ1 A;  3B0D C;  3A1K A;  5BNV B;  4NE6 A;  3AYW C;  4R8P A;  2FFF B;  4H9S A;  3W99 A;  5DNN D;  1U35 B;  3AZG A;  5CPJ A;  3AZF D;  2F8N G;  2ARO A;  4LD9 C;  4KGC B;  3X1V A;  1P34 B;  3W97 A;  3MGP D;  1P3P D;  1H3O A;  4Z66 B;  2IO5 B;  3R45 B;  5AV9 C;  3MGS A;  2HIO B;  2NQB A;  3VH5 T;  2CWE A;  3MGR D;  5B24 B;  4ZBJ C;  3REL C;  1P3G A;  1P3O B;  1KX5 A;  3NQU B;  1KX3 B;  4J8V B;  1ZLA B;  5BO0 A;  3AZJ D;  4AWL B;  3REJ A;  4M6B A;  3AZE D;  4G91 B;  4KUD A;  5B0Y A;  2BG1 A;  3TU4 B;  3C1B D;  3UTB D;  3A6N B;  4WU8 D;  2ZY4 A;  1KU5 A;  1P3M A;  5CP6 D;  1M1A D;  3W96 B;  5GT0 A;  5GT3 A;  1P3I A;  3UT9 A;  4X23 B;  3LJA C;  3WTP D;  4UUZ A;  5AVB C;  4WU9 A;  2DQN C;  3W98 A;  1P3L C;  3B6F B;  5JRG B;  5DNM A;  2G5H C;  2JCH A;  1S32 D;  3AZI C;  5B32 D;  3AZF A;  3AV1 B;  3REH B;  3REI B;  3C1C D;  3WKJ D;  5AY8 C;  4WNN A;  5GXQ A;  1T3U A;  4NE3 A;  4YS3 D;  4H9N A;  3X1S A;  1TZY C;  2NZD D;  1KX4 A;  3KSY A;  3REK C;  2BYM A;  4Z5T C;  2HUE C;  3WA9 B;  1EQZ C;  3AZK B;  1P3B D;  4JJN B;  3LZ0 B;  3H0L C;  5F99 C;  3AZH B;  2PYO B;  4XUJ A;  2ZY3 A;  3O62 C;  4J8W D;  3B6G B;  5AV8 C;  3MGQ A;  2JSS A;  3IP4 C;  3AL0 C;  5B40 A;  4YM6 D;  1M19 A;  2UWX A;  5B2J B;  3AZL C;  3MNN B;  4LD9 B;  1P3A D;  2Y2J A;  5GSU D;  5B32 A;  3EPJ A;  4ZUX C;  3F6T A;  5E5A C;  3UTA A;  3AZM A;  1PZR A;  1U35 C;  5BT1 C;  5B1M A;  1M18 D;  5B2I A;  5AVC D;  4Z66 C;  3KXB D;  3AYW A;  2F8N H;  2ZY5 A;  3WAA A;  5C3I B;  5FUG A;  1HQ3 B;  3VH6 W;  4E44 A;  2CV5 B;  1P3K B;  5B31 D;  1F66 B;  1BH9 A;  1ZLA C;  2FJ7 D;  5B0Z A;  3V9R A;  4AWL C;  1P3L B;  2F8N B;  3LZ1 D;  4G91 C;  4DQY B;  3AN2 A;  3AZI B;  4YM6 A;  4XZQ B;  2Y2H A;  4Z2M G;  3REL A;  4J8X A;  1P3A A;  4R8P D;  3W99 D;  2Y2L A;  3AZN A;  5CPJ D;  3AZG D;  5CPI B;  2ARO D;  2Y2K A;  1TZY B;  3EPK A;  3X1V D;  3W97 D;  3REI C;  3X1T A;  3REK B;  3MGS D;  3KUY B;  1ID3 B;  1P3P C;  3LEL B;  2NQB D;  3LJA A;  1P3G D;  5AVB A;  2RIQ A;  1KX5 D;  5CPK B;  4HGA C;  5AV8 B;  5AV5 A;  3KWQ A;  3REJ D;  1AOI D;  4KUD D;  5B0Y D;  3LZ0 C;  4JJN C;  3AZE C;  5AY8 A;  3EPL A;  1P3M D;  2Y2O A;  3AZL B;  3C1B C;  5GT0 D;  5GT3 D;  3UTB C;  1P3I D;  2XD1 A;  5KDM B;  3UT9 D;  3B6G C;  4WU9 D;  3W98 D;  4ZUX B;  5E5A B;  4H9R B;  4H9O B;  4Z5T A;  5DNM D;  1P3F A;  5BS7 A;  1EQZ A;  4J8U A;  5B2J C;  5AV6 B;  3MNN C;  3O62 A;  4NE5 A;  5B1L B;  3MVD D;  1TAF A;  5GXQ D;  3WKJ C;  5B33 B;  4QLC B;  3X1S D;  4YS3 C;  1KX4 D;  2NZD C;  3B0B A;  4H9Q A;  3X1U B;  2Y2Q A;  3VH5 W;  2LY8 A;  3AV2 D;  2RVQ D;  3EG5 B;  5BNV A;  1AOI A;  1P3B C;  4XUJ D;  4WJ3 C;  5C3I C;  2Y2I A;  1HQ3 C;  1U35 A;  3AFA D;  3MGQ D;  2CV5 C;  1P3K C;  4KGC A;  1F66 C;  1P34 A;  5B40 D;  4Z66 A;  1M19 D;  3R45 A;  2HIO A;  5DNN B;  3AZF B;  4XZQ C;  5B24 A;  3MGP B;  1P3P B;  2YFV B;  1P3O A;  3MVD A;  3NQU A;  1Z2C B;  3UTA D;  1N1J B;  3AZM D;  3NQJ B;  1KX3 A;  4J8V A;  5B1M D;  5CPI C;  1ZLA A;  2DF4 C;  3WTP E;  5B2I D;  1M18 C;  3MGR B;  4Z2M H;  3TU4 A;  3A6N A;  5AVC C;  4HGA B;  5G49 B;  3KUY C;  1ID3 C;  3W96 A;  3AYW D;  3LEL C;  4E45 A;  3AV2 A;  3AZJ B;  4X23 A;  3AZE B;  3WAA D;  3B6F A;  4WU8 B;  5JRG A;  3C1B B;  3UTB B;  4CSR B;  5CP6 B;  5CPK C;  1M1A B;  3AFA A;  3AV1 A;  5B0Z D;  3REH A;  3REI A;  2XD5 A;  3WTP B;  5AV9 D;  4H9P B;  4KHA B;  5BNX A;  3AN2 D;  2Y2M A;  3LZ1 C;  1BH8 A;  1S32 B;  3REL D;  5B32 B;  4J8X D;  3C1C B;  3WKJ B;  2BYK B;  3AZN D;  4DRA A;  3WA9 A;  3AZG C;  4YS3 B;  5CPJ C;  3AZK A;  2ARO C;  3B0C T;  4JJN A;  3LZ0 A;  5AV6 C;  2NZD B;  3AZH A;  3X1T D;  3X1V C;  2PYO A;  4UPK A;  4G92 B;  3W97 C;  5B1L C;  3B0C W;  3LJA D;  3B6G A;  4WV4 B;  5B33 C;  4QLC C;  5AVB D;  1P3B B;  1JFI B;  4J8W B;  1KX5 C;  5B2J A;  3X1U C;  5AV5 D;  3KWQ D;  4LD9 A;  3FDD A;  3REJ C;  5AY8 D;  5AV9 A;  4YM6 B;  1P3M C;  1BFM A;  1P3A B;  2YFW B;  5GSU B;  3UT9 C;  4Z5T D;  1P3F D;  1EQZ D;  5DNM C;  4J8U D;  5F99 D;  5DNN C;  1M18 B;  3AZF C;  3O62 D;  5B32 G;  1HQ3 A;  5AVC B;  3MGP C;  3KXB B;  1P3K A;  3AV1 C;  1P3L A;  2F8N A;  1KX4 C;  4CAY B;  3MGR C;  2Y2N A;  1R4V A;  3AZI A;  5JA4 B;  4XZQ A;  5B31 B;  2FJ7 B;  3AZJ C;  4XUJ C;  3LZ1 B;  1U35 D;  5BT1 D;  5CPI A;  4WU8 C;  1TZY A;  3KFU G;  4KGC D;  5CP6 C;  1P34 D;  1M1A C;  4Z66 D;  3REK A;  4R8P B;  3WTP C;  3W99 B;  3KUY A;  4WZS B;  1ID3 A;  2HIO D;  3LEL A;  3AZG B;  5CPJ B;  2ARO B;  1S32 C;  5F99 A;  5B24 D;  3X1V B;  5B32 C;  3W97 B;  2ZY2 A;  1H3O B;  1P3O D;  1TAF B;  3C1C C;  3MGS B;  1WWI A;  5CPK A;  1KX3 D;  4J8V D;  1ZLA D;  3UTA C;  5AV8 A;  2NQB B;  3P5J B;  1P3G B;  5B2I C;  3TU4 D;  3A6N D;  4G92 C;  1KX5 B;  3AZL A;  3W96 D;  5BO0 B;  2Y2P A;  5KDM A;  4X23 D;  3REJ B;  1AOI B;  2G5I C;  4KUD B;  3WAA C;  5B0Y B;  4ZUX A;  5JRG D;  5E5A A;  3B6F D;  4H9R A;  4H9O A;  1P3M B;  1F1E A;  4J8W C;  5GT0 B;  5GT3 B;  3AV1 D;  5AV6 A;  3REH D;  1P3I B;  3REI D;  3UT9 B;  2ZM5 A;  4UUZ B;  5B0Z C;  4WU9 B;  3W98 B;  5B1L A;  4EO5 B;  5B31 G;  5DNM B;  5B33 A;  3AN2 C;  4QLC A;  4YM6 C;  4J8X C;  1P3A C;  5GSU C;  3X1U A;  4WNN B;  3MVD B;  5GXQ B;  3WA9 D;  3AZN C;  4H9N B;  3AZK D;  3X1S B;  4JJN D;  3LZ0 D;  3AZH D;  2PYO D;  1KX4 B;  2J8P A;  1B67 A;  3X1T C;  2BYM B;  3B6G D;  3AV2 B;  3KXB C;  4XUJ B;  3H0M C;  5B2J D;  5DNN A;  3MNN D;  4LD9 D;  3AFA B;  5AV5 C;  3KWQ C;  3MGQ B;  5B31 C;  3VH6 A;  5BNX B;  2FJ7 C;  3MGP A;  1P3P A;  2YFV A;  5B40 B;  1M19 B;  1BH8 B;  3EPH A;  1N1J A;  3NQJ A;  2F2A C;  3MGR A;  4R8P C;  1WWS A;  4H9S C;  3W99 C;  5G49 A;  3UTA B;  3AZM B;  5BS7 C;  1P3F C;  5B1M B;  4J8U C;  3AZJ A;  5B2I B;  3AZE A;  4DRB A;  1HQ3 D;  3B0D B;  2JE5 A;  4NFT A;  4WU8 A;  3C1B A;  3UTB A;  3MGS C;  2CV5 D;  1P3K D;  4CSR A;  5CP6 A;  1M1A A;  1F66 D;  3AYW B;  1ULY A;  2NQB C;  3WAA B;  1P3L D;  2F8N D;  3WTP A;  1P3G C;  5FUG B;  4H9P A;  4KHA A;  3AZI D;  1S32 A;  4XZQ D;  3MNN A;  1BH9 B;  3H0R C;  5B0Z B;  3V9R B;  1AOI C;  3C1C A;  3WKJ A;  5AV9 B;  2BYK A;  4KUD C;  3A1I A;  2Y2G A;  5B0Y C;  3AN2 B;  5CPI D;  1TZY D;  2F8N K;  2L5A A;  3REL B;  4YS3 A;  4ZBJ B;  5GT0 C;  5GT3 C;  4J8X B;  1P3I C;  2NZD A;  4KGC C;  3REK D;  1P34 C;  3KUY D;  1ID3 D;  3AZN B;  4WU9 C;  1Q9C A;  3LEL D;  2IO5 C;  4EO5 C;  3W98 C;  2HIO C;  3VH6 T;  1P3B A;  1JFI A;  5B24 C;  1HTA A;  3X1T B;  1B6W A;  4J8W A;  2W8S A;  5CPK D;  1P3O C;  3MVD C;  5AV8 D;  5GXQ C;  3LJA B;  2CV5 A;  4J8V C;  1KX3 C;  1F66 A;  3X1S C;  5AVB B;  3TU4 C;  3AZL D;  3A6N C;  5AV5 B;  3KWQ B;  3W96 C;  3AV2 C;  1W2E A;  2YFW A;  2RVQ C;  5GSU A;  4X23 C;  3VH5 A;  4ZUX D;  5CHL B;  5E5A D;  5AY8 B;  3B6F C;  5JRG C;  5AV6 D;  1M18 A;  3AFA C;  3REH C; 
#chains in the Genus database with same CATH homology
 3MGQ C;  5B1L D;  4Z5T B;  2HUE B;  5AVC A;  1P3F B;  5B33 D;  1A7W A;  2VQR A;  4QLC D;  5B40 C;  1M19 C;  1EQZ B;  3KXB A;  4J8U B;  5F99 B;  3O62 B;  3X1U D;  4CAY A;  3WA9 C;  5JA4 A;  3AZM C;  5B31 A;  3AZK C;  5B1M C;  2FJ7 A;  3AZH C;  2PYO C;  4H9Q B;  3LZ1 A;  3B0D C;  3A1K A;  5BNV B;  4NE6 A;  3AYW C;  4R8P A;  2FFF B;  4H9S A;  3W99 A;  5DNN D;  1U35 B;  3AZG A;  5CPJ A;  3AZF D;  2F8N G;  2ARO A;  4LD9 C;  4KGC B;  3X1V A;  1P34 B;  3W97 A;  3MGP D;  1P3P D;  1H3O A;  4Z66 B;  2IO5 B;  3R45 B;  5AV9 C;  3MGS A;  2HIO B;  2NQB A;  3VH5 T;  2CWE A;  3MGR D;  5B24 B;  4ZBJ C;  3REL C;  1P3G A;  1P3O B;  1KX5 A;  3NQU B;  1KX3 B;  4J8V B;  1ZLA B;  5BO0 A;  3AZJ D;  4AWL B;  3REJ A;  4M6B A;  3AZE D;  4G91 B;  4KUD A;  5B0Y A;  2BG1 A;  3TU4 B;  3C1B D;  3UTB D;  3A6N B;  4WU8 D;  2ZY4 A;  1KU5 A;  1P3M A;  5CP6 D;  1M1A D;  3W96 B;  5GT0 A;  5GT3 A;  1P3I A;  3UT9 A;  4X23 B;  3LJA C;  3WTP D;  4UUZ A;  5AVB C;  4WU9 A;  2DQN C;  3W98 A;  1P3L C;  3B6F B;  5JRG B;  5DNM A;  2G5H C;  2JCH A;  1S32 D;  3AZI C;  5B32 D;  3AZF A;  3AV1 B;  3REH B;  3REI B;  3C1C D;  3WKJ D;  5AY8 C;  4WNN A;  5GXQ A;  1T3U A;  4NE3 A;  4YS3 D;  4H9N A;  3X1S A;  1TZY C;  2NZD D;  1KX4 A;  3KSY A;  3REK C;  2BYM A;  4Z5T C;  2HUE C;  3WA9 B;  1EQZ C;  3AZK B;  1P3B D;  4JJN B;  3LZ0 B;  3H0L C;  5F99 C;  3AZH B;  2PYO B;  4XUJ A;  2ZY3 A;  3O62 C;  4J8W D;  3B6G B;  5AV8 C;  3MGQ A;  2JSS A;  3IP4 C;  3AL0 C;  5B40 A;  4YM6 D;  1M19 A;  2UWX A;  5B2J B;  3AZL C;  3MNN B;  4LD9 B;  1P3A D;  2Y2J A;  5GSU D;  5B32 A;  3EPJ A;  4ZUX C;  3F6T A;  5E5A C;  3UTA A;  3AZM A;  1PZR A;  1U35 C;  5BT1 C;  5B1M A;  1M18 D;  5B2I A;  5AVC D;  4Z66 C;  3KXB D;  3AYW A;  2F8N H;  2ZY5 A;  3WAA A;  5C3I B;  5FUG A;  1HQ3 B;  3VH6 W;  4E44 A;  2CV5 B;  1P3K B;  5B31 D;  1F66 B;  1BH9 A;  1ZLA C;  2FJ7 D;  5B0Z A;  3V9R A;  4AWL C;  1P3L B;  2F8N B;  3LZ1 D;  4G91 C;  4DQY B;  3AN2 A;  3AZI B;  4YM6 A;  4XZQ B;  2Y2H A;  4Z2M G;  3REL A;  4J8X A;  1P3A A;  4R8P D;  3W99 D;  2Y2L A;  3AZN A;  5CPJ D;  3AZG D;  5CPI B;  2ARO D;  2Y2K A;  1TZY B;  3EPK A;  3X1V D;  3W97 D;  3REI C;  3X1T A;  3REK B;  3MGS D;  3KUY B;  1ID3 B;  1P3P C;  3LEL B;  2NQB D;  3LJA A;  1P3G D;  5AVB A;  2RIQ A;  1KX5 D;  5CPK B;  4HGA C;  5AV8 B;  5AV5 A;  3KWQ A;  3REJ D;  1AOI D;  4KUD D;  5B0Y D;  3LZ0 C;  4JJN C;  3AZE C;  5AY8 A;  3EPL A;  1P3M D;  2Y2O A;  3AZL B;  3C1B C;  5GT0 D;  5GT3 D;  3UTB C;  1P3I D;  2XD1 A;  5KDM B;  3UT9 D;  3B6G C;  4WU9 D;  3W98 D;  4ZUX B;  5E5A B;  4H9R B;  4H9O B;  4Z5T A;  5DNM D;  1P3F A;  5BS7 A;  1EQZ A;  4J8U A;  5B2J C;  5AV6 B;  3MNN C;  3O62 A;  4NE5 A;  5B1L B;  3MVD D;  1TAF A;  5GXQ D;  3WKJ C;  5B33 B;  4QLC B;  3X1S D;  4YS3 C;  1KX4 D;  2NZD C;  3B0B A;  4H9Q A;  3X1U B;  2Y2Q A;  3VH5 W;  2LY8 A;  3AV2 D;  2RVQ D;  3EG5 B;  5BNV A;  1AOI A;  1P3B C;  4XUJ D;  4WJ3 C;  5C3I C;  2Y2I A;  1HQ3 C;  1U35 A;  3AFA D;  3MGQ D;  2CV5 C;  1P3K C;  4KGC A;  1F66 C;  1P34 A;  5B40 D;  4Z66 A;  1M19 D;  3R45 A;  2HIO A;  5DNN B;  3AZF B;  4XZQ C;  5B24 A;  3MGP B;  1P3P B;  2YFV B;  1P3O A;  3MVD A;  3NQU A;  1Z2C B;  3UTA D;  1N1J B;  3AZM D;  3NQJ B;  1KX3 A;  4J8V A;  5B1M D;  5CPI C;  1ZLA A;  2DF4 C;  3WTP E;  5B2I D;  1M18 C;  3MGR B;  4Z2M H;  3TU4 A;  3A6N A;  5AVC C;  4HGA B;  5G49 B;  3KUY C;  1ID3 C;  3W96 A;  3AYW D;  3LEL C;  4E45 A;  3AV2 A;  3AZJ B;  4X23 A;  3AZE B;  3WAA D;  3B6F A;  4WU8 B;  5JRG A;  3C1B B;  3UTB B;  4CSR B;  5CP6 B;  5CPK C;  1M1A B;  3AFA A;  3AV1 A;  5B0Z D;  3REH A;  3REI A;  2XD5 A;  3WTP B;  5AV9 D;  4H9P B;  4KHA B;  5BNX A;  3AN2 D;  2Y2M A;  3LZ1 C;  1BH8 A;  1S32 B;  3REL D;  5B32 B;  4J8X D;  3C1C B;  3WKJ B;  2BYK B;  3AZN D;  4DRA A;  3WA9 A;  3AZG C;  4YS3 B;  5CPJ C;  3AZK A;  2ARO C;  3B0C T;  4JJN A;  3LZ0 A;  5AV6 C;  2NZD B;  3AZH A;  3X1T D;  3X1V C;  2PYO A;  4UPK A;  4G92 B;  3W97 C;  5B1L C;  3B0C W;  3LJA D;  3B6G A;  4WV4 B;  5B33 C;  4QLC C;  5AVB D;  1P3B B;  1JFI B;  4J8W B;  1KX5 C;  5B2J A;  3X1U C;  5AV5 D;  3KWQ D;  4LD9 A;  3FDD A;  3REJ C;  5AY8 D;  5AV9 A;  4YM6 B;  1P3M C;  1BFM A;  1P3A B;  2YFW B;  5GSU B;  3UT9 C;  4Z5T D;  1P3F D;  1EQZ D;  5DNM C;  4J8U D;  5F99 D;  5DNN C;  1M18 B;  3AZF C;  3O62 D;  5B32 G;  1HQ3 A;  5AVC B;  3MGP C;  3KXB B;  1P3K A;  3AV1 C;  1P3L A;  2F8N A;  1KX4 C;  4CAY B;  3MGR C;  2Y2N A;  1R4V A;  3AZI A;  5JA4 B;  4XZQ A;  5B31 B;  2FJ7 B;  3AZJ C;  4XUJ C;  3LZ1 B;  1U35 D;  5BT1 D;  5CPI A;  4WU8 C;  1TZY A;  3KFU G;  4KGC D;  5CP6 C;  1P34 D;  1M1A C;  4Z66 D;  3REK A;  4R8P B;  3WTP C;  3W99 B;  3KUY A;  4WZS B;  1ID3 A;  2HIO D;  3LEL A;  3AZG B;  5CPJ B;  2ARO B;  1S32 C;  5F99 A;  5B24 D;  3X1V B;  5B32 C;  3W97 B;  2ZY2 A;  1H3O B;  1P3O D;  1TAF B;  3C1C C;  3MGS B;  1WWI A;  5CPK A;  1KX3 D;  4J8V D;  1ZLA D;  3UTA C;  5AV8 A;  2NQB B;  3P5J B;  1P3G B;  5B2I C;  3TU4 D;  3A6N D;  4G92 C;  1KX5 B;  3AZL A;  3W96 D;  5BO0 B;  2Y2P A;  5KDM A;  4X23 D;  3REJ B;  1AOI B;  2G5I C;  4KUD B;  3WAA C;  5B0Y B;  4ZUX A;  5JRG D;  5E5A A;  3B6F D;  4H9R A;  4H9O A;  1P3M B;  1F1E A;  4J8W C;  5GT0 B;  5GT3 B;  3AV1 D;  5AV6 A;  3REH D;  1P3I B;  3REI D;  3UT9 B;  2ZM5 A;  4UUZ B;  5B0Z C;  4WU9 B;  3W98 B;  5B1L A;  4EO5 B;  5B31 G;  5DNM B;  5B33 A;  3AN2 C;  4QLC A;  4YM6 C;  4J8X C;  1P3A C;  5GSU C;  3X1U A;  4WNN B;  3MVD B;  5GXQ B;  3WA9 D;  3AZN C;  4H9N B;  3AZK D;  3X1S B;  4JJN D;  3LZ0 D;  3AZH D;  2PYO D;  1KX4 B;  2J8P A;  1B67 A;  3X1T C;  2BYM B;  3B6G D;  3AV2 B;  3KXB C;  4XUJ B;  3H0M C;  5B2J D;  5DNN A;  3MNN D;  4LD9 D;  3AFA B;  5AV5 C;  3KWQ C;  3MGQ B;  5B31 C;  3VH6 A;  5BNX B;  2FJ7 C;  3MGP A;  1P3P A;  2YFV A;  5B40 B;  1M19 B;  1BH8 B;  3EPH A;  1N1J A;  3NQJ A;  2F2A C;  3MGR A;  4R8P C;  1WWS A;  4H9S C;  3W99 C;  5G49 A;  3UTA B;  3AZM B;  5BS7 C;  1P3F C;  5B1M B;  4J8U C;  3AZJ A;  5B2I B;  3AZE A;  4DRB A;  1HQ3 D;  3B0D B;  2JE5 A;  4NFT A;  4WU8 A;  3C1B A;  3UTB A;  3MGS C;  2CV5 D;  1P3K D;  4CSR A;  5CP6 A;  1M1A A;  1F66 D;  3AYW B;  1ULY A;  2NQB C;  3WAA B;  1P3L D;  2F8N D;  3WTP A;  1P3G C;  5FUG B;  4H9P A;  4KHA A;  3AZI D;  1S32 A;  4XZQ D;  3MNN A;  1BH9 B;  3H0R C;  5B0Z B;  3V9R B;  1AOI C;  3C1C A;  3WKJ A;  5AV9 B;  2BYK A;  4KUD C;  3A1I A;  2Y2G A;  5B0Y C;  3AN2 B;  5CPI D;  1TZY D;  2F8N K;  2L5A A;  3REL B;  4YS3 A;  4ZBJ B;  5GT0 C;  5GT3 C;  4J8X B;  1P3I C;  2NZD A;  4KGC C;  3REK D;  1P34 C;  3KUY D;  1ID3 D;  3AZN B;  4WU9 C;  1Q9C A;  3LEL D;  2IO5 C;  4EO5 C;  3W98 C;  2HIO C;  3VH6 T;  1P3B A;  1JFI A;  5B24 C;  1HTA A;  3X1T B;  1B6W A;  4J8W A;  2W8S A;  5CPK D;  1P3O C;  3MVD C;  5AV8 D;  5GXQ C;  3LJA B;  2CV5 A;  4J8V C;  1KX3 C;  1F66 A;  3X1S C;  5AVB B;  3TU4 C;  3AZL D;  3A6N C;  5AV5 B;  3KWQ B;  3W96 C;  3AV2 C;  1W2E A;  2YFW A;  2RVQ C;  5GSU A;  4X23 C;  3VH5 A;  4ZUX D;  5CHL B;  5E5A D;  5AY8 B;  3B6F C;  5JRG C;  5AV6 D;  1M18 A;  3AFA C;  3REH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...