3AV2D

The human nucleosome structure containing the histone variant h3.3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2D00
3AZEA 3REKB 5KDMA 3KUYB 3VH5T 4H9QB 3TU4C 5GT0C 3W97A 5AY8A 2AROB 5F99A 3O62A 3AZKB 3AN2D 4Z5TA 5DNMA 5B2IA 5FUGB 5DNNC 4X23D 3LJAC 4YS3A 3X1TC 5G49A 5CPIA 2L5AA 5AV6A 5E5AB 4XZQD 3WKJD 3MVDB 1P3MA 3MGSC 3B6GA 4Z2MG 1BH9A 1H3OB 2HUEB 2FJ7B 5B1LC 5B0ZA 4WZSB 3REKD 3B6FA 3MGQA 5B31A 3AYWC 3KUYD 2NZDB 3MNNC 4ZBJB 2BYMA 5B33C 4JJNB 3KWQB 3LZ1C 2AROD 3LELA 3AZKD 3AV1A 1P34B 3W99B 1P3AA 5BT1D 5CP6B 3REIC 5E5AD 3MVDD 1BH8A 3AZIC 4YM6B 2FJ7D 3W96B 2HIOC 2NZDD 3X1SB 4JJND 5B2JA 3KWQD 5BS7A 3AZGC 1AOIB 1P34D 4CAYB 3W99D 3VH6W 1KX5C 1ID3A 1EQZA 4HGAB 1HQ3C 1KX4C 1JFIA 4J8XA 3AZHA 3UTBD 5CP6D 3A6NC 1P3FA 3C1CB 5GXQC 2F8NG 5AV5B 3UTAB 4YM6D 5CPKA 4NE3A 4WU8C 2CV5B 1P3BC 3W96D 3UT9B 4KUDA 4UUZA 3WA9C 2LY8A 3AFAC 1TAFA 3X1SD 5C3IB 3TU4A 3MGPC 5B24B 2BYKB 1M18C 5DNNA 5B40B 1ULYA 3LJAA 3C1CD 3X1TA 1P3PB 5B1MC 2NQBB 5AV5D 3UTAD 3MGRC 5AV8D 5AVCC 1P3GA 5GT3B 3UT9D 5B1LA 5JRGC 1B6WA 4WNNA 3AYWA 3MNNA 4G92B 1M19B 4Z66B 5B33A 3LZ1A 5B24D 3C1BB 5AV8A 5B40D 1P3PD 3REIA 3VH5W 3X1UC 4WU9B 1TZYC 3AZMD 1KX3B 3AZIA 5GT3D 1N1JB 1A7WA 2HIOA 5B32B 3AZFB 2PYOC 5JA4A 1P3KB 1F66D 3AZEB 1M19D 1U35C 4Z66D 4J8UB 5KDMB 1P3IC 3AZGA 3C1BD 3W97B 1ZLAC 5AY8B 1HQ3A 3B0DB 3X1VD 3O62B 3RELC 4J8VC 4Z5TB 5B2IB 3A6NA 4YS3B 4WU9D 5G49B 5GSUC 1KX3D 5AV6B 1F66A 1P3MB 4J8WC 1P3BA 3B6GB 1BH9B 5AVBC 5B32D 3AZFD 2YFVA 3AZED 3WA9A 3AFAA 3B6FB 3MGQB 5B31B 2BYMB 3W97D 4H9PA 5AY8D 5F99D 3LELB 3O62D 3MGPA 3AV1B 1S32A 4Z5TD 5DNMD 5B2ID 1P3AB 1M18A 4YS3D 1WWSA 5B1MA 5CPID 3KXBC 3AZLC 5AV6D 3MGRA 5AVCA 1BH8B 1P3MD 2YFWA 3B6GD 3W98C 1Q9CA 5JRGA 1P3LC 5B0ZD 3B6FD 3MGQD 5B31D 1P3OC 5B2JB 3LELD 3AV1D 1ID3B 1EQZB 4H9NA 1P3AD 1JFIB 4M6BA 4ZBJC 2RVQC 1P3FB 1TZYA 4LD9C 3VH6A 4KHAA 5CPKB 2PYOA 4KUDB 4UUZB 3LZ0C 1U35A 1TAFB 1P3IA 5B2JD 1HTAA 3UTBB 3TU4B 1ZLAA 1ID3D 1EQZD 3RELA 4J8VA 4J8XD 3AZHD 5DNNB 3LJAB 1P3FD 3X1TB 5GSUA 1AOIC 5CPKD 4J8WA 1P3GB 5AVBA 4KUDD 5B1LB 4WNNB 4G91B 3MNNB 3TU4D 4Z2MH 4QLCA 5B33B 2CV5C 4H9RB 3LZ1B 4KGCC 5AV8B 5DNND 3LJAD 5C3IC 3X1TD 3REHC 3KXBA 3AZLA 3REIB 5CHLB 1P3GD 3AZIB 3W98A 5AV9C 5B1LD 5GT0A 1P3LA 3KSYA 2NQBC 2HIOB 5B0YC 3AYWD 5JA4B 3WTPC 3MNND 5B33D 5BO0A 1P3OA 3LZ1D 3AZGB 4NE6A 1HQ3B 3AZMB 3MGSA 5BNVA 3A6NB 3REID 4AWLC 1M1AC 4H9SC 4R8PC 3AZID 4LD9A 1F66B 3B0CW 1P3BB 5BNXA 2HIOD 2YFVB 3AZJC 3WA9B 3LZ0A 2F8NH 3X1VB 3AZGD 3WAAC 2F8NA 1HQ3D 3MGPB 3AZFC 1P3KC 4ZUXC 2IO5C 1S32B 3A6ND 4J8UC 3REJC 5B1MB 4XUJC 1AOIA 3MGRB 5AVCB 3AZNC 4WU8D 1P3BD 3AV2C 3WA9D 1KX5A 3AFAD 5F99B 1KX4A 5CPJC 5DNMB 4NE5A 2CV5A 3V9RA 4KGCA 3MGPD 5CPIB 4E45A 5GXQA 5B32G 1S32D 3B6FC 1M18D 4WU8A 3AN2C 4WV4B 5B1MD 3REHA 3MGRD 4X23C 5B0ZB 1TZYB 5AVCD 4EO5C 4XZQC 3NQUA 3WKJC 5AV9A 5JRGD 4KHAB 1KU5A 2NQBA 5B0YA 2PYOB 3WTPA 3B0CT 3REKC 4H9OA 1U35B 1P3IB 3KUYC 1ZLAB 2AROC 3AZKC 3RELB 1F1EA 5BT1C 3X1UD 1M1AA 1TZYD 4R8PA 5E5AC 3MVDC 2HUEC 5AVBB 2FJ7C 2PYOD 3AZJA 3WTPE 1U35D 2F8NK 1P3ID 2NZDC 4J8XB 3AZHB 3WAAA 3X1UA 4QLCB 3KWQC 4JJNC 1ZLAD 4CSRA 3RELD 4J8VD 4ZUXA 1P34C 1P3KA 3W99C 3R45A 4J8UA 3REJA 5GSUD 4XUJA 3UTBC 3KXBB 3AZLB 5CP6C 4J8WD 3AZNA 4DRAA 3AV2A 3W98B 5AVBD 4YM6C 5GT0B 1P3LB 3W96C 5CPJA 3X1SC 4QLCD 1P3OB 5BO0B 1P3GC 4DRBA 3NQJA 4HGAC 3MGSB 4G91C 3AN2A 3KXBD 3AZLD 5BNVB 1R4VA 4X23A 3C1CC 3AYWB 5AV5C 3UTAC 3W98D 4LD9B 4XZQA 3WKJA 5AV8C 5GT0D 1P3LD 3UT9C 5BNXB 3REKA 3LZ0B 1P3OD 3KUYA 4H9QA 2F8NB 2AROA 3AZKA 3MGSD 5B24C 5FUGA 5B40C 2RVQD 1P3PC 4LD9D 5E5AA 3VH5A 3MVDA 4NFTA 3AZMC 1H3OA 5GT3C 3AZFA 2FJ7A 1KX5B 3LZ0D 1KX4B 2NZDA 1F66C 4G92C 1M19C 4Z66C 4JJNA 3KWQA 3V9RB 2F8ND 4KGCB 5GXQB 3C1BC 1P34A 3W99A 3X1VC 4WU8B 3REHB 3UTBA 1AOID 5CP6A 4WU9C 3AFAB 1KX3C 4YM6A 1S32C 3NQUB 5AV9B 3W96A 1KX5D 4H9PB 5B32C 1KX4D 5B0YB 3AZEC 3WTPB 3X1SA 4H9OB 1M18B 2CV5D 4KGCD 5GXQD 3B0BA 4CAYA 3W97C 5AY8C 3B0DC 5F99C 3O62C 2JSSA 2YFWB 3REHD 4Z5TC 5DNMC 5B2IC 5JRGB 4H9RA 4YS3C 3C1CA 4AWLB 1M1AB 5CPIC 4R8PB 5AV5A 3UTAA 5AV6C 5AV9D 1P3MC 2NQBD 3B6GC 3UT9A 3VH6T 5B0YD 3AZJB 3WTPD 5B0ZC 3MGQC 4H9NB 5B31C 3WAAB 3X1UB 3LELC 3AV1C 4CSRB 5B24A 4E44A 4ZUXB 2IO5B 2BYKA 3R45B 1P3AC 5B40A 1P3PA 1M1AD 3REJB 1BFMA 4XUJB 4R8PD 3AZMA 3AZNB 5GT3A 3AV2B 3AZJD 1B67A 5CPJB 4J8VB 5B31G 1M19A 4Z66A 3WAAD 5B2JC 4H9SA 5GSUB 5BS7C 3C1BA 3NQJB 4ZUXD 1P3KD 1ID3C 1EQZC 3X1VA 4J8UD 4J8WB 3REJD 3AN2B 4J8XC 3AZHC 4XUJD 4QLCC 4X23B 1P3FC 4WU9A 1KX3A 3AZND 4EO5B 3AV2D 2CWEA 4XZQB 1N1JA 3WKJB 5CPKC 1WWIA 5B32A 5CPJD 4KUDC
chains in the Genus database with same CATH superfamily
3AZEA 3REKB 5KDMA 2BG1A 3KUYB 3VH5T 4H9QB 3TU4C 5GT0C 3W97A 5AY8A 2AROB 5F99A 3O62A 3AZKB 3AN2D 4Z5TA 5DNMA 5B2IA 5FUGB 5DNNC 4X23D 3LJAC 4YS3A 3X1TC 5G49A 5CPIA 2L5AA 5AV6A 5E5AB 4XZQD 3WKJD 3MVDB 1P3MA 3MGSC 3B6GA 4Z2MG 1BH9A 1H3OB 2HUEB 3EPLA 2FJ7B 5B1LC 1T3UA 5B0ZA 4WZSB 3REKD 3B6FA 3MGQA 5B31A 3AYWC 3KUYD 2NZDB 3MNNC 4ZBJB 2BYMA 5B33C 4JJNB 3KWQB 3LZ1C 2AROD 3LELA 3AZKD 3AV1A 1P34B 3W99B 1P3AA 5BT1D 5CP6B 3REIC 5E5AD 3MVDD 1BH8A 3AZIC 4YM6B 2FJ7D 3W96B 2HIOC 2ZM5A 2NZDD 3X1SB 4JJND 5B2JA 3KWQD 5BS7A 3AZGC 1AOIB 1P34D 4CAYB 3VH6W 3W99D 1KX5C 1ID3A 1EQZA 4HGAB 1HQ3C 1KX4C 1JFIA 4J8XA 3AZHA 3UTBD 5CP6D 3A6NC 1P3FA 3C1CB 5GXQC 2F8NG 5AV5B 3UTAB 4YM6D 5CPKA 4NE3A 4WU8C 2CV5B 1P3BC 3W96D 3UT9B 4KUDA 4UUZA 3WA9C 2LY8A 3AFAC 1TAFA 3X1SD 5C3IB 3TU4A 3MGPC 5B24B 2BYKB 1M18C 5DNNA 5B40B 1ULYA 3LJAA 3C1CD 3X1TA 1P3PB 5B1MC 2NQBB 5AV5D 3UTAD 3MGRC 5AV8D 5AVCC 1P3GA 2Y2MA 5GT3B 3UT9D 5B1LA 5JRGC 1B6WA 2F2AC 4WNNA 3AYWA 3MNNA 4G92B 1M19B 4Z66B 5B33A 3LZ1A 5B24D 3C1BB 5AV8A 5B40D 1P3PD 3REIA 3VH5W 2RIQA 3X1UC 4WU9B 1TZYC 3AZMD 1KX3B 3AZIA 5GT3D 1N1JB 1A7WA 2HIOA 5B32B 3AZFB 2PYOC 5JA4A 1P3KB 1F66D 3AZEB 1M19D 1U35C 4Z66D 4J8UB 5KDMB 1P3IC 3AZGA 3C1BD 3W97B 1ZLAC 5AY8B 1HQ3A 3B0DB 3X1VD 3O62B 3RELC 4J8VC 4Z5TB 5B2IB 3A6NA 4YS3B 4WU9D 5G49B 5GSUC 1KX3D 5AV6B 1F66A 1P3MB 4J8WC 1P3BA 3B6GB 1BH9B 5AVBC 5B32D 3AZFD 2YFVA 3AZED 3WA9A 3AFAA 3B6FB 3MGQB 5B31B 2BYMB 3W97D 4H9PA 5AY8D 5F99D 3LELB 3O62D 3MGPA 3AV1B 2Y2QA 1S32A 4Z5TD 5DNMD 5B2ID 1P3AB 1M18A 4YS3D 2ZY2A 1WWSA 5B1MA 5CPID 3KXBC 3AZLC 5AV6D 3MGRA 5AVCA 1BH8B 1P3MD 2YFWA 3B6GD 3W98C 1Q9CA 5JRGA 1P3LC 5B0ZD 3B6FD 3MGQD 5B31D 1W2EA 1P3OC 5B2JB 3LELD 3AV1D 1ID3B 1EQZB 4H9NA 1P3AD 2XD5A 1JFIB 4M6BA 4ZBJC 2RVQC 1P3FB 1TZYA 4LD9C 3VH6A 4KHAA 5CPKB 2PYOA 4KUDB 4UUZB 3LZ0C 1U35A 1TAFB 1P3IA 5B2JD 1HTAA 3KFUG 3UTBB 3TU4B 1ZLAA 1ID3D 1EQZD 3RELA 4J8VA 4J8XD 3AZHD 5DNNB 3LJAB 1P3FD 3X1TB 5GSUA 1AOIC 2FFFB 2Y2HA 5CPKD 4J8WA 1P3GB 5AVBA 2XD1A 4KUDD 5B1LB 4WNNB 2DF4C 4G91B 3MNNB 3TU4D 4Z2MH 4QLCA 5B33B 3P5JB 2Y2IA 4H9RB 2CV5C 3LZ1B 4KGCC 5AV8B 5DNND 2Y2LA 3LJAD 5C3IC 3X1TD 3REHC 3KXBA 3AZLA 3REIB 5CHLB 1P3GD 3AZIB 3W98A 5AV9C 5B1LD 5GT0A 1P3LA 3KSYA 2NQBC 3H0RC 2HIOB 2DQNC 5B0YC 3AYWD 5JA4B 3WTPC 3MNND 5B33D 3FDDA 5BO0A 1P3OA 3LZ1D 3AZGB 4NE6A 1HQ3B 2W8SA 3MGSA 3AZMB 3EPHA 5BNVA 3A6NB 3REID 4AWLC 1M1AC 4H9SC 2ZY3A 4R8PC 3AZID 4LD9A 1F66B 1PZRA 3B0CW 1P3BB 5BNXA 2HIOD 2YFVB 3AZJC 3WA9B 3LZ0A 2F8NH 3X1VB 3AZGD 3WAAC 2JCHA 2F8NA 1HQ3D 3MGPB 3AZFC 1P3KC 4ZUXC 2IO5C 1S32B 3F6TA 3A6ND 4J8UC 3REJC 5B1MB 4XUJC 1AOIA 3MGRB 5AVCB 3AZNC 4WU8D 1P3BD 3AV2C 3WA9D 1KX5A 3AFAD 5F99B 1KX4A 5CPJC 5DNMB 4NE5A 2CV5A 3V9RA 4KGCA 3MGPD 5CPIB 4E45A 5GXQA 5B32G 1S32D 3B6FC 1M18D 4WU8A 3AN2C 4WV4B 5B1MD 3REHA 3MGRD 4X23C 5B0ZB 1TZYB 5AVCD 2JE5A 4EO5C 4XZQC 3NQUA 3WKJC 4KHAB 5JRGD 5AV9A 1KU5A 2NQBA 5B0YA 2PYOB 3WTPA 3B0CT 3REKC 4H9OA 2G5HC 1U35B 1P3IB 3KUYC 1ZLAB 2AROC 3AZKC 3RELB 1F1EA 5BT1C 3A1IA 3X1UD 1M1AA 1TZYD 4R8PA 5E5AC 3MVDC 2UWXA 2HUEC 5AVBB 2FJ7C 2PYOD 3AZJA 3WTPE 1U35D 2Y2KA 2F8NK 1P3ID 2NZDC 4J8XB 3AZHB 3WAAA 3X1UA 4QLCB 3KWQC 4JJNC 1ZLAD 4CSRA 3RELD 4J8VD 4ZUXA 1P34C 1P3KA 3W99C 3R45A 4J8UA 3REJA 5GSUD 4XUJA 3UTBC 3KXBB 3AZLB 5CP6C 1Z2CB 4J8WD 3AZNA 4DRAA 3AV2A 3W98B 5AVBD 4YM6C 5GT0B 1P3LB 3W96C 3A1KA 5CPJA 3X1SC 4QLCD 1P3OB 5BO0B 1P3GC 4DRBA 3NQJA 2J8PA 4HGAC 3MGSB 4G91C 3AN2A 3KXBD 3AZLD 5BNVB 1R4VA 4X23A 3C1CC 3AYWB 5AV5C 3UTAC 3W98D 4LD9B 4XZQA 3WKJA 5AV8C 5GT0D 1P3LD 3UT9C 5BNXB 3REKA 3LZ0B 1P3OD 3KUYA 4H9QA 2F8NB 2AROA 3AZKA 3MGSD 5B24C 2Y2PA 5FUGA 2VQRA 2RVQD 5B40C 1P3PC 3IP4C 3EPJA 4LD9D 5E5AA 3VH5A 3MVDA 4NFTA 3AZMC 1H3OA 5GT3C 3AZFA 2FJ7A 3EG5B 1KX5B 3LZ0D 1KX4B 2NZDA 1F66C 4G92C 1M19C 3AL0C 4Z66C 4JJNA 3KWQA 3V9RB 2F8ND 4KGCB 5GXQB 3C1BC 1P34A 3W99A 3H0LC 3X1VC 4WU8B 3REHB 3UTBA 1AOID 5CP6A 4WU9C 3AFAB 1KX3C 4YM6A 1S32C 3NQUB 5AV9B 3W96A 1KX5D 4H9PB 5B32C 1KX4D 5B0YB 3AZEC 3WTPB 3H0MC 4H9OB 3X1SA 1M18B 2CV5D 4KGCD 5GXQD 3B0BA 4CAYA 3W97C 4WJ3C 5AY8C 3B0DC 5F99C 3O62C 2JSSA 2YFWB 3REHD 4Z5TC 5DNMC 5B2IC 5JRGB 4H9RA 4YS3C 3C1CA 4AWLB 1M1AB 5CPIC 4R8PB 5AV5A 3UTAA 5AV6C 5AV9D 1P3MC 4DQYB 2NQBD 3B6GC 3UT9A 3VH6T 5B0YD 3AZJB 3WTPD 5B0ZC 3MGQC 4H9NB 5B31C 3WAAB 3X1UB 3EPKA 3LELC 3AV1C 4CSRB 5B24A 4E44A 4ZUXB 2IO5B 2BYKA 3R45B 1P3AC 5B40A 2G5IC 1P3PA 1M1AD 3REJB 2ZY5A 1BFMA 4XUJB 4R8PD 3AZMA 3AZNB 5GT3A 3AV2B 2Y2OA 4UPKA 3AZJD 1B67A 2ZY4A 5CPJB 4J8VB 5B31G 1M19A 4Z66A 3WAAD 5B2JC 4H9SA 5GSUB 5BS7C 3C1BA 3NQJB 2Y2NA 4ZUXD 1P3KD 2Y2GA 1ID3C 1EQZC 3X1VA 4J8UD 4J8WB 3REJD 3AN2B 4J8XC 3AZHC 4XUJD 4QLCC 4X23B 1P3FC 4WU9A 1KX3A 3AZND 4EO5B 3AV2D 2CWEA 4XZQB 1N1JA 3WKJB 5CPKC 1WWIA 2Y2JA 5B32A 5CPJD 4KUDC
chains in the Genus database with same CATH topology
3AZEA 3REKB 5KDMA 2BG1A 3KUYB 3VH5T 4H9QB 3TU4C 5GT0C 3W97A 5AY8A 2AROB 5F99A 3O62A 3AZKB 3AN2D 4Z5TA 5DNMA 5B2IA 5FUGB 5DNNC 4X23D 3LJAC 4YS3A 3X1TC 5G49A 5CPIA 2L5AA 5AV6A 5E5AB 4XZQD 3WKJD 3MVDB 1P3MA 3MGSC 3B6GA 4Z2MG 1BH9A 1H3OB 2HUEB 3EPLA 2FJ7B 5B1LC 1T3UA 5B0ZA 4WZSB 3REKD 3B6FA 3MGQA 5B31A 3AYWC 3KUYD 2NZDB 3MNNC 4ZBJB 2BYMA 5B33C 4JJNB 3KWQB 3LZ1C 2AROD 3LELA 3AZKD 3AV1A 1P34B 3W99B 1P3AA 5BT1D 5CP6B 3REIC 5E5AD 3MVDD 1BH8A 3AZIC 4YM6B 2FJ7D 3W96B 2HIOC 2ZM5A 2NZDD 3X1SB 4JJND 5B2JA 3KWQD 5BS7A 3AZGC 1AOIB 1P34D 4CAYB 3VH6W 3W99D 1KX5C 1ID3A 1EQZA 4HGAB 1HQ3C 1KX4C 1JFIA 4J8XA 3AZHA 3UTBD 5CP6D 3A6NC 1P3FA 3C1CB 5GXQC 2F8NG 5AV5B 3UTAB 4YM6D 5CPKA 4NE3A 4WU8C 2CV5B 1P3BC 3W96D 3UT9B 4KUDA 4UUZA 3WA9C 2LY8A 3AFAC 1TAFA 3X1SD 5C3IB 3TU4A 3MGPC 5B24B 2BYKB 1M18C 5DNNA 5B40B 1ULYA 3LJAA 3C1CD 3X1TA 1P3PB 5B1MC 2NQBB 5AV5D 3UTAD 3MGRC 5AV8D 5AVCC 1P3GA 2Y2MA 5GT3B 3UT9D 5B1LA 5JRGC 1B6WA 2F2AC 4WNNA 3AYWA 3MNNA 4G92B 1M19B 4Z66B 5B33A 3LZ1A 5B24D 3C1BB 5AV8A 5B40D 1P3PD 3REIA 3VH5W 2RIQA 3X1UC 4WU9B 1TZYC 3AZMD 1KX3B 3AZIA 5GT3D 1N1JB 1A7WA 2HIOA 5B32B 3AZFB 2PYOC 5JA4A 1P3KB 1F66D 3AZEB 1M19D 1U35C 4Z66D 4J8UB 5KDMB 1P3IC 3AZGA 3C1BD 3W97B 1ZLAC 5AY8B 1HQ3A 3B0DB 3X1VD 3O62B 3RELC 4J8VC 4Z5TB 5B2IB 3A6NA 4YS3B 4WU9D 5G49B 5GSUC 1KX3D 5AV6B 1F66A 1P3MB 4J8WC 1P3BA 3B6GB 1BH9B 5AVBC 5B32D 3AZFD 2YFVA 3AZED 3WA9A 3AFAA 3B6FB 3MGQB 5B31B 2BYMB 3W97D 4H9PA 5AY8D 5F99D 3LELB 3O62D 3MGPA 3AV1B 2Y2QA 1S32A 4Z5TD 5DNMD 5B2ID 1P3AB 1M18A 4YS3D 2ZY2A 1WWSA 5B1MA 5CPID 3KXBC 3AZLC 5AV6D 3MGRA 5AVCA 1BH8B 1P3MD 2YFWA 3B6GD 3W98C 1Q9CA 5JRGA 1P3LC 5B0ZD 3B6FD 3MGQD 5B31D 1W2EA 1P3OC 5B2JB 3LELD 3AV1D 1ID3B 1EQZB 4H9NA 1P3AD 2XD5A 1JFIB 4M6BA 4ZBJC 2RVQC 1P3FB 1TZYA 4LD9C 3VH6A 4KHAA 5CPKB 2PYOA 4KUDB 4UUZB 3LZ0C 1U35A 1TAFB 1P3IA 5B2JD 1HTAA 3KFUG 3UTBB 3TU4B 1ZLAA 1ID3D 1EQZD 3RELA 4J8VA 4J8XD 3AZHD 5DNNB 3LJAB 1P3FD 3X1TB 5GSUA 1AOIC 2FFFB 2Y2HA 5CPKD 4J8WA 1P3GB 5AVBA 2XD1A 4KUDD 5B1LB 4WNNB 2DF4C 4G91B 3MNNB 3TU4D 4Z2MH 4QLCA 5B33B 3P5JB 2Y2IA 4H9RB 2CV5C 3LZ1B 4KGCC 5AV8B 5DNND 2Y2LA 3LJAD 5C3IC 3X1TD 3REHC 3KXBA 3AZLA 3REIB 5CHLB 1P3GD 3AZIB 3W98A 5AV9C 5B1LD 5GT0A 1P3LA 3KSYA 2NQBC 3H0RC 2HIOB 2DQNC 5B0YC 3AYWD 5JA4B 3WTPC 3MNND 5B33D 3FDDA 5BO0A 1P3OA 3LZ1D 3AZGB 4NE6A 1HQ3B 2W8SA 3MGSA 3AZMB 3EPHA 5BNVA 3A6NB 3REID 4AWLC 1M1AC 4H9SC 2ZY3A 4R8PC 3AZID 4LD9A 1F66B 1PZRA 3B0CW 1P3BB 5BNXA 2HIOD 2YFVB 3AZJC 3WA9B 3LZ0A 2F8NH 3X1VB 3AZGD 3WAAC 2JCHA 2F8NA 1HQ3D 3MGPB 3AZFC 1P3KC 4ZUXC 2IO5C 1S32B 3F6TA 3A6ND 4J8UC 3REJC 5B1MB 4XUJC 1AOIA 3MGRB 5AVCB 3AZNC 4WU8D 1P3BD 3AV2C 3WA9D 1KX5A 3AFAD 5F99B 1KX4A 5CPJC 5DNMB 4NE5A 2CV5A 3V9RA 4KGCA 3MGPD 5CPIB 4E45A 5GXQA 5B32G 1S32D 3B6FC 1M18D 4WU8A 3AN2C 4WV4B 5B1MD 3REHA 3MGRD 4X23C 5B0ZB 1TZYB 5AVCD 2JE5A 4EO5C 4XZQC 3NQUA 3WKJC 4KHAB 5JRGD 5AV9A 1KU5A 2NQBA 5B0YA 2PYOB 3WTPA 3B0CT 3REKC 4H9OA 2G5HC 1U35B 1P3IB 3KUYC 1ZLAB 2AROC 3AZKC 3RELB 1F1EA 5BT1C 3A1IA 3X1UD 1M1AA 1TZYD 4R8PA 5E5AC 3MVDC 2UWXA 2HUEC 5AVBB 2FJ7C 2PYOD 3AZJA 3WTPE 1U35D 2Y2KA 2F8NK 1P3ID 2NZDC 4J8XB 3AZHB 3WAAA 3X1UA 4QLCB 3KWQC 4JJNC 1ZLAD 4CSRA 3RELD 4J8VD 4ZUXA 1P34C 1P3KA 3W99C 3R45A 4J8UA 3REJA 5GSUD 4XUJA 3UTBC 3KXBB 3AZLB 5CP6C 1Z2CB 4J8WD 3AZNA 4DRAA 3AV2A 3W98B 5AVBD 4YM6C 5GT0B 1P3LB 3W96C 3A1KA 5CPJA 3X1SC 4QLCD 1P3OB 5BO0B 1P3GC 4DRBA 3NQJA 2J8PA 4HGAC 3MGSB 4G91C 3AN2A 3KXBD 3AZLD 5BNVB 1R4VA 4X23A 3C1CC 3AYWB 5AV5C 3UTAC 3W98D 4LD9B 4XZQA 3WKJA 5AV8C 5GT0D 1P3LD 3UT9C 5BNXB 3REKA 3LZ0B 1P3OD 3KUYA 4H9QA 2F8NB 2AROA 3AZKA 3MGSD 5B24C 2Y2PA 5FUGA 2VQRA 2RVQD 5B40C 1P3PC 3IP4C 3EPJA 4LD9D 5E5AA 3VH5A 3MVDA 4NFTA 3AZMC 1H3OA 5GT3C 3AZFA 2FJ7A 3EG5B 1KX5B 3LZ0D 1KX4B 2NZDA 1F66C 4G92C 1M19C 3AL0C 4Z66C 4JJNA 3KWQA 3V9RB 2F8ND 4KGCB 5GXQB 3C1BC 1P34A 3W99A 3H0LC 3X1VC 4WU8B 3REHB 3UTBA 1AOID 5CP6A 4WU9C 3AFAB 1KX3C 4YM6A 1S32C 3NQUB 5AV9B 3W96A 1KX5D 4H9PB 5B32C 1KX4D 5B0YB 3AZEC 3WTPB 3H0MC 4H9OB 3X1SA 1M18B 2CV5D 4KGCD 5GXQD 3B0BA 4CAYA 3W97C 4WJ3C 5AY8C 3B0DC 5F99C 3O62C 2JSSA 2YFWB 3REHD 4Z5TC 5DNMC 5B2IC 5JRGB 4H9RA 4YS3C 3C1CA 4AWLB 1M1AB 5CPIC 4R8PB 5AV5A 3UTAA 5AV6C 5AV9D 1P3MC 4DQYB 2NQBD 3B6GC 3UT9A 3VH6T 5B0YD 3AZJB 3WTPD 5B0ZC 3MGQC 4H9NB 5B31C 3WAAB 3X1UB 3EPKA 3LELC 3AV1C 4CSRB 5B24A 4E44A 4ZUXB 2IO5B 2BYKA 3R45B 1P3AC 5B40A 2G5IC 1P3PA 1M1AD 3REJB 2ZY5A 1BFMA 4XUJB 4R8PD 3AZMA 3AZNB 5GT3A 3AV2B 2Y2OA 4UPKA 3AZJD 1B67A 2ZY4A 5CPJB 4J8VB 5B31G 1M19A 4Z66A 3WAAD 5B2JC 4H9SA 5GSUB 5BS7C 3C1BA 3NQJB 2Y2NA 4ZUXD 1P3KD 2Y2GA 1ID3C 1EQZC 3X1VA 4J8UD 4J8WB 3REJD 3AN2B 4J8XC 3AZHC 4XUJD 4QLCC 4X23B 1P3FC 4WU9A 1KX3A 3AZND 4EO5B 3AV2D 2CWEA 4XZQB 1N1JA 3WKJB 5CPKC 1WWIA 2Y2JA 5B32A 5CPJD 4KUDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE A;  3REK B;  5KDM A;  3KUY B;  3VH5 T;  4H9Q B;  3TU4 C;  5GT0 C;  3W97 A;  5AY8 A;  2ARO B;  5F99 A;  3O62 A;  3AZK B;  3AN2 D;  4Z5T A;  5DNM A;  5B2I A;  5FUG B;  5DNN C;  4X23 D;  3LJA C;  4YS3 A;  3X1T C;  5G49 A;  5CPI A;  2L5A A;  5AV6 A;  5E5A B;  4XZQ D;  3WKJ D;  3MVD B;  1P3M A;  3MGS C;  3B6G A;  4Z2M G;  1BH9 A;  1H3O B;  2HUE B;  2FJ7 B;  5B1L C;  5B0Z A;  4WZS B;  3REK D;  3B6F A;  3MGQ A;  5B31 A;  3AYW C;  3KUY D;  2NZD B;  3MNN C;  4ZBJ B;  2BYM A;  5B33 C;  4JJN B;  3KWQ B;  3LZ1 C;  2ARO D;  3LEL A;  3AZK D;  3AV1 A;  1P34 B;  3W99 B;  1P3A A;  5BT1 D;  5CP6 B;  3REI C;  5E5A D;  3MVD D;  1BH8 A;  3AZI C;  4YM6 B;  2FJ7 D;  3W96 B;  2HIO C;  2NZD D;  3X1S B;  4JJN D;  5B2J A;  3KWQ D;  5BS7 A;  3AZG C;  1AOI B;  1P34 D;  4CAY B;  3W99 D;  3VH6 W;  1KX5 C;  1ID3 A;  1EQZ A;  4HGA B;  1HQ3 C;  1KX4 C;  1JFI A;  4J8X A;  3AZH A;  3UTB D;  5CP6 D;  3A6N C;  1P3F A;  3C1C B;  5GXQ C;  2F8N G;  5AV5 B;  3UTA B;  4YM6 D;  5CPK A;  4NE3 A;  4WU8 C;  2CV5 B;  1P3B C;  3W96 D;  3UT9 B;  4KUD A;  4UUZ A;  3WA9 C;  2LY8 A;  3AFA C;  1TAF A;  3X1S D;  5C3I B;  3TU4 A;  3MGP C;  5B24 B;  2BYK B;  1M18 C;  5DNN A;  5B40 B;  1ULY A;  3LJA A;  3C1C D;  3X1T A;  1P3P B;  5B1M C;  2NQB B;  5AV5 D;  3UTA D;  3MGR C;  5AV8 D;  5AVC C;  1P3G A;  5GT3 B;  3UT9 D;  5B1L A;  5JRG C;  1B6W A;  4WNN A;  3AYW A;  3MNN A;  4G92 B;  1M19 B;  4Z66 B;  5B33 A;  3LZ1 A;  5B24 D;  3C1B B;  5AV8 A;  5B40 D;  1P3P D;  3REI A;  3VH5 W;  3X1U C;  4WU9 B;  1TZY C;  3AZM D;  1KX3 B;  3AZI A;  5GT3 D;  1N1J B;  1A7W A;  2HIO A;  5B32 B;  3AZF B;  2PYO C;  5JA4 A;  1P3K B;  1F66 D;  3AZE B;  1M19 D;  1U35 C;  4Z66 D;  4J8U B;  5KDM B;  1P3I C;  3AZG A;  3C1B D;  3W97 B;  1ZLA C;  5AY8 B;  1HQ3 A;  3B0D B;  3X1V D;  3O62 B;  3REL C;  4J8V C;  4Z5T B;  5B2I B;  3A6N A;  4YS3 B;  4WU9 D;  5G49 B;  5GSU C;  1KX3 D;  5AV6 B;  1F66 A;  1P3M B;  4J8W C;  1P3B A;  3B6G B;  1BH9 B;  5AVB C;  5B32 D;  3AZF D;  2YFV A;  3AZE D;  3WA9 A;  3AFA A;  3B6F B;  3MGQ B;  5B31 B;  2BYM B;  3W97 D;  4H9P A;  5AY8 D;  5F99 D;  3LEL B;  3O62 D;  3MGP A;  3AV1 B;  1S32 A;  4Z5T D;  5DNM D;  5B2I D;  1P3A B;  1M18 A;  4YS3 D;  1WWS A;  5B1M A;  5CPI D;  3KXB C;  3AZL C;  5AV6 D;  3MGR A;  5AVC A;  1BH8 B;  1P3M D;  2YFW A;  3B6G D;  3W98 C;  1Q9C A;  5JRG A;  1P3L C;  5B0Z D;  3B6F D;  3MGQ D;  5B31 D;  1P3O C;  5B2J B;  3LEL D;  3AV1 D;  1ID3 B;  1EQZ B;  4H9N A;  1P3A D;  1JFI B;  4M6B A;  4ZBJ C;  2RVQ C;  1P3F B;  1TZY A;  4LD9 C;  3VH6 A;  4KHA A;  5CPK B;  2PYO A;  4KUD B;  4UUZ B;  3LZ0 C;  1U35 A;  1TAF B;  1P3I A;  5B2J D;  1HTA A;  3UTB B;  3TU4 B;  1ZLA A;  1ID3 D;  1EQZ D;  3REL A;  4J8V A;  4J8X D;  3AZH D;  5DNN B;  3LJA B;  1P3F D;  3X1T B;  5GSU A;  1AOI C;  5CPK D;  4J8W A;  1P3G B;  5AVB A;  4KUD D;  5B1L B;  4WNN B;  4G91 B;  3MNN B;  3TU4 D;  4Z2M H;  4QLC A;  5B33 B;  2CV5 C;  4H9R B;  3LZ1 B;  4KGC C;  5AV8 B;  5DNN D;  3LJA D;  5C3I C;  3X1T D;  3REH C;  3KXB A;  3AZL A;  3REI B;  5CHL B;  1P3G D;  3AZI B;  3W98 A;  5AV9 C;  5B1L D;  5GT0 A;  1P3L A;  3KSY A;  2NQB C;  2HIO B;  5B0Y C;  3AYW D;  5JA4 B;  3WTP C;  3MNN D;  5B33 D;  5BO0 A;  1P3O A;  3LZ1 D;  3AZG B;  4NE6 A;  1HQ3 B;  3AZM B;  3MGS A;  5BNV A;  3A6N B;  3REI D;  4AWL C;  1M1A C;  4H9S C;  4R8P C;  3AZI D;  4LD9 A;  1F66 B;  3B0C W;  1P3B B;  5BNX A;  2HIO D;  2YFV B;  3AZJ C;  3WA9 B;  3LZ0 A;  2F8N H;  3X1V B;  3AZG D;  3WAA C;  2F8N A;  1HQ3 D;  3MGP B;  3AZF C;  1P3K C;  4ZUX C;  2IO5 C;  1S32 B;  3A6N D;  4J8U C;  3REJ C;  5B1M B;  4XUJ C;  1AOI A;  3MGR B;  5AVC B;  3AZN C;  4WU8 D;  1P3B D;  3AV2 C;  3WA9 D;  1KX5 A;  3AFA D;  5F99 B;  1KX4 A;  5CPJ C;  5DNM B;  4NE5 A;  2CV5 A;  3V9R A;  4KGC A;  3MGP D;  5CPI B;  4E45 A;  5GXQ A;  5B32 G;  1S32 D;  3B6F C;  1M18 D;  4WU8 A;  3AN2 C;  4WV4 B;  5B1M D;  3REH A;  3MGR D;  4X23 C;  5B0Z B;  1TZY B;  5AVC D;  4EO5 C;  4XZQ C;  3NQU A;  3WKJ C;  5AV9 A;  5JRG D;  4KHA B;  1KU5 A;  2NQB A;  5B0Y A;  2PYO B;  3WTP A;  3B0C T;  3REK C;  4H9O A;  1U35 B;  1P3I B;  3KUY C;  1ZLA B;  2ARO C;  3AZK C;  3REL B;  1F1E A;  5BT1 C;  3X1U D;  1M1A A;  1TZY D;  4R8P A;  5E5A C;  3MVD C;  2HUE C;  5AVB B;  2FJ7 C;  2PYO D;  3AZJ A;  3WTP E;  1U35 D;  2F8N K;  1P3I D;  2NZD C;  4J8X B;  3AZH B;  3WAA A;  3X1U A;  4QLC B;  3KWQ C;  4JJN C;  1ZLA D;  4CSR A;  3REL D;  4J8V D;  4ZUX A;  1P34 C;  1P3K A;  3W99 C;  3R45 A;  4J8U A;  3REJ A;  5GSU D;  4XUJ A;  3UTB C;  3KXB B;  3AZL B;  5CP6 C;  4J8W D;  3AZN A;  4DRA A;  3AV2 A;  3W98 B;  5AVB D;  4YM6 C;  5GT0 B;  1P3L B;  3W96 C;  5CPJ A;  3X1S C;  4QLC D;  1P3O B;  5BO0 B;  1P3G C;  4DRB A;  3NQJ A;  4HGA C;  3MGS B;  4G91 C;  3AN2 A;  3KXB D;  3AZL D;  5BNV B;  1R4V A;  4X23 A;  3C1C C;  3AYW B;  5AV5 C;  3UTA C;  3W98 D;  4LD9 B;  4XZQ A;  3WKJ A;  5AV8 C;  5GT0 D;  1P3L D;  3UT9 C;  5BNX B;  3REK A;  3LZ0 B;  1P3O D;  3KUY A;  4H9Q A;  2F8N B;  2ARO A;  3AZK A;  3MGS D;  5B24 C;  5FUG A;  5B40 C;  2RVQ D;  1P3P C;  4LD9 D;  5E5A A;  3VH5 A;  3MVD A;  4NFT A;  3AZM C;  1H3O A;  5GT3 C;  3AZF A;  2FJ7 A;  1KX5 B;  3LZ0 D;  1KX4 B;  2NZD A;  1F66 C;  4G92 C;  1M19 C;  4Z66 C;  4JJN A;  3KWQ A;  3V9R B;  2F8N D;  4KGC B;  5GXQ B;  3C1B C;  1P34 A;  3W99 A;  3X1V C;  4WU8 B;  3REH B;  3UTB A;  1AOI D;  5CP6 A;  4WU9 C;  3AFA B;  1KX3 C;  4YM6 A;  1S32 C;  3NQU B;  5AV9 B;  3W96 A;  1KX5 D;  4H9P B;  5B32 C;  1KX4 D;  5B0Y B;  3AZE C;  3WTP B;  3X1S A;  4H9O B;  1M18 B;  2CV5 D;  4KGC D;  5GXQ D;  3B0B A;  4CAY A;  3W97 C;  5AY8 C;  3B0D C;  5F99 C;  3O62 C;  2JSS A;  2YFW B;  3REH D;  4Z5T C;  5DNM C;  5B2I C;  5JRG B;  4H9R A;  4YS3 C;  3C1C A;  4AWL B;  1M1A B;  5CPI C;  4R8P B;  5AV5 A;  3UTA A;  5AV6 C;  5AV9 D;  1P3M C;  2NQB D;  3B6G C;  3UT9 A;  3VH6 T;  5B0Y D;  3AZJ B;  3WTP D;  5B0Z C;  3MGQ C;  4H9N B;  5B31 C;  3WAA B;  3X1U B;  3LEL C;  3AV1 C;  4CSR B;  5B24 A;  4E44 A;  4ZUX B;  2IO5 B;  2BYK A;  3R45 B;  1P3A C;  5B40 A;  1P3P A;  1M1A D;  3REJ B;  1BFM A;  4XUJ B;  4R8P D;  3AZM A;  3AZN B;  5GT3 A;  3AV2 B;  3AZJ D;  1B67 A;  5CPJ B;  4J8V B;  5B31 G;  1M19 A;  4Z66 A;  3WAA D;  5B2J C;  4H9S A;  5GSU B;  5BS7 C;  3C1B A;  3NQJ B;  4ZUX D;  1P3K D;  1ID3 C;  1EQZ C;  3X1V A;  4J8U D;  4J8W B;  3REJ D;  3AN2 B;  4J8X C;  3AZH C;  4XUJ D;  4QLC C;  4X23 B;  1P3F C;  4WU9 A;  1KX3 A;  3AZN D;  4EO5 B;  3AV2 D;  2CWE A;  4XZQ B;  1N1J A;  3WKJ B;  5CPK C;  1WWI A;  5B32 A;  5CPJ D;  4KUD C; 
#chains in the Genus database with same CATH topology
 3AZE A;  3REK B;  5KDM A;  2BG1 A;  3KUY B;  3VH5 T;  4H9Q B;  3TU4 C;  5GT0 C;  3W97 A;  5AY8 A;  2ARO B;  5F99 A;  3O62 A;  3AZK B;  3AN2 D;  4Z5T A;  5DNM A;  5B2I A;  5FUG B;  5DNN C;  4X23 D;  3LJA C;  4YS3 A;  3X1T C;  5G49 A;  5CPI A;  2L5A A;  5AV6 A;  5E5A B;  4XZQ D;  3WKJ D;  3MVD B;  1P3M A;  3MGS C;  3B6G A;  4Z2M G;  1BH9 A;  1H3O B;  2HUE B;  3EPL A;  2FJ7 B;  5B1L C;  1T3U A;  5B0Z A;  4WZS B;  3REK D;  3B6F A;  3MGQ A;  5B31 A;  3AYW C;  3KUY D;  2NZD B;  3MNN C;  4ZBJ B;  2BYM A;  5B33 C;  4JJN B;  3KWQ B;  3LZ1 C;  2ARO D;  3LEL A;  3AZK D;  3AV1 A;  1P34 B;  3W99 B;  1P3A A;  5BT1 D;  5CP6 B;  3REI C;  5E5A D;  3MVD D;  1BH8 A;  3AZI C;  4YM6 B;  2FJ7 D;  3W96 B;  2HIO C;  2ZM5 A;  2NZD D;  3X1S B;  4JJN D;  5B2J A;  3KWQ D;  5BS7 A;  3AZG C;  1AOI B;  1P34 D;  4CAY B;  3VH6 W;  3W99 D;  1KX5 C;  1ID3 A;  1EQZ A;  4HGA B;  1HQ3 C;  1KX4 C;  1JFI A;  4J8X A;  3AZH A;  3UTB D;  5CP6 D;  3A6N C;  1P3F A;  3C1C B;  5GXQ C;  2F8N G;  5AV5 B;  3UTA B;  4YM6 D;  5CPK A;  4NE3 A;  4WU8 C;  2CV5 B;  1P3B C;  3W96 D;  3UT9 B;  4KUD A;  4UUZ A;  3WA9 C;  2LY8 A;  3AFA C;  1TAF A;  3X1S D;  5C3I B;  3TU4 A;  3MGP C;  5B24 B;  2BYK B;  1M18 C;  5DNN A;  5B40 B;  1ULY A;  3LJA A;  3C1C D;  3X1T A;  1P3P B;  5B1M C;  2NQB B;  5AV5 D;  3UTA D;  3MGR C;  5AV8 D;  5AVC C;  1P3G A;  2Y2M A;  5GT3 B;  3UT9 D;  5B1L A;  5JRG C;  1B6W A;  2F2A C;  4WNN A;  3AYW A;  3MNN A;  4G92 B;  1M19 B;  4Z66 B;  5B33 A;  3LZ1 A;  5B24 D;  3C1B B;  5AV8 A;  5B40 D;  1P3P D;  3REI A;  3VH5 W;  2RIQ A;  3X1U C;  4WU9 B;  1TZY C;  3AZM D;  1KX3 B;  3AZI A;  5GT3 D;  1N1J B;  1A7W A;  2HIO A;  5B32 B;  3AZF B;  2PYO C;  5JA4 A;  1P3K B;  1F66 D;  3AZE B;  1M19 D;  1U35 C;  4Z66 D;  4J8U B;  5KDM B;  1P3I C;  3AZG A;  3C1B D;  3W97 B;  1ZLA C;  5AY8 B;  1HQ3 A;  3B0D B;  3X1V D;  3O62 B;  3REL C;  4J8V C;  4Z5T B;  5B2I B;  3A6N A;  4YS3 B;  4WU9 D;  5G49 B;  5GSU C;  1KX3 D;  5AV6 B;  1F66 A;  1P3M B;  4J8W C;  1P3B A;  3B6G B;  1BH9 B;  5AVB C;  5B32 D;  3AZF D;  2YFV A;  3AZE D;  3WA9 A;  3AFA A;  3B6F B;  3MGQ B;  5B31 B;  2BYM B;  3W97 D;  4H9P A;  5AY8 D;  5F99 D;  3LEL B;  3O62 D;  3MGP A;  3AV1 B;  2Y2Q A;  1S32 A;  4Z5T D;  5DNM D;  5B2I D;  1P3A B;  1M18 A;  4YS3 D;  2ZY2 A;  1WWS A;  5B1M A;  5CPI D;  3KXB C;  3AZL C;  5AV6 D;  3MGR A;  5AVC A;  1BH8 B;  1P3M D;  2YFW A;  3B6G D;  3W98 C;  1Q9C A;  5JRG A;  1P3L C;  5B0Z D;  3B6F D;  3MGQ D;  5B31 D;  1W2E A;  1P3O C;  5B2J B;  3LEL D;  3AV1 D;  1ID3 B;  1EQZ B;  4H9N A;  1P3A D;  2XD5 A;  1JFI B;  4M6B A;  4ZBJ C;  2RVQ C;  1P3F B;  1TZY A;  4LD9 C;  3VH6 A;  4KHA A;  5CPK B;  2PYO A;  4KUD B;  4UUZ B;  3LZ0 C;  1U35 A;  1TAF B;  1P3I A;  5B2J D;  1HTA A;  3KFU G;  3UTB B;  3TU4 B;  1ZLA A;  1ID3 D;  1EQZ D;  3REL A;  4J8V A;  4J8X D;  3AZH D;  5DNN B;  3LJA B;  1P3F D;  3X1T B;  5GSU A;  1AOI C;  2FFF B;  2Y2H A;  5CPK D;  4J8W A;  1P3G B;  5AVB A;  2XD1 A;  4KUD D;  5B1L B;  4WNN B;  2DF4 C;  4G91 B;  3MNN B;  3TU4 D;  4Z2M H;  4QLC A;  5B33 B;  3P5J B;  2Y2I A;  4H9R B;  2CV5 C;  3LZ1 B;  4KGC C;  5AV8 B;  5DNN D;  2Y2L A;  3LJA D;  5C3I C;  3X1T D;  3REH C;  3KXB A;  3AZL A;  3REI B;  5CHL B;  1P3G D;  3AZI B;  3W98 A;  5AV9 C;  5B1L D;  5GT0 A;  1P3L A;  3KSY A;  2NQB C;  3H0R C;  2HIO B;  2DQN C;  5B0Y C;  3AYW D;  5JA4 B;  3WTP C;  3MNN D;  5B33 D;  3FDD A;  5BO0 A;  1P3O A;  3LZ1 D;  3AZG B;  4NE6 A;  1HQ3 B;  2W8S A;  3MGS A;  3AZM B;  3EPH A;  5BNV A;  3A6N B;  3REI D;  4AWL C;  1M1A C;  4H9S C;  2ZY3 A;  4R8P C;  3AZI D;  4LD9 A;  1F66 B;  1PZR A;  3B0C W;  1P3B B;  5BNX A;  2HIO D;  2YFV B;  3AZJ C;  3WA9 B;  3LZ0 A;  2F8N H;  3X1V B;  3AZG D;  3WAA C;  2JCH A;  2F8N A;  1HQ3 D;  3MGP B;  3AZF C;  1P3K C;  4ZUX C;  2IO5 C;  1S32 B;  3F6T A;  3A6N D;  4J8U C;  3REJ C;  5B1M B;  4XUJ C;  1AOI A;  3MGR B;  5AVC B;  3AZN C;  4WU8 D;  1P3B D;  3AV2 C;  3WA9 D;  1KX5 A;  3AFA D;  5F99 B;  1KX4 A;  5CPJ C;  5DNM B;  4NE5 A;  2CV5 A;  3V9R A;  4KGC A;  3MGP D;  5CPI B;  4E45 A;  5GXQ A;  5B32 G;  1S32 D;  3B6F C;  1M18 D;  4WU8 A;  3AN2 C;  4WV4 B;  5B1M D;  3REH A;  3MGR D;  4X23 C;  5B0Z B;  1TZY B;  5AVC D;  2JE5 A;  4EO5 C;  4XZQ C;  3NQU A;  3WKJ C;  4KHA B;  5JRG D;  5AV9 A;  1KU5 A;  2NQB A;  5B0Y A;  2PYO B;  3WTP A;  3B0C T;  3REK C;  4H9O A;  2G5H C;  1U35 B;  1P3I B;  3KUY C;  1ZLA B;  2ARO C;  3AZK C;  3REL B;  1F1E A;  5BT1 C;  3A1I A;  3X1U D;  1M1A A;  1TZY D;  4R8P A;  5E5A C;  3MVD C;  2UWX A;  2HUE C;  5AVB B;  2FJ7 C;  2PYO D;  3AZJ A;  3WTP E;  1U35 D;  2Y2K A;  2F8N K;  1P3I D;  2NZD C;  4J8X B;  3AZH B;  3WAA A;  3X1U A;  4QLC B;  3KWQ C;  4JJN C;  1ZLA D;  4CSR A;  3REL D;  4J8V D;  4ZUX A;  1P34 C;  1P3K A;  3W99 C;  3R45 A;  4J8U A;  3REJ A;  5GSU D;  4XUJ A;  3UTB C;  3KXB B;  3AZL B;  5CP6 C;  1Z2C B;  4J8W D;  3AZN A;  4DRA A;  3AV2 A;  3W98 B;  5AVB D;  4YM6 C;  5GT0 B;  1P3L B;  3W96 C;  3A1K A;  5CPJ A;  3X1S C;  4QLC D;  1P3O B;  5BO0 B;  1P3G C;  4DRB A;  3NQJ A;  2J8P A;  4HGA C;  3MGS B;  4G91 C;  3AN2 A;  3KXB D;  3AZL D;  5BNV B;  1R4V A;  4X23 A;  3C1C C;  3AYW B;  5AV5 C;  3UTA C;  3W98 D;  4LD9 B;  4XZQ A;  3WKJ A;  5AV8 C;  5GT0 D;  1P3L D;  3UT9 C;  5BNX B;  3REK A;  3LZ0 B;  1P3O D;  3KUY A;  4H9Q A;  2F8N B;  2ARO A;  3AZK A;  3MGS D;  5B24 C;  2Y2P A;  5FUG A;  2VQR A;  2RVQ D;  5B40 C;  1P3P C;  3IP4 C;  3EPJ A;  4LD9 D;  5E5A A;  3VH5 A;  3MVD A;  4NFT A;  3AZM C;  1H3O A;  5GT3 C;  3AZF A;  2FJ7 A;  3EG5 B;  1KX5 B;  3LZ0 D;  1KX4 B;  2NZD A;  1F66 C;  4G92 C;  1M19 C;  3AL0 C;  4Z66 C;  4JJN A;  3KWQ A;  3V9R B;  2F8N D;  4KGC B;  5GXQ B;  3C1B C;  1P34 A;  3W99 A;  3H0L C;  3X1V C;  4WU8 B;  3REH B;  3UTB A;  1AOI D;  5CP6 A;  4WU9 C;  3AFA B;  1KX3 C;  4YM6 A;  1S32 C;  3NQU B;  5AV9 B;  3W96 A;  1KX5 D;  4H9P B;  5B32 C;  1KX4 D;  5B0Y B;  3AZE C;  3WTP B;  3H0M C;  4H9O B;  3X1S A;  1M18 B;  2CV5 D;  4KGC D;  5GXQ D;  3B0B A;  4CAY A;  3W97 C;  4WJ3 C;  5AY8 C;  3B0D C;  5F99 C;  3O62 C;  2JSS A;  2YFW B;  3REH D;  4Z5T C;  5DNM C;  5B2I C;  5JRG B;  4H9R A;  4YS3 C;  3C1C A;  4AWL B;  1M1A B;  5CPI C;  4R8P B;  5AV5 A;  3UTA A;  5AV6 C;  5AV9 D;  1P3M C;  4DQY B;  2NQB D;  3B6G C;  3UT9 A;  3VH6 T;  5B0Y D;  3AZJ B;  3WTP D;  5B0Z C;  3MGQ C;  4H9N B;  5B31 C;  3WAA B;  3X1U B;  3EPK A;  3LEL C;  3AV1 C;  4CSR B;  5B24 A;  4E44 A;  4ZUX B;  2IO5 B;  2BYK A;  3R45 B;  1P3A C;  5B40 A;  2G5I C;  1P3P A;  1M1A D;  3REJ B;  2ZY5 A;  1BFM A;  4XUJ B;  4R8P D;  3AZM A;  3AZN B;  5GT3 A;  3AV2 B;  2Y2O A;  4UPK A;  3AZJ D;  1B67 A;  2ZY4 A;  5CPJ B;  4J8V B;  5B31 G;  1M19 A;  4Z66 A;  3WAA D;  5B2J C;  4H9S A;  5GSU B;  5BS7 C;  3C1B A;  3NQJ B;  2Y2N A;  4ZUX D;  1P3K D;  2Y2G A;  1ID3 C;  1EQZ C;  3X1V A;  4J8U D;  4J8W B;  3REJ D;  3AN2 B;  4J8X C;  3AZH C;  4XUJ D;  4QLC C;  4X23 B;  1P3F C;  4WU9 A;  1KX3 A;  3AZN D;  4EO5 B;  3AV2 D;  2CWE A;  4XZQ B;  1N1J A;  3WKJ B;  5CPK C;  1WWI A;  2Y2J A;  5B32 A;  5CPJ D;  4KUD C; 
#chains in the Genus database with same CATH homology
 3AZE A;  3REK B;  5KDM A;  2BG1 A;  3KUY B;  3VH5 T;  4H9Q B;  3TU4 C;  5GT0 C;  3W97 A;  5AY8 A;  2ARO B;  5F99 A;  3O62 A;  3AZK B;  3AN2 D;  4Z5T A;  5DNM A;  5B2I A;  5FUG B;  5DNN C;  4X23 D;  3LJA C;  4YS3 A;  3X1T C;  5G49 A;  5CPI A;  2L5A A;  5AV6 A;  5E5A B;  4XZQ D;  3WKJ D;  3MVD B;  1P3M A;  3MGS C;  3B6G A;  4Z2M G;  1BH9 A;  1H3O B;  2HUE B;  3EPL A;  2FJ7 B;  5B1L C;  1T3U A;  5B0Z A;  4WZS B;  3REK D;  3B6F A;  3MGQ A;  5B31 A;  3AYW C;  3KUY D;  2NZD B;  3MNN C;  4ZBJ B;  2BYM A;  5B33 C;  4JJN B;  3KWQ B;  3LZ1 C;  2ARO D;  3LEL A;  3AZK D;  3AV1 A;  1P34 B;  3W99 B;  1P3A A;  5BT1 D;  5CP6 B;  3REI C;  5E5A D;  3MVD D;  1BH8 A;  3AZI C;  4YM6 B;  2FJ7 D;  3W96 B;  2HIO C;  2ZM5 A;  2NZD D;  3X1S B;  4JJN D;  5B2J A;  3KWQ D;  5BS7 A;  3AZG C;  1AOI B;  1P34 D;  4CAY B;  3VH6 W;  3W99 D;  1KX5 C;  1ID3 A;  1EQZ A;  4HGA B;  1HQ3 C;  1KX4 C;  1JFI A;  4J8X A;  3AZH A;  3UTB D;  5CP6 D;  3A6N C;  1P3F A;  3C1C B;  5GXQ C;  2F8N G;  5AV5 B;  3UTA B;  4YM6 D;  5CPK A;  4NE3 A;  4WU8 C;  2CV5 B;  1P3B C;  3W96 D;  3UT9 B;  4KUD A;  4UUZ A;  3WA9 C;  2LY8 A;  3AFA C;  1TAF A;  3X1S D;  5C3I B;  3TU4 A;  3MGP C;  5B24 B;  2BYK B;  1M18 C;  5DNN A;  5B40 B;  1ULY A;  3LJA A;  3C1C D;  3X1T A;  1P3P B;  5B1M C;  2NQB B;  5AV5 D;  3UTA D;  3MGR C;  5AV8 D;  5AVC C;  1P3G A;  2Y2M A;  5GT3 B;  3UT9 D;  5B1L A;  5JRG C;  1B6W A;  2F2A C;  4WNN A;  3AYW A;  3MNN A;  4G92 B;  1M19 B;  4Z66 B;  5B33 A;  3LZ1 A;  5B24 D;  3C1B B;  5AV8 A;  5B40 D;  1P3P D;  3REI A;  3VH5 W;  2RIQ A;  3X1U C;  4WU9 B;  1TZY C;  3AZM D;  1KX3 B;  3AZI A;  5GT3 D;  1N1J B;  1A7W A;  2HIO A;  5B32 B;  3AZF B;  2PYO C;  5JA4 A;  1P3K B;  1F66 D;  3AZE B;  1M19 D;  1U35 C;  4Z66 D;  4J8U B;  5KDM B;  1P3I C;  3AZG A;  3C1B D;  3W97 B;  1ZLA C;  5AY8 B;  1HQ3 A;  3B0D B;  3X1V D;  3O62 B;  3REL C;  4J8V C;  4Z5T B;  5B2I B;  3A6N A;  4YS3 B;  4WU9 D;  5G49 B;  5GSU C;  1KX3 D;  5AV6 B;  1F66 A;  1P3M B;  4J8W C;  1P3B A;  3B6G B;  1BH9 B;  5AVB C;  5B32 D;  3AZF D;  2YFV A;  3AZE D;  3WA9 A;  3AFA A;  3B6F B;  3MGQ B;  5B31 B;  2BYM B;  3W97 D;  4H9P A;  5AY8 D;  5F99 D;  3LEL B;  3O62 D;  3MGP A;  3AV1 B;  2Y2Q A;  1S32 A;  4Z5T D;  5DNM D;  5B2I D;  1P3A B;  1M18 A;  4YS3 D;  2ZY2 A;  1WWS A;  5B1M A;  5CPI D;  3KXB C;  3AZL C;  5AV6 D;  3MGR A;  5AVC A;  1BH8 B;  1P3M D;  2YFW A;  3B6G D;  3W98 C;  1Q9C A;  5JRG A;  1P3L C;  5B0Z D;  3B6F D;  3MGQ D;  5B31 D;  1W2E A;  1P3O C;  5B2J B;  3LEL D;  3AV1 D;  1ID3 B;  1EQZ B;  4H9N A;  1P3A D;  2XD5 A;  1JFI B;  4M6B A;  4ZBJ C;  2RVQ C;  1P3F B;  1TZY A;  4LD9 C;  3VH6 A;  4KHA A;  5CPK B;  2PYO A;  4KUD B;  4UUZ B;  3LZ0 C;  1U35 A;  1TAF B;  1P3I A;  5B2J D;  1HTA A;  3KFU G;  3UTB B;  3TU4 B;  1ZLA A;  1ID3 D;  1EQZ D;  3REL A;  4J8V A;  4J8X D;  3AZH D;  5DNN B;  3LJA B;  1P3F D;  3X1T B;  5GSU A;  1AOI C;  2FFF B;  2Y2H A;  5CPK D;  4J8W A;  1P3G B;  5AVB A;  2XD1 A;  4KUD D;  5B1L B;  4WNN B;  2DF4 C;  4G91 B;  3MNN B;  3TU4 D;  4Z2M H;  4QLC A;  5B33 B;  3P5J B;  2Y2I A;  4H9R B;  2CV5 C;  3LZ1 B;  4KGC C;  5AV8 B;  5DNN D;  2Y2L A;  3LJA D;  5C3I C;  3X1T D;  3REH C;  3KXB A;  3AZL A;  3REI B;  5CHL B;  1P3G D;  3AZI B;  3W98 A;  5AV9 C;  5B1L D;  5GT0 A;  1P3L A;  3KSY A;  2NQB C;  3H0R C;  2HIO B;  2DQN C;  5B0Y C;  3AYW D;  5JA4 B;  3WTP C;  3MNN D;  5B33 D;  3FDD A;  5BO0 A;  1P3O A;  3LZ1 D;  3AZG B;  4NE6 A;  1HQ3 B;  2W8S A;  3MGS A;  3AZM B;  3EPH A;  5BNV A;  3A6N B;  3REI D;  4AWL C;  1M1A C;  4H9S C;  2ZY3 A;  4R8P C;  3AZI D;  4LD9 A;  1F66 B;  1PZR A;  3B0C W;  1P3B B;  5BNX A;  2HIO D;  2YFV B;  3AZJ C;  3WA9 B;  3LZ0 A;  2F8N H;  3X1V B;  3AZG D;  3WAA C;  2JCH A;  2F8N A;  1HQ3 D;  3MGP B;  3AZF C;  1P3K C;  4ZUX C;  2IO5 C;  1S32 B;  3F6T A;  3A6N D;  4J8U C;  3REJ C;  5B1M B;  4XUJ C;  1AOI A;  3MGR B;  5AVC B;  3AZN C;  4WU8 D;  1P3B D;  3AV2 C;  3WA9 D;  1KX5 A;  3AFA D;  5F99 B;  1KX4 A;  5CPJ C;  5DNM B;  4NE5 A;  2CV5 A;  3V9R A;  4KGC A;  3MGP D;  5CPI B;  4E45 A;  5GXQ A;  5B32 G;  1S32 D;  3B6F C;  1M18 D;  4WU8 A;  3AN2 C;  4WV4 B;  5B1M D;  3REH A;  3MGR D;  4X23 C;  5B0Z B;  1TZY B;  5AVC D;  2JE5 A;  4EO5 C;  4XZQ C;  3NQU A;  3WKJ C;  4KHA B;  5JRG D;  5AV9 A;  1KU5 A;  2NQB A;  5B0Y A;  2PYO B;  3WTP A;  3B0C T;  3REK C;  4H9O A;  2G5H C;  1U35 B;  1P3I B;  3KUY C;  1ZLA B;  2ARO C;  3AZK C;  3REL B;  1F1E A;  5BT1 C;  3A1I A;  3X1U D;  1M1A A;  1TZY D;  4R8P A;  5E5A C;  3MVD C;  2UWX A;  2HUE C;  5AVB B;  2FJ7 C;  2PYO D;  3AZJ A;  3WTP E;  1U35 D;  2Y2K A;  2F8N K;  1P3I D;  2NZD C;  4J8X B;  3AZH B;  3WAA A;  3X1U A;  4QLC B;  3KWQ C;  4JJN C;  1ZLA D;  4CSR A;  3REL D;  4J8V D;  4ZUX A;  1P34 C;  1P3K A;  3W99 C;  3R45 A;  4J8U A;  3REJ A;  5GSU D;  4XUJ A;  3UTB C;  3KXB B;  3AZL B;  5CP6 C;  1Z2C B;  4J8W D;  3AZN A;  4DRA A;  3AV2 A;  3W98 B;  5AVB D;  4YM6 C;  5GT0 B;  1P3L B;  3W96 C;  3A1K A;  5CPJ A;  3X1S C;  4QLC D;  1P3O B;  5BO0 B;  1P3G C;  4DRB A;  3NQJ A;  2J8P A;  4HGA C;  3MGS B;  4G91 C;  3AN2 A;  3KXB D;  3AZL D;  5BNV B;  1R4V A;  4X23 A;  3C1C C;  3AYW B;  5AV5 C;  3UTA C;  3W98 D;  4LD9 B;  4XZQ A;  3WKJ A;  5AV8 C;  5GT0 D;  1P3L D;  3UT9 C;  5BNX B;  3REK A;  3LZ0 B;  1P3O D;  3KUY A;  4H9Q A;  2F8N B;  2ARO A;  3AZK A;  3MGS D;  5B24 C;  2Y2P A;  5FUG A;  2VQR A;  2RVQ D;  5B40 C;  1P3P C;  3IP4 C;  3EPJ A;  4LD9 D;  5E5A A;  3VH5 A;  3MVD A;  4NFT A;  3AZM C;  1H3O A;  5GT3 C;  3AZF A;  2FJ7 A;  3EG5 B;  1KX5 B;  3LZ0 D;  1KX4 B;  2NZD A;  1F66 C;  4G92 C;  1M19 C;  3AL0 C;  4Z66 C;  4JJN A;  3KWQ A;  3V9R B;  2F8N D;  4KGC B;  5GXQ B;  3C1B C;  1P34 A;  3W99 A;  3H0L C;  3X1V C;  4WU8 B;  3REH B;  3UTB A;  1AOI D;  5CP6 A;  4WU9 C;  3AFA B;  1KX3 C;  4YM6 A;  1S32 C;  3NQU B;  5AV9 B;  3W96 A;  1KX5 D;  4H9P B;  5B32 C;  1KX4 D;  5B0Y B;  3AZE C;  3WTP B;  3H0M C;  4H9O B;  3X1S A;  1M18 B;  2CV5 D;  4KGC D;  5GXQ D;  3B0B A;  4CAY A;  3W97 C;  4WJ3 C;  5AY8 C;  3B0D C;  5F99 C;  3O62 C;  2JSS A;  2YFW B;  3REH D;  4Z5T C;  5DNM C;  5B2I C;  5JRG B;  4H9R A;  4YS3 C;  3C1C A;  4AWL B;  1M1A B;  5CPI C;  4R8P B;  5AV5 A;  3UTA A;  5AV6 C;  5AV9 D;  1P3M C;  4DQY B;  2NQB D;  3B6G C;  3UT9 A;  3VH6 T;  5B0Y D;  3AZJ B;  3WTP D;  5B0Z C;  3MGQ C;  4H9N B;  5B31 C;  3WAA B;  3X1U B;  3EPK A;  3LEL C;  3AV1 C;  4CSR B;  5B24 A;  4E44 A;  4ZUX B;  2IO5 B;  2BYK A;  3R45 B;  1P3A C;  5B40 A;  2G5I C;  1P3P A;  1M1A D;  3REJ B;  2ZY5 A;  1BFM A;  4XUJ B;  4R8P D;  3AZM A;  3AZN B;  5GT3 A;  3AV2 B;  2Y2O A;  4UPK A;  3AZJ D;  1B67 A;  2ZY4 A;  5CPJ B;  4J8V B;  5B31 G;  1M19 A;  4Z66 A;  3WAA D;  5B2J C;  4H9S A;  5GSU B;  5BS7 C;  3C1B A;  3NQJ B;  2Y2N A;  4ZUX D;  1P3K D;  2Y2G A;  1ID3 C;  1EQZ C;  3X1V A;  4J8U D;  4J8W B;  3REJ D;  3AN2 B;  4J8X C;  3AZH C;  4XUJ D;  4QLC C;  4X23 B;  1P3F C;  4WU9 A;  1KX3 A;  3AZN D;  4EO5 B;  3AV2 D;  2CWE A;  4XZQ B;  1N1J A;  3WKJ B;  5CPK C;  1WWI A;  2Y2J A;  5B32 A;  5CPJ D;  4KUD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...