3AV2D

The human nucleosome structure containing the histone variant h3.3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.3
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2D00
3MNNB 4J8UC 5CPKD 5GT3B 3W96D 5AY8B 1KX3A 5AV9C 5B0ZA 5DNMA 4UUZB 4R8PB 4J8WC 2RVQD 5AVCB 5GT0A 1BH9B 5B31G 5B2IA 3AFAA 3LZ0C 2CV5D 4J8UA 3UTBD 1M19A 4YM6A 3AZIB 3WAAA 5G49B 1EQZB 4KGCA 5B1MC 3B6GC 1TZYA 3REJA 5AVBB 5B33C 4ZBJB 5B32B 3LELB 3AZKC 3W99D 1KX5A 3KWQC 3AV2A 1P3BC 3VH6W 3NQJA 3AZND 4J8VD 5C3IB 3B6GA 4WU9B 4KHAA 3X1SD 1KX4D 5E5AC 2BYKB 1R4VA 1A7WA 2FJ7A 5AV8B 1P3BD 1KX5C 3WA9A 5AV5A 1P3BA 2FJ7D 4LD9B 4EO5B 4J8VA 1P3AC 4WU8D 5AV9B 5B33B 1B6WA 5AY8C 1M1AC 1KX5D 3UT9A 1AOIB 4H9SA 4XUJA 3X1TB 4DRAA 3W97D 3X1UB 3W98B 4LD9C 4XUJD 5DNND 2BYMA 4Z2MG 5AVBC 5AV6B 5BNXA 4ZUXD 1ZLAD 3C1BD 3REID 2NZDB 4XUJC 5B40C 3AZFC 3AV1D 3AZEC 3AZJC 1TAFA 3LZ0B 4J8XD 2HIOC 5B2JB 4JJNA 1ZLAC 2NQBD 3REHB 4ZUXA 4J8WB 5B40D 5B31D 3AYWA 4Z66B 1F66C 4Z5TD 1F1EA 4Z5TB 5B31B 5GXQA 3MGQD 3X1VA 3REHD 5B2JD 3KXBA 4J8XB 1ID3A 3AV1B 2NZDD 3REHC 3C1BB 3REIB 1ZLAB 5B24C 2YFVB 3C1CB 1M19B 4YS3A 3NQUB 1U35A 4KGCB 3W98D 3X1VD 1N1JB 3X1UD 1ID3C 3X1TD 1P3GD 2CV5C 3VH5A 5B24A 5GT0D 5CPIC 3KUYB 3UTBC 1AOID 3AV2B 4H9OB 5B2IC 3B6GD 4QLCC 1P3GC 5B33D 5AV9D 4WU8B 4KHAB 4NE3A 4WU9A 5BNVA 2BYKA 2FJ7B 1TZYC 3LZ1A 5B32G 5CPIA 3KWQD 1BH8A 1P3BB 2F8NG 5GT3A 4Z2MH 5AV9A 5JRGB 4WU9D 3B0CT 3R45A 5DNMC 5B1LC 4R8PA 4G91B 4KUDB 1BFMA 2FJ7C 5B2IB 3RELD 2CWEA 3LELD 5DNMD 4WU8C 5B0YB 4YM6C 5B1MA 4WNNA 1P3AA 3VH6A 1P3MB 3AZGA 3AZHA 2CV5B 2AROA 3TU4A 5AV8C 3UTAA 1HQ3C 5AVCD 3B6FB 1TAFB 4CAYB 3LJAB 5B2JA 4JJNB 5AY8D 3AZLA 5GT3D 5CPKB 3MNND 1HQ3D 3MVDC 3AZGC 3AZHC 3UTAD 3MGSB 5CPJB 3WTPC 3AZGD 3AYWD 3AZHD 3AZEA 4H9RA 3AZJA 3AV1A 5DNNC 1P3KA 3MVDA 5B32A 4X23B 3WKJD 4JJNC 3LJAC 1B67A 3O62D 3MGQC 4ZUXC 1AOIA 3B6FC 3AYWC 3A6NB 3V9RA 4XZQD 3AZED 3AZJD 3WTPB 1P3KD 4H9PB 1P3FD 1U35D 1F66B 3B0DC 3AZFA 1ID3D 1KX3B 3WTPE 5B0ZB 4UUZA 3MGRB 4G91C 1U35C 4WV4B 3AZLD 4AWLC 5GXQD 5CP6D 1P3LD 1BH9A 3KXBD 2RVQC 2JSSA 4NE5A 5B24D 5F99B 4YM6B 3AZIA 1P3ID 5B0YC 1JFIA 3REKB 2PYOA 5JRGA 5GSUB 3KXBC 1TZYB 1P3GA 3X1TC 2BYMB 1P3LA 5FUGA 1KX4A 4KUDA 1HTAA 5B1LB 1P34C 2NZDA 2YFVA 3MGPB 3MGPD 2F8NB 5B0YA 5B1LD 2PYOC 3LZ0A 3VH5W 1P3AB 1H3OA 3X1SC 1P34D 3WAAC 1KX4C 1WWSA 1TZYD 2YFWB 2CV5A 4KGCC 1P34A 4G92C 4YM6D 5B31A 1P3IB 4H9OA 5F99D 5E5AB 1S32B 3KXBB 1Q9CA 4WU8A 3KWQA 3AV2C 4WU9C 1ULYA 3AZLB 5CPKA 4X23C 3MGRD 3VH6T 5KDMA 1M1AD 4QLCB 3WKJA 5B0ZD 5AV5D 1KX3D 5BS7C 3AZKB 2AROC 3TU4C 3AFAC 3MGRC 1U35B 5GT3C 1M19C 4Z66C 3C1CC 5AV5C 3B0CW 1P3KB 3MVDB 3W96C 5AY8A 5AV6A 5BT1C 5BS7A 2F8NK 3AZMB 3AZNA 1S32C 3AZFD 3W99A 3O62B 5CHLB 3AFAB 4J8XC 5BT1D 2HIOD 3WTPA 1P3FA 1P3PB 4J8UB 3LZ1B 2NQBC 3WA9D 3WAAB 3AYWB 3AZHB 5BO0B 3AZGB 5B1MD 3UTAB 5JA4A 3REJB 3MGQA 4H9NA 5AVBA 4XZQA 3B6FA 4J8XA 1HQ3B 5B40A 5B2JC 2LY8A 1P3FC 5CP6A 2IO5B 1P3OB 3AN2B 1M18B 2NQBA 4JJND 1M1AA 3NQJB 3LJAD 1P3MC 4EO5C 1ZLAA 3B6FD 4YS3B 4CSRB 4H9QB 4H9SC 2PYOB 1P3MD 1N1JA 5GXQC 5CP6C 3X1VC 5DNNA 1P3KC 1P3MA 3W97A 1P3IC 5B0YD 1AOIC 5DNMB 2HUEC 3UT9B 5GSUC 3UT9D 5B2ID 3RELB 5AVCA 4KUDD 4YS3C 5BNVB 2YFWA 5JRGD 3W97C 3X1TA 1P3LC 1KU5A 3X1UA 4KUDC 1F66A 2PYOD 5C3IC 4YS3D 3A6NC 3MGSA 4G92B 3LELA 3KWQB 5KDMB 3AN2D 4NE6A 3X1SA 1P3OD 1M18D 4DRBA 3B6GB 1EQZC 3RELC 3LZ1C 3A6NA 3MGPC 3MGSC 3AV2D 4AWLB 3V9RB 5B31C 3LELC 3AZIC 1JFIB 5GT0B 3KUYD 3REJD 3AN2C 2F8NH 4Z5TA 5B1MB 1P3GB 3WAAD 3WA9B 3LZ1D 4J8UD 3X1VB 1P3PD 5CPKC 4KGCD 2HIOB 3AFAD 4R8PC 5B1LA 3AZMA 1EQZA 3REJC 3MGPA 3UTBA 5B33A 5F99C 3C1CD 3AZFB 1M19D 2F8NA 4NFTA 4CAYA 4E44A 3AZMD 5CPJC 3MGRA 1H3OB 3C1CA 3NQUA 5B0ZC 5BO0A 3MVDD 3MNNC 3W96A 5F99A 3MGQB 5E5AA 5CPJA 3AZKD 5AV8A 3UTAC 1S32A 4Z66D 1HQ3A 4E45A 5B40B 4J8WD 3W99C 5BNXB 3KSYA 4H9RB 3WA9C 2NQBB 5AV5B 4QLCD 4X23A 1M1AB 3MNNA 4WZSB 3WKJC 3LZ0D 4J8VC 3AZKA 1S32D 5E5AD 4M6BA 4ZUXB 5AV6D 3VH5T 4XZQC 4Z66A 5DNNB 4H9PA 4XUJB 1P34B 3W97B 1P3AD 3B0BA 5AV6C 5G49A 3AZNC 2F8ND 2L5AA 3REKC 1KX5B 3AZLC 5GSUD 3UT9C 4LD9D 3REKD 4H9NB 3REKA 5AV8D 5GSUA 5B24B 3C1BC 3REIC 5AVCC 1P3LB 5CP6B 1P3OA 1M18A 5GXQB 5FUGB 1KX4B 3X1SB 3AV1C 4LD9A 5B32C 4J8VB 3AZNB 3LJAA 2IO5C 1ID3B 3W99B 2HUEB 3O62A 1F66D 3C1BA 3REIA 5B32D 4HGAB 1P3OC 1M18C 1P3FB 5AVBD 1P3PA 5JRGC 1EQZD 2HIOA 3WTPD 5JA4B 3AZID 1P3IA 3W98A 3UTBB 3AZEB 3AZJB 3R45B 4XZQB 4ZBJC 3A6ND 3O62C 3RELA 2NZDC 3KUYA 1P3PC 3AN2A 1WWIA 4R8PD 4Z5TC 4QLCA 4X23D 3WKJB 3W96B 3W98C 1KX3C 3X1UC 5CPJD 4WNNB 3MGSD 3AZMC 3REHA 2AROD 3B0DB 4H9QA 4CSRA 4J8WA 4HGAC 3KUYC 3TU4D 5CPIB 5GT0C 1BH8B 5CPID 2AROB 3TU4B
chains in the Genus database with same CATH superfamily
3MNNB 4J8UC 5CPKD 5GT3B 3W96D 5AY8B 1KX3A 5AV9C 5B0ZA 5DNMA 4UUZB 4R8PB 4J8WC 2RVQD 5AVCB 5GT0A 1BH9B 5B31G 5B2IA 3AFAA 3LZ0C 2CV5D 4J8UA 3UTBD 1M19A 4YM6A 3AZIB 3WAAA 3FDDA 5G49B 1EQZB 4KGCA 5B1MC 3B6GC 1TZYA 3REJA 5AVBB 5B33C 4ZBJB 5B32B 3LELB 3AZKC 3W99D 1KX5A 3KWQC 3AV2A 1P3BC 3VH6W 3NQJA 3AZND 4J8VD 5C3IB 3B6GA 4WU9B 4KHAA 3X1SD 2Y2QA 1KX4D 2Y2GA 3H0MC 5E5AC 2BYKB 1R4VA 1A7WA 3A1IA 2FJ7A 5AV8B 1P3BD 1KX5C 3WA9A 5AV5A 1P3BA 2FJ7D 4LD9B 4EO5B 4J8VA 1P3AC 4WU8D 5AV9B 5B33B 1B6WA 5AY8C 1M1AC 1KX5D 3UT9A 2VQRA 1AOIB 3H0RC 4H9SA 3IP4C 4XUJA 3X1TB 4DRAA 3W97D 3X1UB 3W98B 4LD9C 4XUJD 5DNND 2BYMA 4Z2MG 5AVBC 5AV6B 5BNXA 4ZUXD 1ZLAD 3C1BD 3REID 2NZDB 4XUJC 5B40C 3AZFC 3AV1D 3AZEC 3AZJC 1TAFA 3LZ0B 4J8XD 2HIOC 5B2JB 1T3UA 4JJNA 1ZLAC 2NQBD 3REHB 4ZUXA 4J8WB 5B40D 5B31D 3AYWA 4Z66B 1F66C 4Z5TD 1F1EA 4Z5TB 5B31B 5GXQA 3MGQD 3X1VA 3REHD 5B2JD 3KXBA 4J8XB 1ID3A 3AV1B 2NZDD 3REHC 3C1BB 3REIB 1ZLAB 5B24C 2YFVB 3C1CB 1M19B 2ZY5A 4YS3A 3NQUB 2FFFB 1U35A 4KGCB 3W98D 3X1VD 1N1JB 3X1UD 1ID3C 3X1TD 1P3GD 2CV5C 3VH5A 5B24A 5CPIC 5GT0D 3KUYB 3UTBC 1AOID 3AV2B 4H9OB 5B2IC 3B6GD 4QLCC 1P3GC 5B33D 5AV9D 4WU8B 4KHAB 4NE3A 4WU9A 5BNVA 2BYKA 2FJ7B 1TZYC 3LZ1A 5B32G 5CPIA 3KWQD 1BH8A 1P3BB 2F8NG 5GT3A 4Z2MH 5AV9A 5JRGB 4WU9D 3B0CT 3R45A 5DNMC 5B1LC 4R8PA 4G91B 4KUDB 1BFMA 2FJ7C 5B2IB 3RELD 2CWEA 3LELD 5DNMD 4WU8C 5B0YB 4YM6C 2Y2KA 5B1MA 4WNNA 1P3AA 3VH6A 1P3MB 3AZGA 3AZHA 2CV5B 2AROA 3TU4A 5AV8C 3UTAA 1HQ3C 5AVCD 3B6FB 1TAFB 3EPHA 4CAYB 3LJAB 5B2JA 4JJNB 2JCHA 4UPKA 5AY8D 3AZLA 5GT3D 2Y2NA 5CPKB 3MNND 1HQ3D 3MVDC 3AZGC 3AZHC 3UTAD 3MGSB 5CPJB 3WTPC 3AZGD 3AYWD 3AZHD 3AZEA 4H9RA 3AZJA 3AV1A 5DNNC 1P3KA 3MVDA 5B32A 4X23B 3WKJD 4JJNC 3LJAC 1B67A 3O62D 3MGQC 4ZUXC 1AOIA 3B6FC 3AYWC 2G5HC 3A6NB 4XZQD 3V9RA 3AZED 3AZJD 2RIQA 2XD1A 3WTPB 1P3KD 4H9PB 1P3FD 1U35D 3H0LC 1F66B 3B0DC 3AZFA 1ID3D 1KX3B 3WTPE 5B0ZB 4UUZA 3MGRB 4G91C 1U35C 4WV4B 3AZLD 4AWLC 5GXQD 5CP6D 1P3LD 1BH9A 3KXBD 2RVQC 4WJ3C 2JSSA 4NE5A 5B24D 5F99B 4YM6B 3AZIA 1P3ID 5B0YC 1JFIA 3REKB 2PYOA 5JRGA 2Y2LA 5GSUB 3KXBC 1TZYB 1P3GA 3X1TC 2BYMB 1P3LA 5FUGA 1KX4A 4KUDA 2Y2OA 1HTAA 5B1LB 1P34C 2NZDA 2YFVA 3MGPB 3MGPD 2F8NB 5B0YA 5B1LD 2PYOC 3VH5W 3LZ0A 1P3AB 1H3OA 2W8SA 3X1SC 1P34D 3WAAC 1KX4C 1WWSA 1TZYD 2YFWB 2CV5A 4KGCC 3KFUG 1P34A 4G92C 4YM6D 5B31A 1P3IB 4H9OA 5F99D 5E5AB 1S32B 3KXBB 1Q9CA 4WU8A 3KWQA 3AV2C 4WU9C 1ULYA 3AZLB 5CPKA 4X23C 3MGRD 3VH6T 5KDMA 1M1AD 4QLCB 3WKJA 5B0ZD 5AV5D 1KX3D 5BS7C 3AZKB 2AROC 3TU4C 3AFAC 3MGRC 2F2AC 1U35B 5GT3C 1M19C 4Z66C 3C1CC 5AV5C 3B0CW 1P3KB 3MVDB 3W96C 3F6TA 5AY8A 5AV6A 5BT1C 5BS7A 2F8NK 3AZMB 3AZNA 1Z2CB 1S32C 2Y2MA 3AZFD 3W99A 3O62B 5CHLB 3AFAB 4J8XC 5BT1D 2HIOD 3WTPA 1P3FA 1P3PB 4J8UB 3LZ1B 2NQBC 3WA9D 3WAAB 3AYWB 3AZHB 5BO0B 3AZGB 5B1MD 3UTAB 5JA4A 3REJB 3MGQA 4H9NA 5AVBA 4XZQA 3B6FA 4J8XA 1HQ3B 5B40A 5B2JC 2LY8A 1P3FC 5CP6A 2IO5B 1P3OB 3AN2B 1M18B 2NQBA 2ZY4A 4JJND 1M1AA 3NQJB 3LJAD 1P3MC 4EO5C 1ZLAA 3B6FD 3AL0C 4YS3B 3A1KA 4CSRB 4H9QB 4H9SC 2PYOB 2DQNC 1P3MD 2Y2HA 1N1JA 5GXQC 5CP6C 3X1VC 5DNNA 1P3KC 1P3MA 3W97A 1P3IC 5B0YD 1AOIC 5DNMB 2HUEC 3UT9B 5GSUC 3UT9D 5B2ID 3RELB 5AVCA 4KUDD 2Y2JA 4YS3C 5BNVB 2XD5A 2YFWA 5JRGD 2UWXA 3W97C 3X1TA 1P3LC 2JE5A 1KU5A 3X1UA 4KUDC 1F66A 2PYOD 1PZRA 5C3IC 4YS3D 3A6NC 3MGSA 4G92B 3LELA 3KWQB 2J8PA 5KDMB 2Y2PA 3AN2D 4NE6A 3X1SA 1P3OD 1M18D 2ZY2A 4DRBA 3B6GB 1EQZC 3RELC 3LZ1C 3A6NA 3MGPC 3MGSC 3AV2D 4AWLB 3V9RB 5B31C 3LELC 3AZIC 1JFIB 5GT0B 3KUYD 3REJD 3AN2C 2F8NH 4Z5TA 5B1MB 1P3GB 3WAAD 3WA9B 3LZ1D 4J8UD 3X1VB 1P3PD 5CPKC 4KGCD 2HIOB 3AFAD 4R8PC 5B1LA 3AZMA 1EQZA 3REJC 3MGPA 3UTBA 5B33A 5F99C 3C1CD 3AZFB 1M19D 2F8NA 4NFTA 4CAYA 4E44A 3AZMD 5CPJC 3MGRA 1H3OB 3EPJA 3C1CA 3NQUA 5B0ZC 5BO0A 3MNNC 3MVDD 3W96A 5F99A 3MGQB 5E5AA 5CPJA 3AZKD 5AV8A 3UTAC 1S32A 4Z66D 1HQ3A 4E45A 5B40B 4J8WD 3W99C 5BNXB 3KSYA 4H9RB 3WA9C 2NQBB 5AV5B 4QLCD 4X23A 1M1AB 3MNNA 4WZSB 3WKJC 3LZ0D 4J8VC 3AZKA 1S32D 5E5AD 4M6BA 4ZUXB 5AV6D 3VH5T 4XZQC 4Z66A 2BG1A 5DNNB 2DF4C 4H9PA 4XUJB 2ZY3A 1P34B 3W97B 1P3AD 3B0BA 5AV6C 5G49A 1W2EA 3AZNC 2F8ND 3P5JB 2L5AA 3REKC 1KX5B 3AZLC 5GSUD 3UT9C 4LD9D 3REKD 4H9NB 3REKA 5AV8D 5GSUA 5B24B 3C1BC 3REIC 5AVCC 1P3LB 5CP6B 4DQYB 1P3OA 5GXQB 1M18A 5FUGB 1KX4B 3X1SB 3AV1C 2ZM5A 4LD9A 5B32C 4J8VB 3AZNB 3LJAA 2IO5C 1ID3B 3W99B 3EPKA 2HUEB 3O62A 1F66D 3C1BA 3REIA 5B32D 4HGAB 1P3OC 1M18C 1P3FB 5AVBD 1P3PA 5JRGC 1EQZD 2HIOA 3WTPD 5JA4B 3AZID 1P3IA 3W98A 3EPLA 3UTBB 3AZEB 3AZJB 3R45B 4XZQB 4ZBJC 3A6ND 3O62C 3RELA 2NZDC 3KUYA 1P3PC 3AN2A 1WWIA 4R8PD 4Z5TC 4QLCA 4X23D 3EG5B 3WKJB 3W96B 3W98C 1KX3C 3X1UC 2Y2IA 4WNNB 5CPJD 3MGSD 3AZMC 3REHA 2G5IC 2AROD 3B0DB 4H9QA 4CSRA 4J8WA 4HGAC 3KUYC 3TU4D 5CPIB 5GT0C 1BH8B 5CPID 2AROB 3TU4B
chains in the Genus database with same CATH topology
3MNNB 4J8UC 5CPKD 5GT3B 3W96D 5AY8B 1KX3A 5AV9C 5B0ZA 5DNMA 4UUZB 4R8PB 4J8WC 2RVQD 5AVCB 5GT0A 1BH9B 5B31G 5B2IA 3AFAA 3LZ0C 2CV5D 4J8UA 3UTBD 1M19A 4YM6A 3AZIB 3WAAA 3FDDA 5G49B 1EQZB 4KGCA 5B1MC 3B6GC 1TZYA 3REJA 5AVBB 5B33C 4ZBJB 5B32B 3LELB 3AZKC 3W99D 1KX5A 3KWQC 3AV2A 1P3BC 3VH6W 3NQJA 3AZND 4J8VD 5C3IB 3B6GA 4WU9B 4KHAA 3X1SD 2Y2QA 1KX4D 2Y2GA 3H0MC 5E5AC 2BYKB 1R4VA 1A7WA 3A1IA 2FJ7A 5AV8B 1P3BD 1KX5C 3WA9A 5AV5A 1P3BA 2FJ7D 4LD9B 4EO5B 4J8VA 1P3AC 4WU8D 5AV9B 5B33B 1B6WA 5AY8C 1M1AC 1KX5D 3UT9A 2VQRA 1AOIB 3H0RC 4H9SA 3IP4C 4XUJA 3X1TB 4DRAA 3W97D 3X1UB 3W98B 4LD9C 4XUJD 5DNND 2BYMA 4Z2MG 5AVBC 5AV6B 5BNXA 4ZUXD 1ZLAD 3C1BD 3REID 2NZDB 4XUJC 5B40C 3AZFC 3AV1D 3AZEC 3AZJC 1TAFA 3LZ0B 4J8XD 2HIOC 5B2JB 1T3UA 4JJNA 1ZLAC 2NQBD 3REHB 4ZUXA 4J8WB 5B40D 5B31D 3AYWA 4Z66B 1F66C 4Z5TD 1F1EA 4Z5TB 5B31B 5GXQA 3MGQD 3X1VA 3REHD 5B2JD 3KXBA 4J8XB 1ID3A 3AV1B 2NZDD 3REHC 3C1BB 3REIB 1ZLAB 5B24C 2YFVB 3C1CB 1M19B 2ZY5A 4YS3A 3NQUB 2FFFB 1U35A 4KGCB 3W98D 3X1VD 1N1JB 3X1UD 1ID3C 3X1TD 1P3GD 2CV5C 3VH5A 5B24A 5CPIC 5GT0D 3KUYB 3UTBC 1AOID 3AV2B 4H9OB 5B2IC 3B6GD 4QLCC 1P3GC 5B33D 5AV9D 4WU8B 4KHAB 4NE3A 4WU9A 5BNVA 2BYKA 2FJ7B 1TZYC 3LZ1A 5B32G 5CPIA 3KWQD 1BH8A 1P3BB 2F8NG 5GT3A 4Z2MH 5AV9A 5JRGB 4WU9D 3B0CT 3R45A 5DNMC 5B1LC 4R8PA 4G91B 4KUDB 1BFMA 2FJ7C 5B2IB 3RELD 2CWEA 3LELD 5DNMD 4WU8C 5B0YB 4YM6C 2Y2KA 5B1MA 4WNNA 1P3AA 3VH6A 1P3MB 3AZGA 3AZHA 2CV5B 2AROA 3TU4A 5AV8C 3UTAA 1HQ3C 5AVCD 3B6FB 1TAFB 3EPHA 4CAYB 3LJAB 5B2JA 4JJNB 2JCHA 4UPKA 5AY8D 3AZLA 5GT3D 2Y2NA 5CPKB 3MNND 1HQ3D 3MVDC 3AZGC 3AZHC 3UTAD 3MGSB 5CPJB 3WTPC 3AZGD 3AYWD 3AZHD 3AZEA 4H9RA 3AZJA 3AV1A 5DNNC 1P3KA 3MVDA 5B32A 4X23B 3WKJD 4JJNC 3LJAC 1B67A 3O62D 3MGQC 4ZUXC 1AOIA 3B6FC 3AYWC 2G5HC 3A6NB 4XZQD 3V9RA 3AZED 3AZJD 2RIQA 2XD1A 3WTPB 1P3KD 4H9PB 1P3FD 1U35D 3H0LC 1F66B 3B0DC 3AZFA 1ID3D 1KX3B 3WTPE 5B0ZB 4UUZA 3MGRB 4G91C 1U35C 4WV4B 3AZLD 4AWLC 5GXQD 5CP6D 1P3LD 1BH9A 3KXBD 2RVQC 4WJ3C 2JSSA 4NE5A 5B24D 5F99B 4YM6B 3AZIA 1P3ID 5B0YC 1JFIA 3REKB 2PYOA 5JRGA 2Y2LA 5GSUB 3KXBC 1TZYB 1P3GA 3X1TC 2BYMB 1P3LA 5FUGA 1KX4A 4KUDA 2Y2OA 1HTAA 5B1LB 1P34C 2NZDA 2YFVA 3MGPB 3MGPD 2F8NB 5B0YA 5B1LD 2PYOC 3VH5W 3LZ0A 1P3AB 1H3OA 2W8SA 3X1SC 1P34D 3WAAC 1KX4C 1WWSA 1TZYD 2YFWB 2CV5A 4KGCC 3KFUG 1P34A 4G92C 4YM6D 5B31A 1P3IB 4H9OA 5F99D 5E5AB 1S32B 3KXBB 1Q9CA 4WU8A 3KWQA 3AV2C 4WU9C 1ULYA 3AZLB 5CPKA 4X23C 3MGRD 3VH6T 5KDMA 1M1AD 4QLCB 3WKJA 5B0ZD 5AV5D 1KX3D 5BS7C 3AZKB 2AROC 3TU4C 3AFAC 3MGRC 2F2AC 1U35B 5GT3C 1M19C 4Z66C 3C1CC 5AV5C 3B0CW 1P3KB 3MVDB 3W96C 3F6TA 5AY8A 5AV6A 5BT1C 5BS7A 2F8NK 3AZMB 3AZNA 1Z2CB 1S32C 2Y2MA 3AZFD 3W99A 3O62B 5CHLB 3AFAB 4J8XC 5BT1D 2HIOD 3WTPA 1P3FA 1P3PB 4J8UB 3LZ1B 2NQBC 3WA9D 3WAAB 3AYWB 3AZHB 5BO0B 3AZGB 5B1MD 3UTAB 5JA4A 3REJB 3MGQA 4H9NA 5AVBA 4XZQA 3B6FA 4J8XA 1HQ3B 5B40A 5B2JC 2LY8A 1P3FC 5CP6A 2IO5B 1P3OB 3AN2B 1M18B 2NQBA 2ZY4A 4JJND 1M1AA 3NQJB 3LJAD 1P3MC 4EO5C 1ZLAA 3B6FD 3AL0C 4YS3B 3A1KA 4CSRB 4H9QB 4H9SC 2PYOB 2DQNC 1P3MD 2Y2HA 1N1JA 5GXQC 5CP6C 3X1VC 5DNNA 1P3KC 1P3MA 3W97A 1P3IC 5B0YD 1AOIC 5DNMB 2HUEC 3UT9B 5GSUC 3UT9D 5B2ID 3RELB 5AVCA 4KUDD 2Y2JA 4YS3C 5BNVB 2XD5A 2YFWA 5JRGD 2UWXA 3W97C 3X1TA 1P3LC 2JE5A 1KU5A 3X1UA 4KUDC 1F66A 2PYOD 1PZRA 5C3IC 4YS3D 3A6NC 3MGSA 4G92B 3LELA 3KWQB 2J8PA 5KDMB 2Y2PA 3AN2D 4NE6A 3X1SA 1P3OD 1M18D 2ZY2A 4DRBA 3B6GB 1EQZC 3RELC 3LZ1C 3A6NA 3MGPC 3MGSC 3AV2D 4AWLB 3V9RB 5B31C 3LELC 3AZIC 1JFIB 5GT0B 3KUYD 3REJD 3AN2C 2F8NH 4Z5TA 5B1MB 1P3GB 3WAAD 3WA9B 3LZ1D 4J8UD 3X1VB 1P3PD 5CPKC 4KGCD 2HIOB 3AFAD 4R8PC 5B1LA 3AZMA 1EQZA 3REJC 3MGPA 3UTBA 5B33A 5F99C 3C1CD 3AZFB 1M19D 2F8NA 4NFTA 4CAYA 4E44A 3AZMD 5CPJC 3MGRA 1H3OB 3EPJA 3C1CA 3NQUA 5B0ZC 5BO0A 3MNNC 3MVDD 3W96A 5F99A 3MGQB 5E5AA 5CPJA 3AZKD 5AV8A 3UTAC 1S32A 4Z66D 1HQ3A 4E45A 5B40B 4J8WD 3W99C 5BNXB 3KSYA 4H9RB 3WA9C 2NQBB 5AV5B 4QLCD 4X23A 1M1AB 3MNNA 4WZSB 3WKJC 3LZ0D 4J8VC 3AZKA 1S32D 5E5AD 4M6BA 4ZUXB 5AV6D 3VH5T 4XZQC 4Z66A 2BG1A 5DNNB 2DF4C 4H9PA 4XUJB 2ZY3A 1P34B 3W97B 1P3AD 3B0BA 5AV6C 5G49A 1W2EA 3AZNC 2F8ND 3P5JB 2L5AA 3REKC 1KX5B 3AZLC 5GSUD 3UT9C 4LD9D 3REKD 4H9NB 3REKA 5AV8D 5GSUA 5B24B 3C1BC 3REIC 5AVCC 1P3LB 5CP6B 4DQYB 1P3OA 5GXQB 1M18A 5FUGB 1KX4B 3X1SB 3AV1C 2ZM5A 4LD9A 5B32C 4J8VB 3AZNB 3LJAA 2IO5C 1ID3B 3W99B 3EPKA 2HUEB 3O62A 1F66D 3C1BA 3REIA 5B32D 4HGAB 1P3OC 1M18C 1P3FB 5AVBD 1P3PA 5JRGC 1EQZD 2HIOA 3WTPD 5JA4B 3AZID 1P3IA 3W98A 3EPLA 3UTBB 3AZEB 3AZJB 3R45B 4XZQB 4ZBJC 3A6ND 3O62C 3RELA 2NZDC 3KUYA 1P3PC 3AN2A 1WWIA 4R8PD 4Z5TC 4QLCA 4X23D 3EG5B 3WKJB 3W96B 3W98C 1KX3C 3X1UC 2Y2IA 4WNNB 5CPJD 3MGSD 3AZMC 3REHA 2G5IC 2AROD 3B0DB 4H9QA 4CSRA 4J8WA 4HGAC 3KUYC 3TU4D 5CPIB 5GT0C 1BH8B 5CPID 2AROB 3TU4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN B;  4J8U C;  5CPK D;  5GT3 B;  3W96 D;  5AY8 B;  1KX3 A;  5AV9 C;  5B0Z A;  5DNM A;  4UUZ B;  4R8P B;  4J8W C;  2RVQ D;  5AVC B;  5GT0 A;  1BH9 B;  5B31 G;  5B2I A;  3AFA A;  3LZ0 C;  2CV5 D;  4J8U A;  3UTB D;  1M19 A;  4YM6 A;  3AZI B;  3WAA A;  5G49 B;  1EQZ B;  4KGC A;  5B1M C;  3B6G C;  1TZY A;  3REJ A;  5AVB B;  5B33 C;  4ZBJ B;  5B32 B;  3LEL B;  3AZK C;  3W99 D;  1KX5 A;  3KWQ C;  3AV2 A;  1P3B C;  3VH6 W;  3NQJ A;  3AZN D;  4J8V D;  5C3I B;  3B6G A;  4WU9 B;  4KHA A;  3X1S D;  1KX4 D;  5E5A C;  2BYK B;  1R4V A;  1A7W A;  2FJ7 A;  5AV8 B;  1P3B D;  1KX5 C;  3WA9 A;  5AV5 A;  1P3B A;  2FJ7 D;  4LD9 B;  4EO5 B;  4J8V A;  1P3A C;  4WU8 D;  5AV9 B;  5B33 B;  1B6W A;  5AY8 C;  1M1A C;  1KX5 D;  3UT9 A;  1AOI B;  4H9S A;  4XUJ A;  3X1T B;  4DRA A;  3W97 D;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5DNN D;  2BYM A;  4Z2M G;  5AVB C;  5AV6 B;  5BNX A;  4ZUX D;  1ZLA D;  3C1B D;  3REI D;  2NZD B;  4XUJ C;  5B40 C;  3AZF C;  3AV1 D;  3AZE C;  3AZJ C;  1TAF A;  3LZ0 B;  4J8X D;  2HIO C;  5B2J B;  4JJN A;  1ZLA C;  2NQB D;  3REH B;  4ZUX A;  4J8W B;  5B40 D;  5B31 D;  3AYW A;  4Z66 B;  1F66 C;  4Z5T D;  1F1E A;  4Z5T B;  5B31 B;  5GXQ A;  3MGQ D;  3X1V A;  3REH D;  5B2J D;  3KXB A;  4J8X B;  1ID3 A;  3AV1 B;  2NZD D;  3REH C;  3C1B B;  3REI B;  1ZLA B;  5B24 C;  2YFV B;  3C1C B;  1M19 B;  4YS3 A;  3NQU B;  1U35 A;  4KGC B;  3W98 D;  3X1V D;  1N1J B;  3X1U D;  1ID3 C;  3X1T D;  1P3G D;  2CV5 C;  3VH5 A;  5B24 A;  5GT0 D;  5CPI C;  3KUY B;  3UTB C;  1AOI D;  3AV2 B;  4H9O B;  5B2I C;  3B6G D;  4QLC C;  1P3G C;  5B33 D;  5AV9 D;  4WU8 B;  4KHA B;  4NE3 A;  4WU9 A;  5BNV A;  2BYK A;  2FJ7 B;  1TZY C;  3LZ1 A;  5B32 G;  5CPI A;  3KWQ D;  1BH8 A;  1P3B B;  2F8N G;  5GT3 A;  4Z2M H;  5AV9 A;  5JRG B;  4WU9 D;  3B0C T;  3R45 A;  5DNM C;  5B1L C;  4R8P A;  4G91 B;  4KUD B;  1BFM A;  2FJ7 C;  5B2I B;  3REL D;  2CWE A;  3LEL D;  5DNM D;  4WU8 C;  5B0Y B;  4YM6 C;  5B1M A;  4WNN A;  1P3A A;  3VH6 A;  1P3M B;  3AZG A;  3AZH A;  2CV5 B;  2ARO A;  3TU4 A;  5AV8 C;  3UTA A;  1HQ3 C;  5AVC D;  3B6F B;  1TAF B;  4CAY B;  3LJA B;  5B2J A;  4JJN B;  5AY8 D;  3AZL A;  5GT3 D;  5CPK B;  3MNN D;  1HQ3 D;  3MVD C;  3AZG C;  3AZH C;  3UTA D;  3MGS B;  5CPJ B;  3WTP C;  3AZG D;  3AYW D;  3AZH D;  3AZE A;  4H9R A;  3AZJ A;  3AV1 A;  5DNN C;  1P3K A;  3MVD A;  5B32 A;  4X23 B;  3WKJ D;  4JJN C;  3LJA C;  1B67 A;  3O62 D;  3MGQ C;  4ZUX C;  1AOI A;  3B6F C;  3AYW C;  3A6N B;  3V9R A;  4XZQ D;  3AZE D;  3AZJ D;  3WTP B;  1P3K D;  4H9P B;  1P3F D;  1U35 D;  1F66 B;  3B0D C;  3AZF A;  1ID3 D;  1KX3 B;  3WTP E;  5B0Z B;  4UUZ A;  3MGR B;  4G91 C;  1U35 C;  4WV4 B;  3AZL D;  4AWL C;  5GXQ D;  5CP6 D;  1P3L D;  1BH9 A;  3KXB D;  2RVQ C;  2JSS A;  4NE5 A;  5B24 D;  5F99 B;  4YM6 B;  3AZI A;  1P3I D;  5B0Y C;  1JFI A;  3REK B;  2PYO A;  5JRG A;  5GSU B;  3KXB C;  1TZY B;  1P3G A;  3X1T C;  2BYM B;  1P3L A;  5FUG A;  1KX4 A;  4KUD A;  1HTA A;  5B1L B;  1P34 C;  2NZD A;  2YFV A;  3MGP B;  3MGP D;  2F8N B;  5B0Y A;  5B1L D;  2PYO C;  3LZ0 A;  3VH5 W;  1P3A B;  1H3O A;  3X1S C;  1P34 D;  3WAA C;  1KX4 C;  1WWS A;  1TZY D;  2YFW B;  2CV5 A;  4KGC C;  1P34 A;  4G92 C;  4YM6 D;  5B31 A;  1P3I B;  4H9O A;  5F99 D;  5E5A B;  1S32 B;  3KXB B;  1Q9C A;  4WU8 A;  3KWQ A;  3AV2 C;  4WU9 C;  1ULY A;  3AZL B;  5CPK A;  4X23 C;  3MGR D;  3VH6 T;  5KDM A;  1M1A D;  4QLC B;  3WKJ A;  5B0Z D;  5AV5 D;  1KX3 D;  5BS7 C;  3AZK B;  2ARO C;  3TU4 C;  3AFA C;  3MGR C;  1U35 B;  5GT3 C;  1M19 C;  4Z66 C;  3C1C C;  5AV5 C;  3B0C W;  1P3K B;  3MVD B;  3W96 C;  5AY8 A;  5AV6 A;  5BT1 C;  5BS7 A;  2F8N K;  3AZM B;  3AZN A;  1S32 C;  3AZF D;  3W99 A;  3O62 B;  5CHL B;  3AFA B;  4J8X C;  5BT1 D;  2HIO D;  3WTP A;  1P3F A;  1P3P B;  4J8U B;  3LZ1 B;  2NQB C;  3WA9 D;  3WAA B;  3AYW B;  3AZH B;  5BO0 B;  3AZG B;  5B1M D;  3UTA B;  5JA4 A;  3REJ B;  3MGQ A;  4H9N A;  5AVB A;  4XZQ A;  3B6F A;  4J8X A;  1HQ3 B;  5B40 A;  5B2J C;  2LY8 A;  1P3F C;  5CP6 A;  2IO5 B;  1P3O B;  3AN2 B;  1M18 B;  2NQB A;  4JJN D;  1M1A A;  3NQJ B;  3LJA D;  1P3M C;  4EO5 C;  1ZLA A;  3B6F D;  4YS3 B;  4CSR B;  4H9Q B;  4H9S C;  2PYO B;  1P3M D;  1N1J A;  5GXQ C;  5CP6 C;  3X1V C;  5DNN A;  1P3K C;  1P3M A;  3W97 A;  1P3I C;  5B0Y D;  1AOI C;  5DNM B;  2HUE C;  3UT9 B;  5GSU C;  3UT9 D;  5B2I D;  3REL B;  5AVC A;  4KUD D;  4YS3 C;  5BNV B;  2YFW A;  5JRG D;  3W97 C;  3X1T A;  1P3L C;  1KU5 A;  3X1U A;  4KUD C;  1F66 A;  2PYO D;  5C3I C;  4YS3 D;  3A6N C;  3MGS A;  4G92 B;  3LEL A;  3KWQ B;  5KDM B;  3AN2 D;  4NE6 A;  3X1S A;  1P3O D;  1M18 D;  4DRB A;  3B6G B;  1EQZ C;  3REL C;  3LZ1 C;  3A6N A;  3MGP C;  3MGS C;  3AV2 D;  4AWL B;  3V9R B;  5B31 C;  3LEL C;  3AZI C;  1JFI B;  5GT0 B;  3KUY D;  3REJ D;  3AN2 C;  2F8N H;  4Z5T A;  5B1M B;  1P3G B;  3WAA D;  3WA9 B;  3LZ1 D;  4J8U D;  3X1V B;  1P3P D;  5CPK C;  4KGC D;  2HIO B;  3AFA D;  4R8P C;  5B1L A;  3AZM A;  1EQZ A;  3REJ C;  3MGP A;  3UTB A;  5B33 A;  5F99 C;  3C1C D;  3AZF B;  1M19 D;  2F8N A;  4NFT A;  4CAY A;  4E44 A;  3AZM D;  5CPJ C;  3MGR A;  1H3O B;  3C1C A;  3NQU A;  5B0Z C;  5BO0 A;  3MVD D;  3MNN C;  3W96 A;  5F99 A;  3MGQ B;  5E5A A;  5CPJ A;  3AZK D;  5AV8 A;  3UTA C;  1S32 A;  4Z66 D;  1HQ3 A;  4E45 A;  5B40 B;  4J8W D;  3W99 C;  5BNX B;  3KSY A;  4H9R B;  3WA9 C;  2NQB B;  5AV5 B;  4QLC D;  4X23 A;  1M1A B;  3MNN A;  4WZS B;  3WKJ C;  3LZ0 D;  4J8V C;  3AZK A;  1S32 D;  5E5A D;  4M6B A;  4ZUX B;  5AV6 D;  3VH5 T;  4XZQ C;  4Z66 A;  5DNN B;  4H9P A;  4XUJ B;  1P34 B;  3W97 B;  1P3A D;  3B0B A;  5AV6 C;  5G49 A;  3AZN C;  2F8N D;  2L5A A;  3REK C;  1KX5 B;  3AZL C;  5GSU D;  3UT9 C;  4LD9 D;  3REK D;  4H9N B;  3REK A;  5AV8 D;  5GSU A;  5B24 B;  3C1B C;  3REI C;  5AVC C;  1P3L B;  5CP6 B;  1P3O A;  1M18 A;  5GXQ B;  5FUG B;  1KX4 B;  3X1S B;  3AV1 C;  4LD9 A;  5B32 C;  4J8V B;  3AZN B;  3LJA A;  2IO5 C;  1ID3 B;  3W99 B;  2HUE B;  3O62 A;  1F66 D;  3C1B A;  3REI A;  5B32 D;  4HGA B;  1P3O C;  1M18 C;  1P3F B;  5AVB D;  1P3P A;  5JRG C;  1EQZ D;  2HIO A;  3WTP D;  5JA4 B;  3AZI D;  1P3I A;  3W98 A;  3UTB B;  3AZE B;  3AZJ B;  3R45 B;  4XZQ B;  4ZBJ C;  3A6N D;  3O62 C;  3REL A;  2NZD C;  3KUY A;  1P3P C;  3AN2 A;  1WWI A;  4R8P D;  4Z5T C;  4QLC A;  4X23 D;  3WKJ B;  3W96 B;  3W98 C;  1KX3 C;  3X1U C;  5CPJ D;  4WNN B;  3MGS D;  3AZM C;  3REH A;  2ARO D;  3B0D B;  4H9Q A;  4CSR A;  4J8W A;  4HGA C;  3KUY C;  3TU4 D;  5CPI B;  5GT0 C;  1BH8 B;  5CPI D;  2ARO B;  3TU4 B; 
#chains in the Genus database with same CATH topology
 3MNN B;  4J8U C;  5CPK D;  5GT3 B;  3W96 D;  5AY8 B;  1KX3 A;  5AV9 C;  5B0Z A;  5DNM A;  4UUZ B;  4R8P B;  4J8W C;  2RVQ D;  5AVC B;  5GT0 A;  1BH9 B;  5B31 G;  5B2I A;  3AFA A;  3LZ0 C;  2CV5 D;  4J8U A;  3UTB D;  1M19 A;  4YM6 A;  3AZI B;  3WAA A;  3FDD A;  5G49 B;  1EQZ B;  4KGC A;  5B1M C;  3B6G C;  1TZY A;  3REJ A;  5AVB B;  5B33 C;  4ZBJ B;  5B32 B;  3LEL B;  3AZK C;  3W99 D;  1KX5 A;  3KWQ C;  3AV2 A;  1P3B C;  3VH6 W;  3NQJ A;  3AZN D;  4J8V D;  5C3I B;  3B6G A;  4WU9 B;  4KHA A;  3X1S D;  2Y2Q A;  1KX4 D;  2Y2G A;  3H0M C;  5E5A C;  2BYK B;  1R4V A;  1A7W A;  3A1I A;  2FJ7 A;  5AV8 B;  1P3B D;  1KX5 C;  3WA9 A;  5AV5 A;  1P3B A;  2FJ7 D;  4LD9 B;  4EO5 B;  4J8V A;  1P3A C;  4WU8 D;  5AV9 B;  5B33 B;  1B6W A;  5AY8 C;  1M1A C;  1KX5 D;  3UT9 A;  2VQR A;  1AOI B;  3H0R C;  4H9S A;  3IP4 C;  4XUJ A;  3X1T B;  4DRA A;  3W97 D;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5DNN D;  2BYM A;  4Z2M G;  5AVB C;  5AV6 B;  5BNX A;  4ZUX D;  1ZLA D;  3C1B D;  3REI D;  2NZD B;  4XUJ C;  5B40 C;  3AZF C;  3AV1 D;  3AZE C;  3AZJ C;  1TAF A;  3LZ0 B;  4J8X D;  2HIO C;  5B2J B;  1T3U A;  4JJN A;  1ZLA C;  2NQB D;  3REH B;  4ZUX A;  4J8W B;  5B40 D;  5B31 D;  3AYW A;  4Z66 B;  1F66 C;  4Z5T D;  1F1E A;  4Z5T B;  5B31 B;  5GXQ A;  3MGQ D;  3X1V A;  3REH D;  5B2J D;  3KXB A;  4J8X B;  1ID3 A;  3AV1 B;  2NZD D;  3REH C;  3C1B B;  3REI B;  1ZLA B;  5B24 C;  2YFV B;  3C1C B;  1M19 B;  2ZY5 A;  4YS3 A;  3NQU B;  2FFF B;  1U35 A;  4KGC B;  3W98 D;  3X1V D;  1N1J B;  3X1U D;  1ID3 C;  3X1T D;  1P3G D;  2CV5 C;  3VH5 A;  5B24 A;  5CPI C;  5GT0 D;  3KUY B;  3UTB C;  1AOI D;  3AV2 B;  4H9O B;  5B2I C;  3B6G D;  4QLC C;  1P3G C;  5B33 D;  5AV9 D;  4WU8 B;  4KHA B;  4NE3 A;  4WU9 A;  5BNV A;  2BYK A;  2FJ7 B;  1TZY C;  3LZ1 A;  5B32 G;  5CPI A;  3KWQ D;  1BH8 A;  1P3B B;  2F8N G;  5GT3 A;  4Z2M H;  5AV9 A;  5JRG B;  4WU9 D;  3B0C T;  3R45 A;  5DNM C;  5B1L C;  4R8P A;  4G91 B;  4KUD B;  1BFM A;  2FJ7 C;  5B2I B;  3REL D;  2CWE A;  3LEL D;  5DNM D;  4WU8 C;  5B0Y B;  4YM6 C;  2Y2K A;  5B1M A;  4WNN A;  1P3A A;  3VH6 A;  1P3M B;  3AZG A;  3AZH A;  2CV5 B;  2ARO A;  3TU4 A;  5AV8 C;  3UTA A;  1HQ3 C;  5AVC D;  3B6F B;  1TAF B;  3EPH A;  4CAY B;  3LJA B;  5B2J A;  4JJN B;  2JCH A;  4UPK A;  5AY8 D;  3AZL A;  5GT3 D;  2Y2N A;  5CPK B;  3MNN D;  1HQ3 D;  3MVD C;  3AZG C;  3AZH C;  3UTA D;  3MGS B;  5CPJ B;  3WTP C;  3AZG D;  3AYW D;  3AZH D;  3AZE A;  4H9R A;  3AZJ A;  3AV1 A;  5DNN C;  1P3K A;  3MVD A;  5B32 A;  4X23 B;  3WKJ D;  4JJN C;  3LJA C;  1B67 A;  3O62 D;  3MGQ C;  4ZUX C;  1AOI A;  3B6F C;  3AYW C;  2G5H C;  3A6N B;  4XZQ D;  3V9R A;  3AZE D;  3AZJ D;  2RIQ A;  2XD1 A;  3WTP B;  1P3K D;  4H9P B;  1P3F D;  1U35 D;  3H0L C;  1F66 B;  3B0D C;  3AZF A;  1ID3 D;  1KX3 B;  3WTP E;  5B0Z B;  4UUZ A;  3MGR B;  4G91 C;  1U35 C;  4WV4 B;  3AZL D;  4AWL C;  5GXQ D;  5CP6 D;  1P3L D;  1BH9 A;  3KXB D;  2RVQ C;  4WJ3 C;  2JSS A;  4NE5 A;  5B24 D;  5F99 B;  4YM6 B;  3AZI A;  1P3I D;  5B0Y C;  1JFI A;  3REK B;  2PYO A;  5JRG A;  2Y2L A;  5GSU B;  3KXB C;  1TZY B;  1P3G A;  3X1T C;  2BYM B;  1P3L A;  5FUG A;  1KX4 A;  4KUD A;  2Y2O A;  1HTA A;  5B1L B;  1P34 C;  2NZD A;  2YFV A;  3MGP B;  3MGP D;  2F8N B;  5B0Y A;  5B1L D;  2PYO C;  3VH5 W;  3LZ0 A;  1P3A B;  1H3O A;  2W8S A;  3X1S C;  1P34 D;  3WAA C;  1KX4 C;  1WWS A;  1TZY D;  2YFW B;  2CV5 A;  4KGC C;  3KFU G;  1P34 A;  4G92 C;  4YM6 D;  5B31 A;  1P3I B;  4H9O A;  5F99 D;  5E5A B;  1S32 B;  3KXB B;  1Q9C A;  4WU8 A;  3KWQ A;  3AV2 C;  4WU9 C;  1ULY A;  3AZL B;  5CPK A;  4X23 C;  3MGR D;  3VH6 T;  5KDM A;  1M1A D;  4QLC B;  3WKJ A;  5B0Z D;  5AV5 D;  1KX3 D;  5BS7 C;  3AZK B;  2ARO C;  3TU4 C;  3AFA C;  3MGR C;  2F2A C;  1U35 B;  5GT3 C;  1M19 C;  4Z66 C;  3C1C C;  5AV5 C;  3B0C W;  1P3K B;  3MVD B;  3W96 C;  3F6T A;  5AY8 A;  5AV6 A;  5BT1 C;  5BS7 A;  2F8N K;  3AZM B;  3AZN A;  1Z2C B;  1S32 C;  2Y2M A;  3AZF D;  3W99 A;  3O62 B;  5CHL B;  3AFA B;  4J8X C;  5BT1 D;  2HIO D;  3WTP A;  1P3F A;  1P3P B;  4J8U B;  3LZ1 B;  2NQB C;  3WA9 D;  3WAA B;  3AYW B;  3AZH B;  5BO0 B;  3AZG B;  5B1M D;  3UTA B;  5JA4 A;  3REJ B;  3MGQ A;  4H9N A;  5AVB A;  4XZQ A;  3B6F A;  4J8X A;  1HQ3 B;  5B40 A;  5B2J C;  2LY8 A;  1P3F C;  5CP6 A;  2IO5 B;  1P3O B;  3AN2 B;  1M18 B;  2NQB A;  2ZY4 A;  4JJN D;  1M1A A;  3NQJ B;  3LJA D;  1P3M C;  4EO5 C;  1ZLA A;  3B6F D;  3AL0 C;  4YS3 B;  3A1K A;  4CSR B;  4H9Q B;  4H9S C;  2PYO B;  2DQN C;  1P3M D;  2Y2H A;  1N1J A;  5GXQ C;  5CP6 C;  3X1V C;  5DNN A;  1P3K C;  1P3M A;  3W97 A;  1P3I C;  5B0Y D;  1AOI C;  5DNM B;  2HUE C;  3UT9 B;  5GSU C;  3UT9 D;  5B2I D;  3REL B;  5AVC A;  4KUD D;  2Y2J A;  4YS3 C;  5BNV B;  2XD5 A;  2YFW A;  5JRG D;  2UWX A;  3W97 C;  3X1T A;  1P3L C;  2JE5 A;  1KU5 A;  3X1U A;  4KUD C;  1F66 A;  2PYO D;  1PZR A;  5C3I C;  4YS3 D;  3A6N C;  3MGS A;  4G92 B;  3LEL A;  3KWQ B;  2J8P A;  5KDM B;  2Y2P A;  3AN2 D;  4NE6 A;  3X1S A;  1P3O D;  1M18 D;  2ZY2 A;  4DRB A;  3B6G B;  1EQZ C;  3REL C;  3LZ1 C;  3A6N A;  3MGP C;  3MGS C;  3AV2 D;  4AWL B;  3V9R B;  5B31 C;  3LEL C;  3AZI C;  1JFI B;  5GT0 B;  3KUY D;  3REJ D;  3AN2 C;  2F8N H;  4Z5T A;  5B1M B;  1P3G B;  3WAA D;  3WA9 B;  3LZ1 D;  4J8U D;  3X1V B;  1P3P D;  5CPK C;  4KGC D;  2HIO B;  3AFA D;  4R8P C;  5B1L A;  3AZM A;  1EQZ A;  3REJ C;  3MGP A;  3UTB A;  5B33 A;  5F99 C;  3C1C D;  3AZF B;  1M19 D;  2F8N A;  4NFT A;  4CAY A;  4E44 A;  3AZM D;  5CPJ C;  3MGR A;  1H3O B;  3EPJ A;  3C1C A;  3NQU A;  5B0Z C;  5BO0 A;  3MNN C;  3MVD D;  3W96 A;  5F99 A;  3MGQ B;  5E5A A;  5CPJ A;  3AZK D;  5AV8 A;  3UTA C;  1S32 A;  4Z66 D;  1HQ3 A;  4E45 A;  5B40 B;  4J8W D;  3W99 C;  5BNX B;  3KSY A;  4H9R B;  3WA9 C;  2NQB B;  5AV5 B;  4QLC D;  4X23 A;  1M1A B;  3MNN A;  4WZS B;  3WKJ C;  3LZ0 D;  4J8V C;  3AZK A;  1S32 D;  5E5A D;  4M6B A;  4ZUX B;  5AV6 D;  3VH5 T;  4XZQ C;  4Z66 A;  2BG1 A;  5DNN B;  2DF4 C;  4H9P A;  4XUJ B;  2ZY3 A;  1P34 B;  3W97 B;  1P3A D;  3B0B A;  5AV6 C;  5G49 A;  1W2E A;  3AZN C;  2F8N D;  3P5J B;  2L5A A;  3REK C;  1KX5 B;  3AZL C;  5GSU D;  3UT9 C;  4LD9 D;  3REK D;  4H9N B;  3REK A;  5AV8 D;  5GSU A;  5B24 B;  3C1B C;  3REI C;  5AVC C;  1P3L B;  5CP6 B;  4DQY B;  1P3O A;  5GXQ B;  1M18 A;  5FUG B;  1KX4 B;  3X1S B;  3AV1 C;  2ZM5 A;  4LD9 A;  5B32 C;  4J8V B;  3AZN B;  3LJA A;  2IO5 C;  1ID3 B;  3W99 B;  3EPK A;  2HUE B;  3O62 A;  1F66 D;  3C1B A;  3REI A;  5B32 D;  4HGA B;  1P3O C;  1M18 C;  1P3F B;  5AVB D;  1P3P A;  5JRG C;  1EQZ D;  2HIO A;  3WTP D;  5JA4 B;  3AZI D;  1P3I A;  3W98 A;  3EPL A;  3UTB B;  3AZE B;  3AZJ B;  3R45 B;  4XZQ B;  4ZBJ C;  3A6N D;  3O62 C;  3REL A;  2NZD C;  3KUY A;  1P3P C;  3AN2 A;  1WWI A;  4R8P D;  4Z5T C;  4QLC A;  4X23 D;  3EG5 B;  3WKJ B;  3W96 B;  3W98 C;  1KX3 C;  3X1U C;  2Y2I A;  4WNN B;  5CPJ D;  3MGS D;  3AZM C;  3REH A;  2G5I C;  2ARO D;  3B0D B;  4H9Q A;  4CSR A;  4J8W A;  4HGA C;  3KUY C;  3TU4 D;  5CPI B;  5GT0 C;  1BH8 B;  5CPI D;  2ARO B;  3TU4 B; 
#chains in the Genus database with same CATH homology
 3MNN B;  4J8U C;  5CPK D;  5GT3 B;  3W96 D;  5AY8 B;  1KX3 A;  5AV9 C;  5B0Z A;  5DNM A;  4UUZ B;  4R8P B;  4J8W C;  2RVQ D;  5AVC B;  5GT0 A;  1BH9 B;  5B31 G;  5B2I A;  3AFA A;  3LZ0 C;  2CV5 D;  4J8U A;  3UTB D;  1M19 A;  4YM6 A;  3AZI B;  3WAA A;  3FDD A;  5G49 B;  1EQZ B;  4KGC A;  5B1M C;  3B6G C;  1TZY A;  3REJ A;  5AVB B;  5B33 C;  4ZBJ B;  5B32 B;  3LEL B;  3AZK C;  3W99 D;  1KX5 A;  3KWQ C;  3AV2 A;  1P3B C;  3VH6 W;  3NQJ A;  3AZN D;  4J8V D;  5C3I B;  3B6G A;  4WU9 B;  4KHA A;  3X1S D;  2Y2Q A;  1KX4 D;  2Y2G A;  3H0M C;  5E5A C;  2BYK B;  1R4V A;  1A7W A;  3A1I A;  2FJ7 A;  5AV8 B;  1P3B D;  1KX5 C;  3WA9 A;  5AV5 A;  1P3B A;  2FJ7 D;  4LD9 B;  4EO5 B;  4J8V A;  1P3A C;  4WU8 D;  5AV9 B;  5B33 B;  1B6W A;  5AY8 C;  1M1A C;  1KX5 D;  3UT9 A;  2VQR A;  1AOI B;  3H0R C;  4H9S A;  3IP4 C;  4XUJ A;  3X1T B;  4DRA A;  3W97 D;  3X1U B;  3W98 B;  4LD9 C;  4XUJ D;  5DNN D;  2BYM A;  4Z2M G;  5AVB C;  5AV6 B;  5BNX A;  4ZUX D;  1ZLA D;  3C1B D;  3REI D;  2NZD B;  4XUJ C;  5B40 C;  3AZF C;  3AV1 D;  3AZE C;  3AZJ C;  1TAF A;  3LZ0 B;  4J8X D;  2HIO C;  5B2J B;  1T3U A;  4JJN A;  1ZLA C;  2NQB D;  3REH B;  4ZUX A;  4J8W B;  5B40 D;  5B31 D;  3AYW A;  4Z66 B;  1F66 C;  4Z5T D;  1F1E A;  4Z5T B;  5B31 B;  5GXQ A;  3MGQ D;  3X1V A;  3REH D;  5B2J D;  3KXB A;  4J8X B;  1ID3 A;  3AV1 B;  2NZD D;  3REH C;  3C1B B;  3REI B;  1ZLA B;  5B24 C;  2YFV B;  3C1C B;  1M19 B;  2ZY5 A;  4YS3 A;  3NQU B;  2FFF B;  1U35 A;  4KGC B;  3W98 D;  3X1V D;  1N1J B;  3X1U D;  1ID3 C;  3X1T D;  1P3G D;  2CV5 C;  3VH5 A;  5B24 A;  5CPI C;  5GT0 D;  3KUY B;  3UTB C;  1AOI D;  3AV2 B;  4H9O B;  5B2I C;  3B6G D;  4QLC C;  1P3G C;  5B33 D;  5AV9 D;  4WU8 B;  4KHA B;  4NE3 A;  4WU9 A;  5BNV A;  2BYK A;  2FJ7 B;  1TZY C;  3LZ1 A;  5B32 G;  5CPI A;  3KWQ D;  1BH8 A;  1P3B B;  2F8N G;  5GT3 A;  4Z2M H;  5AV9 A;  5JRG B;  4WU9 D;  3B0C T;  3R45 A;  5DNM C;  5B1L C;  4R8P A;  4G91 B;  4KUD B;  1BFM A;  2FJ7 C;  5B2I B;  3REL D;  2CWE A;  3LEL D;  5DNM D;  4WU8 C;  5B0Y B;  4YM6 C;  2Y2K A;  5B1M A;  4WNN A;  1P3A A;  3VH6 A;  1P3M B;  3AZG A;  3AZH A;  2CV5 B;  2ARO A;  3TU4 A;  5AV8 C;  3UTA A;  1HQ3 C;  5AVC D;  3B6F B;  1TAF B;  3EPH A;  4CAY B;  3LJA B;  5B2J A;  4JJN B;  2JCH A;  4UPK A;  5AY8 D;  3AZL A;  5GT3 D;  2Y2N A;  5CPK B;  3MNN D;  1HQ3 D;  3MVD C;  3AZG C;  3AZH C;  3UTA D;  3MGS B;  5CPJ B;  3WTP C;  3AZG D;  3AYW D;  3AZH D;  3AZE A;  4H9R A;  3AZJ A;  3AV1 A;  5DNN C;  1P3K A;  3MVD A;  5B32 A;  4X23 B;  3WKJ D;  4JJN C;  3LJA C;  1B67 A;  3O62 D;  3MGQ C;  4ZUX C;  1AOI A;  3B6F C;  3AYW C;  2G5H C;  3A6N B;  4XZQ D;  3V9R A;  3AZE D;  3AZJ D;  2RIQ A;  2XD1 A;  3WTP B;  1P3K D;  4H9P B;  1P3F D;  1U35 D;  3H0L C;  1F66 B;  3B0D C;  3AZF A;  1ID3 D;  1KX3 B;  3WTP E;  5B0Z B;  4UUZ A;  3MGR B;  4G91 C;  1U35 C;  4WV4 B;  3AZL D;  4AWL C;  5GXQ D;  5CP6 D;  1P3L D;  1BH9 A;  3KXB D;  2RVQ C;  4WJ3 C;  2JSS A;  4NE5 A;  5B24 D;  5F99 B;  4YM6 B;  3AZI A;  1P3I D;  5B0Y C;  1JFI A;  3REK B;  2PYO A;  5JRG A;  2Y2L A;  5GSU B;  3KXB C;  1TZY B;  1P3G A;  3X1T C;  2BYM B;  1P3L A;  5FUG A;  1KX4 A;  4KUD A;  2Y2O A;  1HTA A;  5B1L B;  1P34 C;  2NZD A;  2YFV A;  3MGP B;  3MGP D;  2F8N B;  5B0Y A;  5B1L D;  2PYO C;  3VH5 W;  3LZ0 A;  1P3A B;  1H3O A;  2W8S A;  3X1S C;  1P34 D;  3WAA C;  1KX4 C;  1WWS A;  1TZY D;  2YFW B;  2CV5 A;  4KGC C;  3KFU G;  1P34 A;  4G92 C;  4YM6 D;  5B31 A;  1P3I B;  4H9O A;  5F99 D;  5E5A B;  1S32 B;  3KXB B;  1Q9C A;  4WU8 A;  3KWQ A;  3AV2 C;  4WU9 C;  1ULY A;  3AZL B;  5CPK A;  4X23 C;  3MGR D;  3VH6 T;  5KDM A;  1M1A D;  4QLC B;  3WKJ A;  5B0Z D;  5AV5 D;  1KX3 D;  5BS7 C;  3AZK B;  2ARO C;  3TU4 C;  3AFA C;  3MGR C;  2F2A C;  1U35 B;  5GT3 C;  1M19 C;  4Z66 C;  3C1C C;  5AV5 C;  3B0C W;  1P3K B;  3MVD B;  3W96 C;  3F6T A;  5AY8 A;  5AV6 A;  5BT1 C;  5BS7 A;  2F8N K;  3AZM B;  3AZN A;  1Z2C B;  1S32 C;  2Y2M A;  3AZF D;  3W99 A;  3O62 B;  5CHL B;  3AFA B;  4J8X C;  5BT1 D;  2HIO D;  3WTP A;  1P3F A;  1P3P B;  4J8U B;  3LZ1 B;  2NQB C;  3WA9 D;  3WAA B;  3AYW B;  3AZH B;  5BO0 B;  3AZG B;  5B1M D;  3UTA B;  5JA4 A;  3REJ B;  3MGQ A;  4H9N A;  5AVB A;  4XZQ A;  3B6F A;  4J8X A;  1HQ3 B;  5B40 A;  5B2J C;  2LY8 A;  1P3F C;  5CP6 A;  2IO5 B;  1P3O B;  3AN2 B;  1M18 B;  2NQB A;  2ZY4 A;  4JJN D;  1M1A A;  3NQJ B;  3LJA D;  1P3M C;  4EO5 C;  1ZLA A;  3B6F D;  3AL0 C;  4YS3 B;  3A1K A;  4CSR B;  4H9Q B;  4H9S C;  2PYO B;  2DQN C;  1P3M D;  2Y2H A;  1N1J A;  5GXQ C;  5CP6 C;  3X1V C;  5DNN A;  1P3K C;  1P3M A;  3W97 A;  1P3I C;  5B0Y D;  1AOI C;  5DNM B;  2HUE C;  3UT9 B;  5GSU C;  3UT9 D;  5B2I D;  3REL B;  5AVC A;  4KUD D;  2Y2J A;  4YS3 C;  5BNV B;  2XD5 A;  2YFW A;  5JRG D;  2UWX A;  3W97 C;  3X1T A;  1P3L C;  2JE5 A;  1KU5 A;  3X1U A;  4KUD C;  1F66 A;  2PYO D;  1PZR A;  5C3I C;  4YS3 D;  3A6N C;  3MGS A;  4G92 B;  3LEL A;  3KWQ B;  2J8P A;  5KDM B;  2Y2P A;  3AN2 D;  4NE6 A;  3X1S A;  1P3O D;  1M18 D;  2ZY2 A;  4DRB A;  3B6G B;  1EQZ C;  3REL C;  3LZ1 C;  3A6N A;  3MGP C;  3MGS C;  3AV2 D;  4AWL B;  3V9R B;  5B31 C;  3LEL C;  3AZI C;  1JFI B;  5GT0 B;  3KUY D;  3REJ D;  3AN2 C;  2F8N H;  4Z5T A;  5B1M B;  1P3G B;  3WAA D;  3WA9 B;  3LZ1 D;  4J8U D;  3X1V B;  1P3P D;  5CPK C;  4KGC D;  2HIO B;  3AFA D;  4R8P C;  5B1L A;  3AZM A;  1EQZ A;  3REJ C;  3MGP A;  3UTB A;  5B33 A;  5F99 C;  3C1C D;  3AZF B;  1M19 D;  2F8N A;  4NFT A;  4CAY A;  4E44 A;  3AZM D;  5CPJ C;  3MGR A;  1H3O B;  3EPJ A;  3C1C A;  3NQU A;  5B0Z C;  5BO0 A;  3MNN C;  3MVD D;  3W96 A;  5F99 A;  3MGQ B;  5E5A A;  5CPJ A;  3AZK D;  5AV8 A;  3UTA C;  1S32 A;  4Z66 D;  1HQ3 A;  4E45 A;  5B40 B;  4J8W D;  3W99 C;  5BNX B;  3KSY A;  4H9R B;  3WA9 C;  2NQB B;  5AV5 B;  4QLC D;  4X23 A;  1M1A B;  3MNN A;  4WZS B;  3WKJ C;  3LZ0 D;  4J8V C;  3AZK A;  1S32 D;  5E5A D;  4M6B A;  4ZUX B;  5AV6 D;  3VH5 T;  4XZQ C;  4Z66 A;  2BG1 A;  5DNN B;  2DF4 C;  4H9P A;  4XUJ B;  2ZY3 A;  1P34 B;  3W97 B;  1P3A D;  3B0B A;  5AV6 C;  5G49 A;  1W2E A;  3AZN C;  2F8N D;  3P5J B;  2L5A A;  3REK C;  1KX5 B;  3AZL C;  5GSU D;  3UT9 C;  4LD9 D;  3REK D;  4H9N B;  3REK A;  5AV8 D;  5GSU A;  5B24 B;  3C1B C;  3REI C;  5AVC C;  1P3L B;  5CP6 B;  4DQY B;  1P3O A;  5GXQ B;  1M18 A;  5FUG B;  1KX4 B;  3X1S B;  3AV1 C;  2ZM5 A;  4LD9 A;  5B32 C;  4J8V B;  3AZN B;  3LJA A;  2IO5 C;  1ID3 B;  3W99 B;  3EPK A;  2HUE B;  3O62 A;  1F66 D;  3C1B A;  3REI A;  5B32 D;  4HGA B;  1P3O C;  1M18 C;  1P3F B;  5AVB D;  1P3P A;  5JRG C;  1EQZ D;  2HIO A;  3WTP D;  5JA4 B;  3AZI D;  1P3I A;  3W98 A;  3EPL A;  3UTB B;  3AZE B;  3AZJ B;  3R45 B;  4XZQ B;  4ZBJ C;  3A6N D;  3O62 C;  3REL A;  2NZD C;  3KUY A;  1P3P C;  3AN2 A;  1WWI A;  4R8P D;  4Z5T C;  4QLC A;  4X23 D;  3EG5 B;  3WKJ B;  3W96 B;  3W98 C;  1KX3 C;  3X1U C;  2Y2I A;  4WNN B;  5CPJ D;  3MGS D;  3AZM C;  3REH A;  2G5I C;  2ARO D;  3B0D B;  4H9Q A;  4CSR A;  4J8W A;  4HGA C;  3KUY C;  3TU4 D;  5CPI B;  5GT0 C;  1BH8 B;  5CPI D;  2ARO B;  3TU4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...