3AZIA

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziA00
1P3BA 1A7WA 2F8NH 5JA4A 4J8VC 3LJAA 5DNMD 5AV8D 3A6NB 1P3KB 3KUYB 5B1MA 3O62D 4YS3C 4X23A 3KWQA 1P3GD 3W96A 2F8NA 5AV9B 3W98C 2PYOC 4NE6A 5B40C 3WAAA 5E5AA 4H9QB 3AZFD 3WTPD 4XUJB 3A6ND 5JRGD 3KXBD 3LZ0A 3AYWB 3AZEC 3MVDD 4WU9C 3AZKB 3C1CC 4J8UA 4YM6B 4R8PC 4JJNA 5GSUB 4KGCB 3LZ1B 3LELD 1ZLAC 3W99D 5BO0B 4LD9D 3AZLD 5GT0B 3NQJA 5BNXB 3MGQD 1P3PB 5GT3A 3AV1D 1S32B 3AZHB 4ZUXB 3LZ1D 2NZDA 3REIB 5BNVB 3C1BD 3B6GA 4YM6C 4UUZA 5JA4B 5B2JB 3AN2B 1P3OD 5CPIA 1TZYB 5GT0D 1P3FA 1KX4B 1P3AA 1HQ3C 1M19D 3AFAD 5DNNC 5AV5C 4G92C 3AZGD 1KX5B 4DRBA 4XZQB 3W97C 3W96B 4KUDC 2FJ7A 4H9SC 1P3BD 3REJC 1P3PC 3RELA 4H9RA 4J8XB 4Z5TA 3LJAD 3REKA 3AZIA 1AOIC 1EQZA 3WAAB 3X1SA 3MNNC 5CHLB 3REIC 5B1MD 3WA9B 5B2JC 2BYKA 3X1UB 1KX3A 1ID3C 1KX5D 3KWQD 2F8ND 3W96D 3UTAB 2RVQD 4KHAA 5B24A 1M18C 5CP6C 3X1TC 2YFWA 1B67A 1F66B 3WAAD 5E5AD 4JJNB 3WKJA 4Z2MH 4H9OB 4YS3A 3LZ0D 3W98A 4QLCA 2PYOA 5BS7C 5B0YC 5B40A 1M1AA 4J8UD 2YFVA 3X1VA 3WA9C 4JJND 2AROB 5B32G 4AWLB 3AZJB 4WV4B 3UTBA 5GXQC 3AZEA 3B0CW 4EO5C 3VH5A 5B31G 4WU9A 3AZMB 1F66C 3C1CA 5CPKB 3B6FC 2NQBC 1P3AB 5GT3D 1P3LC 5B2IC 4G91C 1BH9A 1P3IC 1U35A 4HGAC 2NZDD 1ZLAA 4WU8A 3VH6T 3B6GD 3RELB 5B1LC 5DNMB 2IO5C 4Z5TB 5CPID 1P3MB 3AZJC 3UT9A 1P3FD 3AZIB 1F1EA 1P3AD 4E45A 5FUGA 3MGSC 3O62B 3B0DC 1P3GB 2BYMA 5F99C 2FJ7D 5B33C 4KHAB 3RELD 5B24B 5CPJA 4Z5TD 3REKD 1P3MD 1HQ3A 1P34C 3AZID 3AZFB 3WTPB 5B32C 1EQZD 5JRGB 3X1SD 3WKJB 3KXBB 1JFIA 4CSRB 2HUEC 5B31C 1KX3D 3MVDB 4H9SA 4KUDA 3REJA 4Z66C 4QLCB 5AV8C 5G49A 5B24D 1M1AB 1AOIA 5AV6A 5AVCC 3MNNA 3WKJD 3REHA 3MGRC 3UTBB 4YS3D 4ZBJB 3AV2A 1ID3A 3W98D 4QLCD 3LELB 3W99B 3WTPE 3MGPA 1M18A 3A6NC 5CP6A 4LD9B 3AZLB 5B40D 1P3KC 3MGQB 3KUYC 1M1AD 3VH6W 3AV1B 3X1VD 2CV5A 4H9PA 3AZNA 5AV9C 3TU4A 3UTBD 3AZED 4J8WA 5BS7A 5AY8A 3V9RA 3C1BB 4WU9D 5B0YA 3R45A 1P3OB 1BH8B 4XUJC 3C1CD 4H9NA 1N1JB 3UT9B 3AYWC 1M19B 2CWEA 3AFAB 5GXQA 3AZKC 3AZGB 1U35D 2BYMB 1P3BB 1ZLAD 4WU8D 5AVBA 4DRAA 3B6FA 3LJAB 2NQBA 5GSUC 4KGCC 3UT9D 1TAFA 1ULYA 3LZ1C 1P3LA 5B2IA 1P3IA 5B1MB 2HIOA 4X23B 3KWQB 2F8NB 5C3IB 5B0ZA 5GT0C 5B1LA 4CAYA 5CPJD 1S32C 3AZHC 1HQ3D 5E5AB 4ZUXC 3MGSA 3REHB 3LZ0B 1H3OA 3AN2C 4WNNA 4X23D 3LJAC 4KUDD 4J8VA 4NE3A 1TZYC 1KX4C 3MGPB 4J8UB 1AOID 5B32A 5AV6D 3MNND 2CV5B 1KX5C 3REHD 4XZQC 3W96C 5B31A 3TU4B 4J8XC 3AV2D 1ID3D 4Z66A 4J8WB 3WAAC 3MGPD 1M18D 5CP6D 5AVCA 4H9NB 3NQJB 2L5AA 3LZ0C 1HTAA 5GT3B 3MGRA 3X1UC 2CV5D 3AZND 3TU4D 3UTAC 2NZDB 4J8WD 5AY8D 2LY8A 3B6GB 5B0YD 4UUZB 5AVBB 4JJNC 5CPIB 1P3KA 3KUYA 1KU5A 4R8PA 1P3FB 5AV9A 5GXQD 5B0ZB 2FJ7B 4XUJA 4H9RB 5AVBD 4CAYB 3REKB 2AROC 3B6FD 2NQBD 4AWLC 3AYWA 1EQZB 3X1SB 1P3LD 5B2ID 1P3ID 3AZKA 3AZMC 2BYKB 1KX3B 4M6BA 5CPKC 2HIOD 5CPIC 4YM6A 2F8NK 5B0ZD 1P3FC 1P3AC 5B1LD 5GSUA 4KGCA 5BT1C 2YFWB 3NQUA 3MGSD 5DNNA 4YS3B 5AV5A 3W97A 3RELC 3W98B 5DNMC 1P3PA 5BNXA 4Z5TC 1P3MC 2PYOB 4J8VD 3AZIC 1S32A 3AZHA 5B40B 2YFVB 4ZUXA 5B32D 3X1VB 3O62C 3REIA 1KX3C 1P3GC 5BNVA 5B2JA 3AN2A 5B31D 3AZEB 5B24C 4Z66D 1TZYA 1KX4A 4WU9B 2PYOD 3VH5T 1R4VA 3AZFC 3WTPC 3C1CB 5JRGC 3X1TA 3WKJC 3KXBC 5AVCD 4R8PB 1KX5A 4XZQA 3MGRD 3MVDC 4QLCC 4J8XA 1BH9B 1U35B 1ZLAB 1M1AC 4WU8B 3X1VC 1P3KD 3KUYD 3WA9A 4R8PD 3X1UA 3UTBC 4ZBJC 5AV9D 5FUGB 3UTAA 3LELC 3W99C 1BFMA 2F8NG 4LD9C 3AZLC 1F66A 3MGQC 4XUJD 3AV1C 5CPJB 4H9OA 1WWIA 1HQ3B 3AYWD 5KDMA 4NFTA 1U35C 1JFIB 3NQUB 3C1BC 5DNNB 1P3OC 5AV5B 4G92B 3AZKD 4WU8C 3W97B 4KUDB 1B6WA 3REJB 4YM6D 3UT9C 2AROA 5G49B 5GSUD 3AZJA 1M19C 4KGCD 3AFAC 1AOIB 3VH5W 5AV6B 3MNNB 3AZGC 3KSYA 3AZMA 1P3BC 5DNND 3AV2B 5AV5D 5CPKA 1ID3B 3W97D 5F99A 5CPJC 1P3PD 3REJD 5B33A 2JSSA 1S32D 1M18B 3B0CT 3AZHD 5CP6B 3X1TB 1P34A 5B1MC 4ZUXD 3VH6A 4H9PB 4X23C 3REID 3KWQC 3AZNB 5C3IC 5B2JD 3AN2D 2RVQC 5DNMA 1P3MA 5AY8B 3V9RB 1TZYD 5AV8A 1KX4D 5B0YB 5AV6C 3B0BA 3R45B 5E5AC 3X1TD 3REHC 3O62A 1P3GA 3AV2C 4XZQD 4WZSB 5GXQB 4J8XD 4EO5B 3MGPC 4J8UC 3AZFA 3WTPA 1WWSA 3A6NA 5JRGA 3KXBA 3B6FB 2CV5C 2NQBB 4CSRA 3AZNC 3WA9D 3TU4C 3X1UD 3MVDA 1TAFB 5KDMB 1P3LB 5B2IB 4J8WC 4G91B 5AY8C 1P3IB 3UTAD 4HGAB 2HIOB 4H9QA 1F66D 5B1LB 2IO5B 5GT3C 1Q9CA 2NZDC 3LELA 3MGSB 3W99A 1H3OB 3B0DB 3B6GC 4LD9A 5AVBC 3AZLA 4WNNB 5F99B 3MGQA 4J8VB 5B33B 3AV1A 2AROD 4NE5A 1P34B 3AZJD 4Z2MG 5B32B 3LZ1A 4E44A 2HIOC 3C1BA 1P3OA 3AZMD 2HUEB 5B31B 5B0ZC 2FJ7C 1BH8A 5CPKD 5BO0A 4Z66B 5GT0A 5F99D 3REKC 5AV8B 1N1JA 5B33D 1M19A 1EQZC 3X1SC 3AFAA 5AVCB 1P34D 5BT1D 3AZGA 3MGRB
chains in the Genus database with same CATH superfamily
1P3BA 1A7WA 2F8NH 5JA4A 4J8VC 3LJAA 5DNMD 5AV8D 3EPHA 3A6NB 1P3KB 3KUYB 5B1MA 3O62D 4YS3C 4X23A 3KWQA 1P3GD 3W96A 2F8NA 5AV9B 3W98C 3EG5B 2PYOC 4NE6A 5B40C 3WAAA 5E5AA 4H9QB 3AZFD 3WTPD 4XUJB 3A6ND 5JRGD 3KXBD 3LZ0A 3AYWB 3AZEC 3MVDD 4WU9C 2ZY2A 3AZKB 3C1CC 4J8UA 4YM6B 2Y2LA 4R8PC 4JJNA 5GSUB 2Y2OA 4KGCB 3LZ1B 3LELD 1ZLAC 3W99D 5BO0B 4LD9D 3AZLD 5GT0B 3P5JB 3NQJA 5BNXB 3MGQD 1P3PB 5GT3A 3AV1D 1S32B 3AZHB 2F2AC 4ZUXB 3LZ1D 2NZDA 2Y2GA 3REIB 5BNVB 3C1BD 3B6GA 4YM6C 4UUZA 5JA4B 5B2JB 3AN2B 1P3OD 2BG1A 5CPIA 1TZYB 5GT0D 1P3FA 1KX4B 1P3AA 1HQ3C 2XD5A 1M19D 3AFAD 5DNNC 5AV5C 4G92C 3AZGD 1KX5B 4DRBA 4XZQB 3W97C 3W96B 4KUDC 2FJ7A 4H9SC 1P3BD 3REJC 1P3PC 3RELA 4H9RA 4J8XB 3A1IA 4Z5TA 3LJAD 3REKA 3AZIA 1AOIC 1EQZA 3WAAB 3X1SA 3MNNC 5CHLB 3REIC 5B1MD 3WA9B 5B2JC 2JE5A 2BYKA 3X1UB 1KX3A 1KX5D 1ID3C 3KWQD 2F8ND 3W96D 3UTAB 2RVQD 4KHAA 5B24A 1M18C 5CP6C 3X1TC 2YFWA 1B67A 1F66B 3WAAD 5E5AD 4JJNB 3WKJA 4Z2MH 4H9OB 4YS3A 3LZ0D 2Y2QA 2Y2NA 3W98A 4QLCA 2PYOA 5BS7C 5B0YC 5B40A 1M1AA 4J8UD 2YFVA 3X1VA 3WA9C 4JJND 2AROB 5B32G 4AWLB 3AZJB 4WV4B 1W2EA 3UTBA 5GXQC 3H0MC 3AZEA 3B0CW 4EO5C 3VH5A 5B31G 4WU9A 2JCHA 2ZM5A 3AZMB 1F66C 3C1CA 5CPKB 3H0LC 3B6FC 2NQBC 1P3AB 5GT3D 1P3LC 5B2IC 4G91C 1BH9A 1P3IC 1U35A 4HGAC 2NZDD 1ZLAA 4WU8A 3VH6T 3B6GD 3RELB 5B1LC 5DNMB 2IO5C 4Z5TB 5CPID 1P3MB 3AZJC 3UT9A 1P3FD 3AZIB 1F1EA 1P3AD 4E45A 2ZY4A 5FUGA 3MGSC 3O62B 3B0DC 1P3GB 2BYMA 2ZY3A 5F99C 2FJ7D 5B33C 4KHAB 3RELD 5B24B 5CPJA 4Z5TD 3REKD 1P3MD 1HQ3A 1P34C 3AZID 3AZFB 3WTPB 5B32C 1EQZD 5JRGB 3X1SD 3WKJB 3KXBB 1JFIA 4CSRB 2HUEC 5B31C 1KX3D 3MVDB 4H9SA 4KUDA 3REJA 4Z66C 4QLCB 5AV8C 5G49A 5B24D 2DQNC 1M1AB 1AOIA 5AV6A 5AVCC 3MNNA 3WKJD 3REHA 3MGRC 3UTBB 4YS3D 4ZBJB 3AV2A 1ID3A 3W98D 4QLCD 3LELB 3W99B 3WTPE 3MGPA 1M18A 3A6NC 5CP6A 4LD9B 3AZLB 5B40D 1P3KC 3MGQB 3KUYC 1M1AD 3VH6W 4DQYB 3AV1B 3X1VD 2CV5A 4H9PA 3AZNA 5AV9C 3TU4A 3UTBD 3AZED 4J8WA 5BS7A 5AY8A 3V9RA 3C1BB 4WU9D 5B0YA 3R45A 1P3OB 3KFUG 1BH8B 1PZRA 2J8PA 2ZY5A 3FDDA 4XUJC 3C1CD 4H9NA 1N1JB 3UT9B 3AYWC 1M19B 2CWEA 3AFAB 5GXQA 3AZKC 3AZGB 1U35D 2BYMB 3A1KA 1P3BB 4UPKA 1ZLAD 4WU8D 5AVBA 4DRAA 3B6FA 3LJAB 2NQBA 5GSUC 4KGCC 3UT9D 1TAFA 1ULYA 3LZ1C 1P3LA 5B2IA 1P3IA 5B1MB 2HIOA 4X23B 3KWQB 2F8NB 5C3IB 5B0ZA 5GT0C 5B1LA 4CAYA 5CPJD 1S32C 3AZHC 1HQ3D 5E5AB 4ZUXC 2W8SA 3MGSA 3REHB 3LZ0B 1H3OA 3AN2C 4WNNA 4X23D 3LJAC 4KUDD 4J8VA 4NE3A 1TZYC 1KX4C 3MGPB 4J8UB 1AOID 5B32A 5AV6D 3MNND 2CV5B 1KX5C 3REHD 4XZQC 3W96C 5B31A 3TU4B 4J8XC 3AV2D 1ID3D 4Z66A 4J8WB 3WAAC 3EPJA 3MGPD 1M18D 5CP6D 5AVCA 4H9NB 3NQJB 2L5AA 3LZ0C 1HTAA 5GT3B 3MGRA 3X1UC 2CV5D 3AZND 3TU4D 3UTAC 2NZDB 4J8WD 5AY8D 2LY8A 3B6GB 5B0YD 4UUZB 5AVBB 4JJNC 5CPIB 1P3KA 3KUYA 1KU5A 4R8PA 1P3FB 5AV9A 5GXQD 4WJ3C 5B0ZB 2FJ7B 4XUJA 4H9RB 5AVBD 4CAYB 3REKB 2AROC 3B6FD 2NQBD 1T3UA 4AWLC 3AYWA 1EQZB 3X1SB 3EPLA 1P3LD 5B2ID 1P3ID 3AZKA 3AZMC 2UWXA 2BYKB 1KX3B 4M6BA 5CPKC 2HIOD 5CPIC 4YM6A 2F8NK 5B0ZD 1P3FC 1P3AC 5B1LD 5GSUA 4KGCA 5BT1C 2YFWB 3EPKA 3NQUA 3MGSD 5DNNA 4YS3B 5AV5A 3W97A 3RELC 3W98B 5DNMC 1P3PA 5BNXA 4Z5TC 1P3MC 2PYOB 4J8VD 3AZIC 1S32A 3AZHA 5B40B 2YFVB 4ZUXA 5B32D 3X1VB 3O62C 3REIA 1KX3C 1P3GC 5BNVA 5B2JA 3AN2A 5B31D 3AZEB 5B24C 4Z66D 1TZYA 1KX4A 4WU9B 2PYOD 3VH5T 1R4VA 3AZFC 3WTPC 3C1CB 5JRGC 3X1TA 3WKJC 3KXBC 5AVCD 4R8PB 1KX5A 4XZQA 3MGRD 3MVDC 4QLCC 4J8XA 1BH9B 1U35B 1ZLAB 1M1AC 4WU8B 3X1VC 1P3KD 3KUYD 3WA9A 4R8PD 3X1UA 3UTBC 4ZBJC 5AV9D 5FUGB 3UTAA 3LELC 3W99C 1BFMA 2F8NG 2RIQA 4LD9C 3AZLC 1Z2CB 3MGQC 1F66A 4XUJD 3AV1C 5CPJB 4H9OA 2Y2MA 1WWIA 1HQ3B 3F6TA 2Y2HA 3AYWD 5KDMA 4NFTA 1U35C 1JFIB 3NQUB 3C1BC 5DNNB 1P3OC 5AV5B 4G92B 3AZKD 4WU8C 3W97B 4KUDB 1B6WA 3REJB 4YM6D 3UT9C 2AROA 5G49B 5GSUD 3AZJA 1M19C 4KGCD 3AFAC 2Y2JA 3VH5W 5AV6B 1AOIB 3MNNB 3AZGC 3KSYA 3AZMA 1P3BC 2DF4C 5DNND 3AV2B 5AV5D 5CPKA 1ID3B 3W97D 5F99A 5CPJC 1P3PD 3REJD 5B33A 3IP4C 2JSSA 2VQRA 1S32D 1M18B 3B0CT 3AZHD 5CP6B 3X1TB 1P34A 5B1MC 4ZUXD 3VH6A 4H9PB 4X23C 3REID 3KWQC 3AZNB 5C3IC 5B2JD 3AN2D 2RVQC 5DNMA 1P3MA 5AY8B 3V9RB 1TZYD 5AV8A 1KX4D 5B0YB 5AV6C 3B0BA 3R45B 5E5AC 3X1TD 2Y2IA 3REHC 3O62A 1P3GA 3AV2C 4XZQD 4WZSB 5GXQB 4J8XD 4EO5B 3MGPC 2G5IC 4J8UC 3AZFA 3WTPA 1WWSA 3A6NA 5JRGA 3KXBA 3B6FB 2CV5C 2NQBB 4CSRA 3AZNC 3WA9D 3TU4C 3X1UD 3MVDA 1TAFB 5KDMB 1P3LB 5B2IB 4J8WC 4G91B 5AY8C 1P3IB 3UTAD 4HGAB 2HIOB 3AL0C 4H9QA 1F66D 5B1LB 2IO5B 5GT3C 1Q9CA 2NZDC 2G5HC 3H0RC 3LELA 3MGSB 3W99A 1H3OB 3B0DB 3B6GC 2Y2PA 5AVBC 3AZLA 4WNNB 4LD9A 5F99B 3MGQA 2Y2KA 4J8VB 5B33B 3AV1A 2XD1A 2AROD 4NE5A 1P34B 3AZJD 4Z2MG 5B32B 3LZ1A 4E44A 2FFFB 2HIOC 3C1BA 1P3OA 3AZMD 2HUEB 5B31B 5B0ZC 2FJ7C 1BH8A 5CPKD 5BO0A 4Z66B 5GT0A 5F99D 3REKC 5AV8B 1N1JA 5B33D 1M19A 1EQZC 3X1SC 3AFAA 5AVCB 1P34D 5BT1D 3AZGA 3MGRB
chains in the Genus database with same CATH topology
1P3BA 1A7WA 2F8NH 5JA4A 4J8VC 3LJAA 5DNMD 5AV8D 3EPHA 3A6NB 1P3KB 3KUYB 5B1MA 3O62D 4YS3C 4X23A 3KWQA 1P3GD 3W96A 2F8NA 5AV9B 3W98C 3EG5B 2PYOC 4NE6A 5B40C 3WAAA 5E5AA 4H9QB 3AZFD 3WTPD 4XUJB 3A6ND 5JRGD 3KXBD 3LZ0A 3AYWB 3AZEC 3MVDD 4WU9C 2ZY2A 3AZKB 3C1CC 4J8UA 4YM6B 2Y2LA 4R8PC 4JJNA 5GSUB 2Y2OA 4KGCB 3LZ1B 3LELD 1ZLAC 3W99D 5BO0B 4LD9D 3AZLD 5GT0B 3P5JB 3NQJA 5BNXB 3MGQD 1P3PB 5GT3A 3AV1D 1S32B 3AZHB 2F2AC 4ZUXB 3LZ1D 2NZDA 2Y2GA 3REIB 5BNVB 3C1BD 3B6GA 4YM6C 4UUZA 5JA4B 5B2JB 3AN2B 1P3OD 2BG1A 5CPIA 1TZYB 5GT0D 1P3FA 1KX4B 1P3AA 1HQ3C 2XD5A 1M19D 3AFAD 5DNNC 5AV5C 4G92C 3AZGD 1KX5B 4DRBA 4XZQB 3W97C 3W96B 4KUDC 2FJ7A 4H9SC 1P3BD 3REJC 1P3PC 3RELA 4H9RA 4J8XB 3A1IA 4Z5TA 3LJAD 3REKA 3AZIA 1AOIC 1EQZA 3WAAB 3X1SA 3MNNC 5CHLB 3REIC 5B1MD 3WA9B 5B2JC 2JE5A 2BYKA 3X1UB 1KX3A 1KX5D 1ID3C 3KWQD 2F8ND 3W96D 3UTAB 2RVQD 4KHAA 5B24A 1M18C 5CP6C 3X1TC 2YFWA 1B67A 1F66B 3WAAD 5E5AD 4JJNB 3WKJA 4Z2MH 4H9OB 4YS3A 3LZ0D 2Y2QA 2Y2NA 3W98A 4QLCA 2PYOA 5BS7C 5B0YC 5B40A 1M1AA 4J8UD 2YFVA 3X1VA 3WA9C 4JJND 2AROB 5B32G 4AWLB 3AZJB 4WV4B 1W2EA 3UTBA 5GXQC 3H0MC 3AZEA 3B0CW 4EO5C 3VH5A 5B31G 4WU9A 2JCHA 2ZM5A 3AZMB 1F66C 3C1CA 5CPKB 3H0LC 3B6FC 2NQBC 1P3AB 5GT3D 1P3LC 5B2IC 4G91C 1BH9A 1P3IC 1U35A 4HGAC 2NZDD 1ZLAA 4WU8A 3VH6T 3B6GD 3RELB 5B1LC 5DNMB 2IO5C 4Z5TB 5CPID 1P3MB 3AZJC 3UT9A 1P3FD 3AZIB 1F1EA 1P3AD 4E45A 2ZY4A 5FUGA 3MGSC 3O62B 3B0DC 1P3GB 2BYMA 2ZY3A 5F99C 2FJ7D 5B33C 4KHAB 3RELD 5B24B 5CPJA 4Z5TD 3REKD 1P3MD 1HQ3A 1P34C 3AZID 3AZFB 3WTPB 5B32C 1EQZD 5JRGB 3X1SD 3WKJB 3KXBB 1JFIA 4CSRB 2HUEC 5B31C 1KX3D 3MVDB 4H9SA 4KUDA 3REJA 4Z66C 4QLCB 5AV8C 5G49A 5B24D 2DQNC 1M1AB 1AOIA 5AV6A 5AVCC 3MNNA 3WKJD 3REHA 3MGRC 3UTBB 4YS3D 4ZBJB 3AV2A 1ID3A 3W98D 4QLCD 3LELB 3W99B 3WTPE 3MGPA 1M18A 3A6NC 5CP6A 4LD9B 3AZLB 5B40D 1P3KC 3MGQB 3KUYC 1M1AD 3VH6W 4DQYB 3AV1B 3X1VD 2CV5A 4H9PA 3AZNA 5AV9C 3TU4A 3UTBD 3AZED 4J8WA 5BS7A 5AY8A 3V9RA 3C1BB 4WU9D 5B0YA 3R45A 1P3OB 3KFUG 1BH8B 1PZRA 2J8PA 2ZY5A 3FDDA 4XUJC 3C1CD 4H9NA 1N1JB 3UT9B 3AYWC 1M19B 2CWEA 3AFAB 5GXQA 3AZKC 3AZGB 1U35D 2BYMB 3A1KA 1P3BB 4UPKA 1ZLAD 4WU8D 5AVBA 4DRAA 3B6FA 3LJAB 2NQBA 5GSUC 4KGCC 3UT9D 1TAFA 1ULYA 3LZ1C 1P3LA 5B2IA 1P3IA 5B1MB 2HIOA 4X23B 3KWQB 2F8NB 5C3IB 5B0ZA 5GT0C 5B1LA 4CAYA 5CPJD 1S32C 3AZHC 1HQ3D 5E5AB 4ZUXC 2W8SA 3MGSA 3REHB 3LZ0B 1H3OA 3AN2C 4WNNA 4X23D 3LJAC 4KUDD 4J8VA 4NE3A 1TZYC 1KX4C 3MGPB 4J8UB 1AOID 5B32A 5AV6D 3MNND 2CV5B 1KX5C 3REHD 4XZQC 3W96C 5B31A 3TU4B 4J8XC 3AV2D 1ID3D 4Z66A 4J8WB 3WAAC 3EPJA 3MGPD 1M18D 5CP6D 5AVCA 4H9NB 3NQJB 2L5AA 3LZ0C 1HTAA 5GT3B 3MGRA 3X1UC 2CV5D 3AZND 3TU4D 3UTAC 2NZDB 4J8WD 5AY8D 2LY8A 3B6GB 5B0YD 4UUZB 5AVBB 4JJNC 5CPIB 1P3KA 3KUYA 1KU5A 4R8PA 1P3FB 5AV9A 5GXQD 4WJ3C 5B0ZB 2FJ7B 4XUJA 4H9RB 5AVBD 4CAYB 3REKB 2AROC 3B6FD 2NQBD 1T3UA 4AWLC 3AYWA 1EQZB 3X1SB 3EPLA 1P3LD 5B2ID 1P3ID 3AZKA 3AZMC 2UWXA 2BYKB 1KX3B 4M6BA 5CPKC 2HIOD 5CPIC 4YM6A 2F8NK 5B0ZD 1P3FC 1P3AC 5B1LD 5GSUA 4KGCA 5BT1C 2YFWB 3EPKA 3NQUA 3MGSD 5DNNA 4YS3B 5AV5A 3W97A 3RELC 3W98B 5DNMC 1P3PA 5BNXA 4Z5TC 1P3MC 2PYOB 4J8VD 3AZIC 1S32A 3AZHA 5B40B 2YFVB 4ZUXA 5B32D 3X1VB 3O62C 3REIA 1KX3C 1P3GC 5BNVA 5B2JA 3AN2A 5B31D 3AZEB 5B24C 4Z66D 1TZYA 1KX4A 4WU9B 2PYOD 3VH5T 1R4VA 3AZFC 3WTPC 3C1CB 5JRGC 3X1TA 3WKJC 3KXBC 5AVCD 4R8PB 1KX5A 4XZQA 3MGRD 3MVDC 4QLCC 4J8XA 1BH9B 1U35B 1ZLAB 1M1AC 4WU8B 3X1VC 1P3KD 3KUYD 3WA9A 4R8PD 3X1UA 3UTBC 4ZBJC 5AV9D 5FUGB 3UTAA 3LELC 3W99C 1BFMA 2F8NG 2RIQA 4LD9C 3AZLC 1Z2CB 3MGQC 1F66A 4XUJD 3AV1C 5CPJB 4H9OA 2Y2MA 1WWIA 1HQ3B 3F6TA 2Y2HA 3AYWD 5KDMA 4NFTA 1U35C 1JFIB 3NQUB 3C1BC 5DNNB 1P3OC 5AV5B 4G92B 3AZKD 4WU8C 3W97B 4KUDB 1B6WA 3REJB 4YM6D 3UT9C 2AROA 5G49B 5GSUD 3AZJA 1M19C 4KGCD 3AFAC 2Y2JA 3VH5W 5AV6B 1AOIB 3MNNB 3AZGC 3KSYA 3AZMA 1P3BC 2DF4C 5DNND 3AV2B 5AV5D 5CPKA 1ID3B 3W97D 5F99A 5CPJC 1P3PD 3REJD 5B33A 3IP4C 2JSSA 2VQRA 1S32D 1M18B 3B0CT 3AZHD 5CP6B 3X1TB 1P34A 5B1MC 4ZUXD 3VH6A 4H9PB 4X23C 3REID 3KWQC 3AZNB 5C3IC 5B2JD 3AN2D 2RVQC 5DNMA 1P3MA 5AY8B 3V9RB 1TZYD 5AV8A 1KX4D 5B0YB 5AV6C 3B0BA 3R45B 5E5AC 3X1TD 2Y2IA 3REHC 3O62A 1P3GA 3AV2C 4XZQD 4WZSB 5GXQB 4J8XD 4EO5B 3MGPC 2G5IC 4J8UC 3AZFA 3WTPA 1WWSA 3A6NA 5JRGA 3KXBA 3B6FB 2CV5C 2NQBB 4CSRA 3AZNC 3WA9D 3TU4C 3X1UD 3MVDA 1TAFB 5KDMB 1P3LB 5B2IB 4J8WC 4G91B 5AY8C 1P3IB 3UTAD 4HGAB 2HIOB 3AL0C 4H9QA 1F66D 5B1LB 2IO5B 5GT3C 1Q9CA 2NZDC 2G5HC 3H0RC 3LELA 3MGSB 3W99A 1H3OB 3B0DB 3B6GC 2Y2PA 5AVBC 3AZLA 4WNNB 4LD9A 5F99B 3MGQA 2Y2KA 4J8VB 5B33B 3AV1A 2XD1A 2AROD 4NE5A 1P34B 3AZJD 4Z2MG 5B32B 3LZ1A 4E44A 2FFFB 2HIOC 3C1BA 1P3OA 3AZMD 2HUEB 5B31B 5B0ZC 2FJ7C 1BH8A 5CPKD 5BO0A 4Z66B 5GT0A 5F99D 3REKC 5AV8B 1N1JA 5B33D 1M19A 1EQZC 3X1SC 3AFAA 5AVCB 1P34D 5BT1D 3AZGA 3MGRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B A;  1A7W A;  2F8N H;  5JA4 A;  4J8V C;  3LJA A;  5DNM D;  5AV8 D;  3A6N B;  1P3K B;  3KUY B;  5B1M A;  3O62 D;  4YS3 C;  4X23 A;  3KWQ A;  1P3G D;  3W96 A;  2F8N A;  5AV9 B;  3W98 C;  2PYO C;  4NE6 A;  5B40 C;  3WAA A;  5E5A A;  4H9Q B;  3AZF D;  3WTP D;  4XUJ B;  3A6N D;  5JRG D;  3KXB D;  3LZ0 A;  3AYW B;  3AZE C;  3MVD D;  4WU9 C;  3AZK B;  3C1C C;  4J8U A;  4YM6 B;  4R8P C;  4JJN A;  5GSU B;  4KGC B;  3LZ1 B;  3LEL D;  1ZLA C;  3W99 D;  5BO0 B;  4LD9 D;  3AZL D;  5GT0 B;  3NQJ A;  5BNX B;  3MGQ D;  1P3P B;  5GT3 A;  3AV1 D;  1S32 B;  3AZH B;  4ZUX B;  3LZ1 D;  2NZD A;  3REI B;  5BNV B;  3C1B D;  3B6G A;  4YM6 C;  4UUZ A;  5JA4 B;  5B2J B;  3AN2 B;  1P3O D;  5CPI A;  1TZY B;  5GT0 D;  1P3F A;  1KX4 B;  1P3A A;  1HQ3 C;  1M19 D;  3AFA D;  5DNN C;  5AV5 C;  4G92 C;  3AZG D;  1KX5 B;  4DRB A;  4XZQ B;  3W97 C;  3W96 B;  4KUD C;  2FJ7 A;  4H9S C;  1P3B D;  3REJ C;  1P3P C;  3REL A;  4H9R A;  4J8X B;  4Z5T A;  3LJA D;  3REK A;  3AZI A;  1AOI C;  1EQZ A;  3WAA B;  3X1S A;  3MNN C;  5CHL B;  3REI C;  5B1M D;  3WA9 B;  5B2J C;  2BYK A;  3X1U B;  1KX3 A;  1ID3 C;  1KX5 D;  3KWQ D;  2F8N D;  3W96 D;  3UTA B;  2RVQ D;  4KHA A;  5B24 A;  1M18 C;  5CP6 C;  3X1T C;  2YFW A;  1B67 A;  1F66 B;  3WAA D;  5E5A D;  4JJN B;  3WKJ A;  4Z2M H;  4H9O B;  4YS3 A;  3LZ0 D;  3W98 A;  4QLC A;  2PYO A;  5BS7 C;  5B0Y C;  5B40 A;  1M1A A;  4J8U D;  2YFV A;  3X1V A;  3WA9 C;  4JJN D;  2ARO B;  5B32 G;  4AWL B;  3AZJ B;  4WV4 B;  3UTB A;  5GXQ C;  3AZE A;  3B0C W;  4EO5 C;  3VH5 A;  5B31 G;  4WU9 A;  3AZM B;  1F66 C;  3C1C A;  5CPK B;  3B6F C;  2NQB C;  1P3A B;  5GT3 D;  1P3L C;  5B2I C;  4G91 C;  1BH9 A;  1P3I C;  1U35 A;  4HGA C;  2NZD D;  1ZLA A;  4WU8 A;  3VH6 T;  3B6G D;  3REL B;  5B1L C;  5DNM B;  2IO5 C;  4Z5T B;  5CPI D;  1P3M B;  3AZJ C;  3UT9 A;  1P3F D;  3AZI B;  1F1E A;  1P3A D;  4E45 A;  5FUG A;  3MGS C;  3O62 B;  3B0D C;  1P3G B;  2BYM A;  5F99 C;  2FJ7 D;  5B33 C;  4KHA B;  3REL D;  5B24 B;  5CPJ A;  4Z5T D;  3REK D;  1P3M D;  1HQ3 A;  1P34 C;  3AZI D;  3AZF B;  3WTP B;  5B32 C;  1EQZ D;  5JRG B;  3X1S D;  3WKJ B;  3KXB B;  1JFI A;  4CSR B;  2HUE C;  5B31 C;  1KX3 D;  3MVD B;  4H9S A;  4KUD A;  3REJ A;  4Z66 C;  4QLC B;  5AV8 C;  5G49 A;  5B24 D;  1M1A B;  1AOI A;  5AV6 A;  5AVC C;  3MNN A;  3WKJ D;  3REH A;  3MGR C;  3UTB B;  4YS3 D;  4ZBJ B;  3AV2 A;  1ID3 A;  3W98 D;  4QLC D;  3LEL B;  3W99 B;  3WTP E;  3MGP A;  1M18 A;  3A6N C;  5CP6 A;  4LD9 B;  3AZL B;  5B40 D;  1P3K C;  3MGQ B;  3KUY C;  1M1A D;  3VH6 W;  3AV1 B;  3X1V D;  2CV5 A;  4H9P A;  3AZN A;  5AV9 C;  3TU4 A;  3UTB D;  3AZE D;  4J8W A;  5BS7 A;  5AY8 A;  3V9R A;  3C1B B;  4WU9 D;  5B0Y A;  3R45 A;  1P3O B;  1BH8 B;  4XUJ C;  3C1C D;  4H9N A;  1N1J B;  3UT9 B;  3AYW C;  1M19 B;  2CWE A;  3AFA B;  5GXQ A;  3AZK C;  3AZG B;  1U35 D;  2BYM B;  1P3B B;  1ZLA D;  4WU8 D;  5AVB A;  4DRA A;  3B6F A;  3LJA B;  2NQB A;  5GSU C;  4KGC C;  3UT9 D;  1TAF A;  1ULY A;  3LZ1 C;  1P3L A;  5B2I A;  1P3I A;  5B1M B;  2HIO A;  4X23 B;  3KWQ B;  2F8N B;  5C3I B;  5B0Z A;  5GT0 C;  5B1L A;  4CAY A;  5CPJ D;  1S32 C;  3AZH C;  1HQ3 D;  5E5A B;  4ZUX C;  3MGS A;  3REH B;  3LZ0 B;  1H3O A;  3AN2 C;  4WNN A;  4X23 D;  3LJA C;  4KUD D;  4J8V A;  4NE3 A;  1TZY C;  1KX4 C;  3MGP B;  4J8U B;  1AOI D;  5B32 A;  5AV6 D;  3MNN D;  2CV5 B;  1KX5 C;  3REH D;  4XZQ C;  3W96 C;  5B31 A;  3TU4 B;  4J8X C;  3AV2 D;  1ID3 D;  4Z66 A;  4J8W B;  3WAA C;  3MGP D;  1M18 D;  5CP6 D;  5AVC A;  4H9N B;  3NQJ B;  2L5A A;  3LZ0 C;  1HTA A;  5GT3 B;  3MGR A;  3X1U C;  2CV5 D;  3AZN D;  3TU4 D;  3UTA C;  2NZD B;  4J8W D;  5AY8 D;  2LY8 A;  3B6G B;  5B0Y D;  4UUZ B;  5AVB B;  4JJN C;  5CPI B;  1P3K A;  3KUY A;  1KU5 A;  4R8P A;  1P3F B;  5AV9 A;  5GXQ D;  5B0Z B;  2FJ7 B;  4XUJ A;  4H9R B;  5AVB D;  4CAY B;  3REK B;  2ARO C;  3B6F D;  2NQB D;  4AWL C;  3AYW A;  1EQZ B;  3X1S B;  1P3L D;  5B2I D;  1P3I D;  3AZK A;  3AZM C;  2BYK B;  1KX3 B;  4M6B A;  5CPK C;  2HIO D;  5CPI C;  4YM6 A;  2F8N K;  5B0Z D;  1P3F C;  1P3A C;  5B1L D;  5GSU A;  4KGC A;  5BT1 C;  2YFW B;  3NQU A;  3MGS D;  5DNN A;  4YS3 B;  5AV5 A;  3W97 A;  3REL C;  3W98 B;  5DNM C;  1P3P A;  5BNX A;  4Z5T C;  1P3M C;  2PYO B;  4J8V D;  3AZI C;  1S32 A;  3AZH A;  5B40 B;  2YFV B;  4ZUX A;  5B32 D;  3X1V B;  3O62 C;  3REI A;  1KX3 C;  1P3G C;  5BNV A;  5B2J A;  3AN2 A;  5B31 D;  3AZE B;  5B24 C;  4Z66 D;  1TZY A;  1KX4 A;  4WU9 B;  2PYO D;  3VH5 T;  1R4V A;  3AZF C;  3WTP C;  3C1C B;  5JRG C;  3X1T A;  3WKJ C;  3KXB C;  5AVC D;  4R8P B;  1KX5 A;  4XZQ A;  3MGR D;  3MVD C;  4QLC C;  4J8X A;  1BH9 B;  1U35 B;  1ZLA B;  1M1A C;  4WU8 B;  3X1V C;  1P3K D;  3KUY D;  3WA9 A;  4R8P D;  3X1U A;  3UTB C;  4ZBJ C;  5AV9 D;  5FUG B;  3UTA A;  3LEL C;  3W99 C;  1BFM A;  2F8N G;  4LD9 C;  3AZL C;  1F66 A;  3MGQ C;  4XUJ D;  3AV1 C;  5CPJ B;  4H9O A;  1WWI A;  1HQ3 B;  3AYW D;  5KDM A;  4NFT A;  1U35 C;  1JFI B;  3NQU B;  3C1B C;  5DNN B;  1P3O C;  5AV5 B;  4G92 B;  3AZK D;  4WU8 C;  3W97 B;  4KUD B;  1B6W A;  3REJ B;  4YM6 D;  3UT9 C;  2ARO A;  5G49 B;  5GSU D;  3AZJ A;  1M19 C;  4KGC D;  3AFA C;  1AOI B;  3VH5 W;  5AV6 B;  3MNN B;  3AZG C;  3KSY A;  3AZM A;  1P3B C;  5DNN D;  3AV2 B;  5AV5 D;  5CPK A;  1ID3 B;  3W97 D;  5F99 A;  5CPJ C;  1P3P D;  3REJ D;  5B33 A;  2JSS A;  1S32 D;  1M18 B;  3B0C T;  3AZH D;  5CP6 B;  3X1T B;  1P34 A;  5B1M C;  4ZUX D;  3VH6 A;  4H9P B;  4X23 C;  3REI D;  3KWQ C;  3AZN B;  5C3I C;  5B2J D;  3AN2 D;  2RVQ C;  5DNM A;  1P3M A;  5AY8 B;  3V9R B;  1TZY D;  5AV8 A;  1KX4 D;  5B0Y B;  5AV6 C;  3B0B A;  3R45 B;  5E5A C;  3X1T D;  3REH C;  3O62 A;  1P3G A;  3AV2 C;  4XZQ D;  4WZS B;  5GXQ B;  4J8X D;  4EO5 B;  3MGP C;  4J8U C;  3AZF A;  3WTP A;  1WWS A;  3A6N A;  5JRG A;  3KXB A;  3B6F B;  2CV5 C;  2NQB B;  4CSR A;  3AZN C;  3WA9 D;  3TU4 C;  3X1U D;  3MVD A;  1TAF B;  5KDM B;  1P3L B;  5B2I B;  4J8W C;  4G91 B;  5AY8 C;  1P3I B;  3UTA D;  4HGA B;  2HIO B;  4H9Q A;  1F66 D;  5B1L B;  2IO5 B;  5GT3 C;  1Q9C A;  2NZD C;  3LEL A;  3MGS B;  3W99 A;  1H3O B;  3B0D B;  3B6G C;  4LD9 A;  5AVB C;  3AZL A;  4WNN B;  5F99 B;  3MGQ A;  4J8V B;  5B33 B;  3AV1 A;  2ARO D;  4NE5 A;  1P34 B;  3AZJ D;  4Z2M G;  5B32 B;  3LZ1 A;  4E44 A;  2HIO C;  3C1B A;  1P3O A;  3AZM D;  2HUE B;  5B31 B;  5B0Z C;  2FJ7 C;  1BH8 A;  5CPK D;  5BO0 A;  4Z66 B;  5GT0 A;  5F99 D;  3REK C;  5AV8 B;  1N1J A;  5B33 D;  1M19 A;  1EQZ C;  3X1S C;  3AFA A;  5AVC B;  1P34 D;  5BT1 D;  3AZG A;  3MGR B; 
#chains in the Genus database with same CATH topology
 1P3B A;  1A7W A;  2F8N H;  5JA4 A;  4J8V C;  3LJA A;  5DNM D;  5AV8 D;  3EPH A;  3A6N B;  1P3K B;  3KUY B;  5B1M A;  3O62 D;  4YS3 C;  4X23 A;  3KWQ A;  1P3G D;  3W96 A;  2F8N A;  5AV9 B;  3W98 C;  3EG5 B;  2PYO C;  4NE6 A;  5B40 C;  3WAA A;  5E5A A;  4H9Q B;  3AZF D;  3WTP D;  4XUJ B;  3A6N D;  5JRG D;  3KXB D;  3LZ0 A;  3AYW B;  3AZE C;  3MVD D;  4WU9 C;  2ZY2 A;  3AZK B;  3C1C C;  4J8U A;  4YM6 B;  2Y2L A;  4R8P C;  4JJN A;  5GSU B;  2Y2O A;  4KGC B;  3LZ1 B;  3LEL D;  1ZLA C;  3W99 D;  5BO0 B;  4LD9 D;  3AZL D;  5GT0 B;  3P5J B;  3NQJ A;  5BNX B;  3MGQ D;  1P3P B;  5GT3 A;  3AV1 D;  1S32 B;  3AZH B;  2F2A C;  4ZUX B;  3LZ1 D;  2NZD A;  2Y2G A;  3REI B;  5BNV B;  3C1B D;  3B6G A;  4YM6 C;  4UUZ A;  5JA4 B;  5B2J B;  3AN2 B;  1P3O D;  2BG1 A;  5CPI A;  1TZY B;  5GT0 D;  1P3F A;  1KX4 B;  1P3A A;  1HQ3 C;  2XD5 A;  1M19 D;  3AFA D;  5DNN C;  5AV5 C;  4G92 C;  3AZG D;  1KX5 B;  4DRB A;  4XZQ B;  3W97 C;  3W96 B;  4KUD C;  2FJ7 A;  4H9S C;  1P3B D;  3REJ C;  1P3P C;  3REL A;  4H9R A;  4J8X B;  3A1I A;  4Z5T A;  3LJA D;  3REK A;  3AZI A;  1AOI C;  1EQZ A;  3WAA B;  3X1S A;  3MNN C;  5CHL B;  3REI C;  5B1M D;  3WA9 B;  5B2J C;  2JE5 A;  2BYK A;  3X1U B;  1KX3 A;  1KX5 D;  1ID3 C;  3KWQ D;  2F8N D;  3W96 D;  3UTA B;  2RVQ D;  4KHA A;  5B24 A;  1M18 C;  5CP6 C;  3X1T C;  2YFW A;  1B67 A;  1F66 B;  3WAA D;  5E5A D;  4JJN B;  3WKJ A;  4Z2M H;  4H9O B;  4YS3 A;  3LZ0 D;  2Y2Q A;  2Y2N A;  3W98 A;  4QLC A;  2PYO A;  5BS7 C;  5B0Y C;  5B40 A;  1M1A A;  4J8U D;  2YFV A;  3X1V A;  3WA9 C;  4JJN D;  2ARO B;  5B32 G;  4AWL B;  3AZJ B;  4WV4 B;  1W2E A;  3UTB A;  5GXQ C;  3H0M C;  3AZE A;  3B0C W;  4EO5 C;  3VH5 A;  5B31 G;  4WU9 A;  2JCH A;  2ZM5 A;  3AZM B;  1F66 C;  3C1C A;  5CPK B;  3H0L C;  3B6F C;  2NQB C;  1P3A B;  5GT3 D;  1P3L C;  5B2I C;  4G91 C;  1BH9 A;  1P3I C;  1U35 A;  4HGA C;  2NZD D;  1ZLA A;  4WU8 A;  3VH6 T;  3B6G D;  3REL B;  5B1L C;  5DNM B;  2IO5 C;  4Z5T B;  5CPI D;  1P3M B;  3AZJ C;  3UT9 A;  1P3F D;  3AZI B;  1F1E A;  1P3A D;  4E45 A;  2ZY4 A;  5FUG A;  3MGS C;  3O62 B;  3B0D C;  1P3G B;  2BYM A;  2ZY3 A;  5F99 C;  2FJ7 D;  5B33 C;  4KHA B;  3REL D;  5B24 B;  5CPJ A;  4Z5T D;  3REK D;  1P3M D;  1HQ3 A;  1P34 C;  3AZI D;  3AZF B;  3WTP B;  5B32 C;  1EQZ D;  5JRG B;  3X1S D;  3WKJ B;  3KXB B;  1JFI A;  4CSR B;  2HUE C;  5B31 C;  1KX3 D;  3MVD B;  4H9S A;  4KUD A;  3REJ A;  4Z66 C;  4QLC B;  5AV8 C;  5G49 A;  5B24 D;  2DQN C;  1M1A B;  1AOI A;  5AV6 A;  5AVC C;  3MNN A;  3WKJ D;  3REH A;  3MGR C;  3UTB B;  4YS3 D;  4ZBJ B;  3AV2 A;  1ID3 A;  3W98 D;  4QLC D;  3LEL B;  3W99 B;  3WTP E;  3MGP A;  1M18 A;  3A6N C;  5CP6 A;  4LD9 B;  3AZL B;  5B40 D;  1P3K C;  3MGQ B;  3KUY C;  1M1A D;  3VH6 W;  4DQY B;  3AV1 B;  3X1V D;  2CV5 A;  4H9P A;  3AZN A;  5AV9 C;  3TU4 A;  3UTB D;  3AZE D;  4J8W A;  5BS7 A;  5AY8 A;  3V9R A;  3C1B B;  4WU9 D;  5B0Y A;  3R45 A;  1P3O B;  3KFU G;  1BH8 B;  1PZR A;  2J8P A;  2ZY5 A;  3FDD A;  4XUJ C;  3C1C D;  4H9N A;  1N1J B;  3UT9 B;  3AYW C;  1M19 B;  2CWE A;  3AFA B;  5GXQ A;  3AZK C;  3AZG B;  1U35 D;  2BYM B;  3A1K A;  1P3B B;  4UPK A;  1ZLA D;  4WU8 D;  5AVB A;  4DRA A;  3B6F A;  3LJA B;  2NQB A;  5GSU C;  4KGC C;  3UT9 D;  1TAF A;  1ULY A;  3LZ1 C;  1P3L A;  5B2I A;  1P3I A;  5B1M B;  2HIO A;  4X23 B;  3KWQ B;  2F8N B;  5C3I B;  5B0Z A;  5GT0 C;  5B1L A;  4CAY A;  5CPJ D;  1S32 C;  3AZH C;  1HQ3 D;  5E5A B;  4ZUX C;  2W8S A;  3MGS A;  3REH B;  3LZ0 B;  1H3O A;  3AN2 C;  4WNN A;  4X23 D;  3LJA C;  4KUD D;  4J8V A;  4NE3 A;  1TZY C;  1KX4 C;  3MGP B;  4J8U B;  1AOI D;  5B32 A;  5AV6 D;  3MNN D;  2CV5 B;  1KX5 C;  3REH D;  4XZQ C;  3W96 C;  5B31 A;  3TU4 B;  4J8X C;  3AV2 D;  1ID3 D;  4Z66 A;  4J8W B;  3WAA C;  3EPJ A;  3MGP D;  1M18 D;  5CP6 D;  5AVC A;  4H9N B;  3NQJ B;  2L5A A;  3LZ0 C;  1HTA A;  5GT3 B;  3MGR A;  3X1U C;  2CV5 D;  3AZN D;  3TU4 D;  3UTA C;  2NZD B;  4J8W D;  5AY8 D;  2LY8 A;  3B6G B;  5B0Y D;  4UUZ B;  5AVB B;  4JJN C;  5CPI B;  1P3K A;  3KUY A;  1KU5 A;  4R8P A;  1P3F B;  5AV9 A;  5GXQ D;  4WJ3 C;  5B0Z B;  2FJ7 B;  4XUJ A;  4H9R B;  5AVB D;  4CAY B;  3REK B;  2ARO C;  3B6F D;  2NQB D;  1T3U A;  4AWL C;  3AYW A;  1EQZ B;  3X1S B;  3EPL A;  1P3L D;  5B2I D;  1P3I D;  3AZK A;  3AZM C;  2UWX A;  2BYK B;  1KX3 B;  4M6B A;  5CPK C;  2HIO D;  5CPI C;  4YM6 A;  2F8N K;  5B0Z D;  1P3F C;  1P3A C;  5B1L D;  5GSU A;  4KGC A;  5BT1 C;  2YFW B;  3EPK A;  3NQU A;  3MGS D;  5DNN A;  4YS3 B;  5AV5 A;  3W97 A;  3REL C;  3W98 B;  5DNM C;  1P3P A;  5BNX A;  4Z5T C;  1P3M C;  2PYO B;  4J8V D;  3AZI C;  1S32 A;  3AZH A;  5B40 B;  2YFV B;  4ZUX A;  5B32 D;  3X1V B;  3O62 C;  3REI A;  1KX3 C;  1P3G C;  5BNV A;  5B2J A;  3AN2 A;  5B31 D;  3AZE B;  5B24 C;  4Z66 D;  1TZY A;  1KX4 A;  4WU9 B;  2PYO D;  3VH5 T;  1R4V A;  3AZF C;  3WTP C;  3C1C B;  5JRG C;  3X1T A;  3WKJ C;  3KXB C;  5AVC D;  4R8P B;  1KX5 A;  4XZQ A;  3MGR D;  3MVD C;  4QLC C;  4J8X A;  1BH9 B;  1U35 B;  1ZLA B;  1M1A C;  4WU8 B;  3X1V C;  1P3K D;  3KUY D;  3WA9 A;  4R8P D;  3X1U A;  3UTB C;  4ZBJ C;  5AV9 D;  5FUG B;  3UTA A;  3LEL C;  3W99 C;  1BFM A;  2F8N G;  2RIQ A;  4LD9 C;  3AZL C;  1Z2C B;  3MGQ C;  1F66 A;  4XUJ D;  3AV1 C;  5CPJ B;  4H9O A;  2Y2M A;  1WWI A;  1HQ3 B;  3F6T A;  2Y2H A;  3AYW D;  5KDM A;  4NFT A;  1U35 C;  1JFI B;  3NQU B;  3C1B C;  5DNN B;  1P3O C;  5AV5 B;  4G92 B;  3AZK D;  4WU8 C;  3W97 B;  4KUD B;  1B6W A;  3REJ B;  4YM6 D;  3UT9 C;  2ARO A;  5G49 B;  5GSU D;  3AZJ A;  1M19 C;  4KGC D;  3AFA C;  2Y2J A;  3VH5 W;  5AV6 B;  1AOI B;  3MNN B;  3AZG C;  3KSY A;  3AZM A;  1P3B C;  2DF4 C;  5DNN D;  3AV2 B;  5AV5 D;  5CPK A;  1ID3 B;  3W97 D;  5F99 A;  5CPJ C;  1P3P D;  3REJ D;  5B33 A;  3IP4 C;  2JSS A;  2VQR A;  1S32 D;  1M18 B;  3B0C T;  3AZH D;  5CP6 B;  3X1T B;  1P34 A;  5B1M C;  4ZUX D;  3VH6 A;  4H9P B;  4X23 C;  3REI D;  3KWQ C;  3AZN B;  5C3I C;  5B2J D;  3AN2 D;  2RVQ C;  5DNM A;  1P3M A;  5AY8 B;  3V9R B;  1TZY D;  5AV8 A;  1KX4 D;  5B0Y B;  5AV6 C;  3B0B A;  3R45 B;  5E5A C;  3X1T D;  2Y2I A;  3REH C;  3O62 A;  1P3G A;  3AV2 C;  4XZQ D;  4WZS B;  5GXQ B;  4J8X D;  4EO5 B;  3MGP C;  2G5I C;  4J8U C;  3AZF A;  3WTP A;  1WWS A;  3A6N A;  5JRG A;  3KXB A;  3B6F B;  2CV5 C;  2NQB B;  4CSR A;  3AZN C;  3WA9 D;  3TU4 C;  3X1U D;  3MVD A;  1TAF B;  5KDM B;  1P3L B;  5B2I B;  4J8W C;  4G91 B;  5AY8 C;  1P3I B;  3UTA D;  4HGA B;  2HIO B;  3AL0 C;  4H9Q A;  1F66 D;  5B1L B;  2IO5 B;  5GT3 C;  1Q9C A;  2NZD C;  2G5H C;  3H0R C;  3LEL A;  3MGS B;  3W99 A;  1H3O B;  3B0D B;  3B6G C;  2Y2P A;  5AVB C;  3AZL A;  4WNN B;  4LD9 A;  5F99 B;  3MGQ A;  2Y2K A;  4J8V B;  5B33 B;  3AV1 A;  2XD1 A;  2ARO D;  4NE5 A;  1P34 B;  3AZJ D;  4Z2M G;  5B32 B;  3LZ1 A;  4E44 A;  2FFF B;  2HIO C;  3C1B A;  1P3O A;  3AZM D;  2HUE B;  5B31 B;  5B0Z C;  2FJ7 C;  1BH8 A;  5CPK D;  5BO0 A;  4Z66 B;  5GT0 A;  5F99 D;  3REK C;  5AV8 B;  1N1J A;  5B33 D;  1M19 A;  1EQZ C;  3X1S C;  3AFA A;  5AVC B;  1P34 D;  5BT1 D;  3AZG A;  3MGR B; 
#chains in the Genus database with same CATH homology
 1P3B A;  1A7W A;  2F8N H;  5JA4 A;  4J8V C;  3LJA A;  5DNM D;  5AV8 D;  3EPH A;  3A6N B;  1P3K B;  3KUY B;  5B1M A;  3O62 D;  4YS3 C;  4X23 A;  3KWQ A;  1P3G D;  3W96 A;  2F8N A;  5AV9 B;  3W98 C;  3EG5 B;  2PYO C;  4NE6 A;  5B40 C;  3WAA A;  5E5A A;  4H9Q B;  3AZF D;  3WTP D;  4XUJ B;  3A6N D;  5JRG D;  3KXB D;  3LZ0 A;  3AYW B;  3AZE C;  3MVD D;  4WU9 C;  2ZY2 A;  3AZK B;  3C1C C;  4J8U A;  4YM6 B;  2Y2L A;  4R8P C;  4JJN A;  5GSU B;  2Y2O A;  4KGC B;  3LZ1 B;  3LEL D;  1ZLA C;  3W99 D;  5BO0 B;  4LD9 D;  3AZL D;  5GT0 B;  3P5J B;  3NQJ A;  5BNX B;  3MGQ D;  1P3P B;  5GT3 A;  3AV1 D;  1S32 B;  3AZH B;  2F2A C;  4ZUX B;  3LZ1 D;  2NZD A;  2Y2G A;  3REI B;  5BNV B;  3C1B D;  3B6G A;  4YM6 C;  4UUZ A;  5JA4 B;  5B2J B;  3AN2 B;  1P3O D;  2BG1 A;  5CPI A;  1TZY B;  5GT0 D;  1P3F A;  1KX4 B;  1P3A A;  1HQ3 C;  2XD5 A;  1M19 D;  3AFA D;  5DNN C;  5AV5 C;  4G92 C;  3AZG D;  1KX5 B;  4DRB A;  4XZQ B;  3W97 C;  3W96 B;  4KUD C;  2FJ7 A;  4H9S C;  1P3B D;  3REJ C;  1P3P C;  3REL A;  4H9R A;  4J8X B;  3A1I A;  4Z5T A;  3LJA D;  3REK A;  3AZI A;  1AOI C;  1EQZ A;  3WAA B;  3X1S A;  3MNN C;  5CHL B;  3REI C;  5B1M D;  3WA9 B;  5B2J C;  2JE5 A;  2BYK A;  3X1U B;  1KX3 A;  1KX5 D;  1ID3 C;  3KWQ D;  2F8N D;  3W96 D;  3UTA B;  2RVQ D;  4KHA A;  5B24 A;  1M18 C;  5CP6 C;  3X1T C;  2YFW A;  1B67 A;  1F66 B;  3WAA D;  5E5A D;  4JJN B;  3WKJ A;  4Z2M H;  4H9O B;  4YS3 A;  3LZ0 D;  2Y2Q A;  2Y2N A;  3W98 A;  4QLC A;  2PYO A;  5BS7 C;  5B0Y C;  5B40 A;  1M1A A;  4J8U D;  2YFV A;  3X1V A;  3WA9 C;  4JJN D;  2ARO B;  5B32 G;  4AWL B;  3AZJ B;  4WV4 B;  1W2E A;  3UTB A;  5GXQ C;  3H0M C;  3AZE A;  3B0C W;  4EO5 C;  3VH5 A;  5B31 G;  4WU9 A;  2JCH A;  2ZM5 A;  3AZM B;  1F66 C;  3C1C A;  5CPK B;  3H0L C;  3B6F C;  2NQB C;  1P3A B;  5GT3 D;  1P3L C;  5B2I C;  4G91 C;  1BH9 A;  1P3I C;  1U35 A;  4HGA C;  2NZD D;  1ZLA A;  4WU8 A;  3VH6 T;  3B6G D;  3REL B;  5B1L C;  5DNM B;  2IO5 C;  4Z5T B;  5CPI D;  1P3M B;  3AZJ C;  3UT9 A;  1P3F D;  3AZI B;  1F1E A;  1P3A D;  4E45 A;  2ZY4 A;  5FUG A;  3MGS C;  3O62 B;  3B0D C;  1P3G B;  2BYM A;  2ZY3 A;  5F99 C;  2FJ7 D;  5B33 C;  4KHA B;  3REL D;  5B24 B;  5CPJ A;  4Z5T D;  3REK D;  1P3M D;  1HQ3 A;  1P34 C;  3AZI D;  3AZF B;  3WTP B;  5B32 C;  1EQZ D;  5JRG B;  3X1S D;  3WKJ B;  3KXB B;  1JFI A;  4CSR B;  2HUE C;  5B31 C;  1KX3 D;  3MVD B;  4H9S A;  4KUD A;  3REJ A;  4Z66 C;  4QLC B;  5AV8 C;  5G49 A;  5B24 D;  2DQN C;  1M1A B;  1AOI A;  5AV6 A;  5AVC C;  3MNN A;  3WKJ D;  3REH A;  3MGR C;  3UTB B;  4YS3 D;  4ZBJ B;  3AV2 A;  1ID3 A;  3W98 D;  4QLC D;  3LEL B;  3W99 B;  3WTP E;  3MGP A;  1M18 A;  3A6N C;  5CP6 A;  4LD9 B;  3AZL B;  5B40 D;  1P3K C;  3MGQ B;  3KUY C;  1M1A D;  3VH6 W;  4DQY B;  3AV1 B;  3X1V D;  2CV5 A;  4H9P A;  3AZN A;  5AV9 C;  3TU4 A;  3UTB D;  3AZE D;  4J8W A;  5BS7 A;  5AY8 A;  3V9R A;  3C1B B;  4WU9 D;  5B0Y A;  3R45 A;  1P3O B;  3KFU G;  1BH8 B;  1PZR A;  2J8P A;  2ZY5 A;  3FDD A;  4XUJ C;  3C1C D;  4H9N A;  1N1J B;  3UT9 B;  3AYW C;  1M19 B;  2CWE A;  3AFA B;  5GXQ A;  3AZK C;  3AZG B;  1U35 D;  2BYM B;  3A1K A;  1P3B B;  4UPK A;  1ZLA D;  4WU8 D;  5AVB A;  4DRA A;  3B6F A;  3LJA B;  2NQB A;  5GSU C;  4KGC C;  3UT9 D;  1TAF A;  1ULY A;  3LZ1 C;  1P3L A;  5B2I A;  1P3I A;  5B1M B;  2HIO A;  4X23 B;  3KWQ B;  2F8N B;  5C3I B;  5B0Z A;  5GT0 C;  5B1L A;  4CAY A;  5CPJ D;  1S32 C;  3AZH C;  1HQ3 D;  5E5A B;  4ZUX C;  2W8S A;  3MGS A;  3REH B;  3LZ0 B;  1H3O A;  3AN2 C;  4WNN A;  4X23 D;  3LJA C;  4KUD D;  4J8V A;  4NE3 A;  1TZY C;  1KX4 C;  3MGP B;  4J8U B;  1AOI D;  5B32 A;  5AV6 D;  3MNN D;  2CV5 B;  1KX5 C;  3REH D;  4XZQ C;  3W96 C;  5B31 A;  3TU4 B;  4J8X C;  3AV2 D;  1ID3 D;  4Z66 A;  4J8W B;  3WAA C;  3EPJ A;  3MGP D;  1M18 D;  5CP6 D;  5AVC A;  4H9N B;  3NQJ B;  2L5A A;  3LZ0 C;  1HTA A;  5GT3 B;  3MGR A;  3X1U C;  2CV5 D;  3AZN D;  3TU4 D;  3UTA C;  2NZD B;  4J8W D;  5AY8 D;  2LY8 A;  3B6G B;  5B0Y D;  4UUZ B;  5AVB B;  4JJN C;  5CPI B;  1P3K A;  3KUY A;  1KU5 A;  4R8P A;  1P3F B;  5AV9 A;  5GXQ D;  4WJ3 C;  5B0Z B;  2FJ7 B;  4XUJ A;  4H9R B;  5AVB D;  4CAY B;  3REK B;  2ARO C;  3B6F D;  2NQB D;  1T3U A;  4AWL C;  3AYW A;  1EQZ B;  3X1S B;  3EPL A;  1P3L D;  5B2I D;  1P3I D;  3AZK A;  3AZM C;  2UWX A;  2BYK B;  1KX3 B;  4M6B A;  5CPK C;  2HIO D;  5CPI C;  4YM6 A;  2F8N K;  5B0Z D;  1P3F C;  1P3A C;  5B1L D;  5GSU A;  4KGC A;  5BT1 C;  2YFW B;  3EPK A;  3NQU A;  3MGS D;  5DNN A;  4YS3 B;  5AV5 A;  3W97 A;  3REL C;  3W98 B;  5DNM C;  1P3P A;  5BNX A;  4Z5T C;  1P3M C;  2PYO B;  4J8V D;  3AZI C;  1S32 A;  3AZH A;  5B40 B;  2YFV B;  4ZUX A;  5B32 D;  3X1V B;  3O62 C;  3REI A;  1KX3 C;  1P3G C;  5BNV A;  5B2J A;  3AN2 A;  5B31 D;  3AZE B;  5B24 C;  4Z66 D;  1TZY A;  1KX4 A;  4WU9 B;  2PYO D;  3VH5 T;  1R4V A;  3AZF C;  3WTP C;  3C1C B;  5JRG C;  3X1T A;  3WKJ C;  3KXB C;  5AVC D;  4R8P B;  1KX5 A;  4XZQ A;  3MGR D;  3MVD C;  4QLC C;  4J8X A;  1BH9 B;  1U35 B;  1ZLA B;  1M1A C;  4WU8 B;  3X1V C;  1P3K D;  3KUY D;  3WA9 A;  4R8P D;  3X1U A;  3UTB C;  4ZBJ C;  5AV9 D;  5FUG B;  3UTA A;  3LEL C;  3W99 C;  1BFM A;  2F8N G;  2RIQ A;  4LD9 C;  3AZL C;  1Z2C B;  3MGQ C;  1F66 A;  4XUJ D;  3AV1 C;  5CPJ B;  4H9O A;  2Y2M A;  1WWI A;  1HQ3 B;  3F6T A;  2Y2H A;  3AYW D;  5KDM A;  4NFT A;  1U35 C;  1JFI B;  3NQU B;  3C1B C;  5DNN B;  1P3O C;  5AV5 B;  4G92 B;  3AZK D;  4WU8 C;  3W97 B;  4KUD B;  1B6W A;  3REJ B;  4YM6 D;  3UT9 C;  2ARO A;  5G49 B;  5GSU D;  3AZJ A;  1M19 C;  4KGC D;  3AFA C;  2Y2J A;  3VH5 W;  5AV6 B;  1AOI B;  3MNN B;  3AZG C;  3KSY A;  3AZM A;  1P3B C;  2DF4 C;  5DNN D;  3AV2 B;  5AV5 D;  5CPK A;  1ID3 B;  3W97 D;  5F99 A;  5CPJ C;  1P3P D;  3REJ D;  5B33 A;  3IP4 C;  2JSS A;  2VQR A;  1S32 D;  1M18 B;  3B0C T;  3AZH D;  5CP6 B;  3X1T B;  1P34 A;  5B1M C;  4ZUX D;  3VH6 A;  4H9P B;  4X23 C;  3REI D;  3KWQ C;  3AZN B;  5C3I C;  5B2J D;  3AN2 D;  2RVQ C;  5DNM A;  1P3M A;  5AY8 B;  3V9R B;  1TZY D;  5AV8 A;  1KX4 D;  5B0Y B;  5AV6 C;  3B0B A;  3R45 B;  5E5A C;  3X1T D;  2Y2I A;  3REH C;  3O62 A;  1P3G A;  3AV2 C;  4XZQ D;  4WZS B;  5GXQ B;  4J8X D;  4EO5 B;  3MGP C;  2G5I C;  4J8U C;  3AZF A;  3WTP A;  1WWS A;  3A6N A;  5JRG A;  3KXB A;  3B6F B;  2CV5 C;  2NQB B;  4CSR A;  3AZN C;  3WA9 D;  3TU4 C;  3X1U D;  3MVD A;  1TAF B;  5KDM B;  1P3L B;  5B2I B;  4J8W C;  4G91 B;  5AY8 C;  1P3I B;  3UTA D;  4HGA B;  2HIO B;  3AL0 C;  4H9Q A;  1F66 D;  5B1L B;  2IO5 B;  5GT3 C;  1Q9C A;  2NZD C;  2G5H C;  3H0R C;  3LEL A;  3MGS B;  3W99 A;  1H3O B;  3B0D B;  3B6G C;  2Y2P A;  5AVB C;  3AZL A;  4WNN B;  4LD9 A;  5F99 B;  3MGQ A;  2Y2K A;  4J8V B;  5B33 B;  3AV1 A;  2XD1 A;  2ARO D;  4NE5 A;  1P34 B;  3AZJ D;  4Z2M G;  5B32 B;  3LZ1 A;  4E44 A;  2FFF B;  2HIO C;  3C1B A;  1P3O A;  3AZM D;  2HUE B;  5B31 B;  5B0Z C;  2FJ7 C;  1BH8 A;  5CPK D;  5BO0 A;  4Z66 B;  5GT0 A;  5F99 D;  3REK C;  5AV8 B;  1N1J A;  5B33 D;  1M19 A;  1EQZ C;  3X1S C;  3AFA A;  5AVC B;  1P34 D;  5BT1 D;  3AZG A;  3MGR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...