4CAYA

Crystal structure of a human anp32e-h2a.z-h2b complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
86
Chain Sequence
SRSQRAGLQFPVGRIHRHLKSRGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A.Z
publication title Anp32E is a Histone Chaperone that Removes H2A.Z from Chromatin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4cayA00
3WAAC 3RELA 1AOIA 2AROC 3W98B 3MGRD 3AZHD 3MNNC 4J8WB 3MGSA 4WU9A 3X1TD 5AV9D 4CAYA 3AZGA 4QLCC 5KDMA 3X1UD 1P3BA 1P3FA 4YS3A 4Z5TB 4Z66D 5BNVB 3NQUA 5AVBA 4CSRB 3AZKC 3AN2D 1M19C 5GXQD 3LZ0B 1S32B 1U35D 4J8VD 3W96A 4AWLB 3W98A 2NQBB 1KX3A 5JA4B 5B24A 3W99D 5B0ZA 3MVDD 3LZ1B 4EO5B 1KX5B 1EQZB 1TZYC 3X1VA 5BNVA 4CSRA 3C1BD 1ID3B 3AV2C 1AOIC 2LY8A 4YM6A 3AFAD 2FJ7B 3X1SC 2YFVB 3O62A 3MGRB 2NQBA 3AZLA 4H9NA 3AZHB 5F99C 3WTPD 5DNNA 4X23A 3X1TB 5B2IA 1EQZA 3MGPD 3REHB 1P3PB 3AZED 1P3FC 3X1UB 1WWSA 4YS3C 5GT3D 5BO0A 4Z66B 1P3OA 3AN2B 5CPID 5GXQB 2NZDD 3AV1B 3NQJB 4H9SC 1U35B 2HIOD 4J8VB 3MGRA 1KX3C 5B24C 4H9QA 3W99B 4ZUXC 3W97D 4KHAB 1P3KD 3WKJA 1B6WA 3X1TA 4KGCD 4WNNB 5AV9A 3X1UA 1BH9B 3X1VC 4Z66A 5GSUD 4WU8D 5GXQA 3NQJA 3B6GD 3LELD 1KU5A 4DRBA 2IO5B 3AZLC 2CV5D 1ZLAD 3KWQB 3WTPE 3AZNC 3MVDA 3AYWC 3VH6T 5B2IC 4WNNA 3UT9C 4Z2MH 1HQ3A 5B32D 3AZEB 1BH9A 1P3OC 3B6FB 5AY8A 5CP6A 3C1BA 2NZDB 4XUJD 3AFAA 4DRAA 2HIOB 1F1EA 4E45A 3WKJC 3WTPA 5AV9C 3MGPA 5E5AD 3VH5A 5GT3A 4HGAC 5DNMB 5GSUB 5CPIA 4H9RB 4XZQD 1P3GB 1BH8A 3C1CB 3WA9D 3B6GB 3REIC 4J8XC 2CV5B 1ZLAB 5B40A 3MVDC 3W97A 3B0DC 1P3KA 4KGCA 1HQ3C 5B32B 1H3OB 1HTAA 5CHLB 3REKD 3TU4C 4ZBJB 5AY8C 5CP6C 4H9RA 4WU8A 2F8NK 4XUJB 3AFAC 4J8WD 4JJNC 3B6GA 3LELA 1P3IC 2RVQD 4KUDC 4R8PD 5GT0C 1KX4D 3WTPC 3LZ0D 5E5AB 1F66B 5AV6D 1S32D 5GT3C 1H3OA 5CPJB 5CPIC 4XZQB 3AZJA 3WA9B 2F8ND 2PYOB 5BT1C 5B40C 1P3KC 1ID3D 3V9RA 3KXBA 4KGCC 5AV5A 5E5AA 1Q9CA 5B0YA 1M1AB 2FJ7D 5BNXA 4WZSB 3KUYD 3REKB 1M18A 5B32G 4WU8C 3AV2B 3AZMA 3LELC 3R45A 3REJC 3REHD 1P3PD 3B0CT 4R8PB 2BYKB 1KX4B 4NFTA 4G91C 3AV1D 2F8NH 5AV6B 3REKA 5CPKC 1P34D 1P3LC 3AZJC 4J8WA 5AVCC 2F8NB 2HUEC 5C3IC 5B1MB 4LD9C 5B33C 3A6ND 2BYKA 4Z5TA 4ZUXB 3KXBC 3RELC 5AV5C 3LZ0A 3UTBB 3UTAD 5AV6A 5B0YC 1S32A 2YFWB 1M18C 3KUYB 5JA4A 5B31D 4J8UD 3KWQD 3KSYA 3MGSC 4WU9C 3AZMC 2F8NA 3LZ1A 1KX5A 3AZGC 1P3BC 4UUZB 5B2JB 3B6FD 5AVBC 1N1JB 1ID3A 1B67A 2FJ7A 5FUGB 2YFVA 3W96C 1P34B 3W98C 5JRGB 4G92B 3AZHA 4H9PB 5B0ZC 4J8WC 1A7WA 3REHA 1P3PA 1P3MD 2F8NG 3LJAD 5BS7A 3A6NB 4UUZA 4Z5TC 5DNMD 3AN2A 4NE5A 1P3GD 4YM6C 3C1CD 3MGQD 3UTAB 3AV1A 1U35A 4J8VA 3O62C 4AWLC 5B1LD 2NQBC 4HGAB 4J8UB 5B31B 1JFIB 1P3AD 3AZFB 3W99A 1TAFB 4KHAA 3LZ1C 5DNNC 4X23C 1KX5C 1EQZC 1ID3C 3UTAA 2AROD 3MGRC 4J8UA 3AZHC 3KWQA 3MNND 3B0BA 4NE3A 3X1TC 3REHC 1P3PC 1P3MB 1F66D 3LJAB 3AZEA 5BS7C 3X1UC 4QLCD 4Z66C 5CPJD 3AZIB 5GT0B 3AN2C 3B6FA 1M19D 5GXQC 3AZKD 2NZDA 3AV1C 3MGQB 5AV8B 1U35C 2HIOA 4J8VC 5B1LB 2PYOD 1P3AB 3W99C 4H9OB 5G49B 1P3MA 1R4VA 1TZYD 1M1AD 5DNMA 5GSUA 3C1BC 3WAAB 1P3GA 3AV2D 3C1CA 3MGQA 1AOID 2AROB 4Z2MG 2IO5C 3X1SD 2CV5A 2CWEA 3KWQC 1ZLAA 1P3AA 3MNNB 5F99D 3MGPC 3AZEC 5B32A 4QLCB 1P3FD 3B6FC 4YS3D 1M19B 3AZKB 2NZDC 4XUJA 2HIOC 5CPKB 4M6BA 5B1MD 3VH5T 1KX3D 3MNNA 1P3LB 3W97C 4ZUXD 2HUEB 3UTBD 1F66A 1TZYB 5DNMC 5CPJA 5GSUC 3AZKA 4XZQA 1P3GC 3RELB 1AOIB 3B6GC 3WA9A 3X1SB 2CV5C 1ZLAC 3AZLD 2PYOA 5B2JD 3AZND 4WU9B 3AYWD 5F99B 3UT9D 5B32C 4CAYB 3AZGB 1P3FB 1M1AA 4YS3B 4ZBJC 5JRGD 3NQUB 4XUJC 3AV2A 2L5AA 3X1SA 3W96B 1KX3B 5B24B 4R8PA 5B0ZB 1KX4A 5F99A 3WKJD 5E5AC 1ULYA 1F66C 3X1VB 5CPJC 4XZQC 3AZFD 3WA9C 4YM6B 4H9SA 3REID 4J8XD 3O62B 4NE6A 5B1MA 3AZLB 2PYOC 4H9NB 3AZNB 4ZUXA 3AYWB 5DNNB 4X23B 5B2IB 3UTBA 3UT9B 1HQ3D 1M1AC 2YFWA 3REKC 3KUYA 5BO0B 1P3OB 3TU4D 5AY8D 5CP6D 3VH6A 4JJND 4WV4B 2RVQC 1P3ID 4KUDD 4R8PC 4H9QB 5B2JA 3AZNA 3AZID 3AYWA 5GT0D 1N1JA 1KX4C 4E44A 3WKJB 3LZ0C 5AV9B 3UT9A 5AV6C 5AV8D 1S32C 5FUGA 1P34A 5JRGA 4H9PA 3VH6W 4EO5C 3REIB 1WWIA 4J8XB 5B1MC 3A6NA 5BT1D 5B40D 3MVDB 3B0DB 3WAAD 3UTBC 1HQ3B 2FJ7C 3KUYC 3TU4B 5B31A 1JFIA 5CP6B 5AY8B 3C1BB 3AZFA 1TAFA 3AFAB 4JJNB 3REJD 3REIA 4J8XA 1P3IB 2BYMB 4KUDB 5B2JC 3WTPB 3MGPB 5GT3B 1P34C 5JRGC 4G92C 3TU4A 5CPIB 5CPKD 1P3LD 3AZJD 1BH8B 4JJNA 5AVCD 5B31G 1P3IA 2BYMA 3LJAA 4KUDA 3A6NC 4LD9D 5B40B 5B33D 3AZIA 5GT0A 3W97B 1P3KB 3KXBD 4KGCB 3RELD 3UTAC 5AV5D 5AV8A 5B0YD 5B1LA 4J8UC 5B31C 1M18D 3AZFC 4WU8B 3MGSD 4H9OA 4WU9D 3AZMD 3LELB 5G49A 3REJB 3AZGD 1P3BD 5AVBD 3WAAA 4G91B 2AROA 3VH5W 3W98D 3W96D 5B24D 3AZJB 5B0ZD 5AVCB 3REJA 5C3IB 1P3MC 3LJAC 4LD9B 4QLCA 5B33B 3AZIC 3X1VD 4Z5TD 1M19A 3V9RB 3KXBB 3C1CC 3MGQC 5AV5B 4YM6D 5AV8C 5B0YB 5B1LC 5BNXB 3O62D 5CPKA 3B0CW 1M18B 1P3AC 2NQBD 1P3LA 3MGSB 3AZMB 5AVCA 3R45B 3LZ1D 5DNND 4X23D 1BFMA 5B2ID 1KX5D 1EQZD 1TZYA 4LD9A 5KDMB 1P3BB 2JSSA 5B33A 1P3OD 5AVBB
chains in the Genus database with same CATH superfamily
3WAAC 3RELA 1AOIA 3AL0C 2AROC 3W98B 3MGRD 3AZHD 3MNNC 4J8WB 3MGSA 4WU9A 3X1TD 5AV9D 4CAYA 3AZGA 4QLCC 5KDMA 3X1UD 1P3BA 3P5JB 1P3FA 4YS3A 4Z5TB 4Z66D 5BNVB 3NQUA 1PZRA 4CSRB 5AVBA 3AZKC 3AN2D 1M19C 5GXQD 3LZ0B 1S32B 1U35D 2FFFB 4J8VD 3W96A 4AWLB 3W98A 2NQBB 1KX3A 5JA4B 5B24A 3W99D 5B0ZA 3MVDD 3LZ1B 4EO5B 1KX5B 1EQZB 1TZYC 3X1VA 5BNVA 1W2EA 4CSRA 3C1BD 1ID3B 3AV2C 1AOIC 2LY8A 4YM6A 3AFAD 2FJ7B 3X1SC 2YFVB 3O62A 3MGRB 2NQBA 3AZLA 4H9NA 3AZHB 2Y2JA 5F99C 3WTPD 5DNNA 4X23A 3X1TB 5B2IA 1EQZA 3MGPD 3REHB 1P3PB 3AZED 1P3FC 3X1UB 1WWSA 4YS3C 2ZY5A 5GT3D 5BO0A 4Z66B 1P3OA 3AN2B 5CPID 5GXQB 2NZDD 3AV1B 3NQJB 4H9SC 1U35B 2HIOD 3A1IA 4J8VB 3MGRA 1KX3C 5B24C 4H9QA 3W99B 4ZUXC 3W97D 4KHAB 1P3KD 3WKJA 1B6WA 3X1TA 4KGCD 4WNNB 5AV9A 3EPJA 2DF4C 2W8SA 3X1UA 1BH9B 3X1VC 4Z66A 5GSUD 4WU8D 5GXQA 3KFUG 3NQJA 3B6GD 3LELD 1KU5A 4DRBA 2IO5B 3AZLC 2CV5D 1ZLAD 2XD1A 3KWQB 3WTPE 3AZNC 3MVDA 3AYWC 3VH6T 5B2IC 4WNNA 3UT9C 2Y2NA 4Z2MH 1HQ3A 5B32D 3AZEB 1BH9A 1P3OC 3B6FB 5AY8A 5CP6A 3C1BA 2NZDB 4XUJD 3AFAA 3EPKA 4DRAA 2HIOB 2RIQA 1F1EA 4E45A 3WKJC 3WTPA 5AV9C 3MGPA 5E5AD 3VH5A 5GT3A 4HGAC 5DNMB 5GSUB 5CPIA 4H9RB 4XZQD 1P3GB 1BH8A 3C1CB 3WA9D 3B6GB 3REIC 4J8XC 2CV5B 1ZLAB 5B40A 3MVDC 3W97A 3B0DC 1P3KA 4KGCA 1HQ3C 2ZY2A 5B32B 1H3OB 1HTAA 5CHLB 3REKD 3TU4C 4ZBJB 5AY8C 5CP6C 4H9RA 4WU8A 2F8NK 4XUJB 3AFAC 4J8WD 4JJNC 3B6GA 3LELA 1P3IC 2RVQD 4KUDC 3EPHA 4R8PD 5GT0C 1KX4D 3WTPC 3LZ0D 5E5AB 1F66B 5AV6D 1S32D 5GT3C 1H3OA 5CPJB 5CPIC 4XZQB 3AZJA 3WA9B 2F8ND 2ZY4A 2G5IC 3EG5B 2PYOB 5BT1C 5B40C 1P3KC 1ID3D 3V9RA 3KXBA 4KGCC 5AV5A 5E5AA 1Q9CA 5B0YA 1M1AB 2FJ7D 5BNXA 4WZSB 3KUYD 3REKB 1M18A 5B32G 4WU8C 3AV2B 3AZMA 3LELC 3R45A 3REJC 3REHD 1P3PD 3B0CT 4R8PB 2BYKB 1KX4B 4NFTA 4G91C 3AV1D 2F8NH 5AV6B 3REKA 5CPKC 2Y2LA 1P34D 1P3LC 3AZJC 4J8WA 5AVCC 2F8NB 2HUEC 5C3IC 5B1MB 4LD9C 5B33C 3A6ND 2BYKA 4Z5TA 4ZUXB 3H0MC 3KXBC 3RELC 5AV5C 3LZ0A 3UTBB 3UTAD 5AV6A 5B0YC 1S32A 2YFWB 1M18C 3KUYB 5JA4A 5B31D 4J8UD 3KWQD 3KSYA 3MGSC 4WU9C 3AZMC 2F8NA 3LZ1A 2J8PA 1KX5A 1T3UA 3AZGC 1P3BC 4UUZB 5B2JB 3B6FD 5AVBC 1N1JB 1ID3A 1B67A 2G5HC 2XD5A 2FJ7A 5FUGB 2YFVA 3W96C 1P34B 3W98C 2JE5A 5JRGB 4G92B 3AZHA 4H9PB 5B0ZC 4J8WC 1A7WA 3REHA 1P3PA 1P3MD 2F8NG 3LJAD 5BS7A 3IP4C 3A6NB 4UUZA 4Z5TC 5DNMD 3AN2A 4NE5A 1P3GD 4YM6C 3C1CD 3MGQD 3UTAB 3AV1A 1U35A 4J8VA 3O62C 4AWLC 5B1LD 2NQBC 4HGAB 4J8UB 5B31B 1JFIB 1P3AD 3AZFB 3W99A 1TAFB 4KHAA 3LZ1C 5DNNC 4X23C 1KX5C 1EQZC 3H0LC 1ID3C 3UTAA 2AROD 3MGRC 4J8UA 3AZHC 2Y2QA 3KWQA 2F2AC 3MNND 3FDDA 3B0BA 4NE3A 3X1TC 4UPKA 3REHC 1P3PC 1P3MB 1F66D 3LJAB 3AZEA 5BS7C 3X1UC 4QLCD 4Z66C 5CPJD 3AZIB 5GT0B 3AN2C 3B6FA 1M19D 5GXQC 3AZKD 2NZDA 3AV1C 3MGQB 5AV8B 1U35C 2HIOA 4J8VC 5B1LB 2Y2OA 2PYOD 1P3AB 3W99C 4H9OB 2UWXA 5G49B 1P3MA 1R4VA 1TZYD 1M1AD 5DNMA 5GSUA 3C1BC 3WAAB 1P3GA 3AV2D 3C1CA 3MGQA 1AOID 2AROB 4Z2MG 2IO5C 3X1SD 2CV5A 2CWEA 3KWQC 1ZLAA 1P3AA 3MNNB 3F6TA 5F99D 3MGPC 2DQNC 3AZEC 5B32A 4QLCB 1P3FD 3B6FC 4YS3D 1M19B 3AZKB 2NZDC 4XUJA 2HIOC 5CPKB 4M6BA 5B1MD 3VH5T 1KX3D 3MNNA 1P3LB 3W97C 4ZUXD 2HUEB 3H0RC 3UTBD 1F66A 1TZYB 5DNMC 5CPJA 5GSUC 3AZKA 4XZQA 1P3GC 3RELB 1AOIB 3B6GC 3WA9A 3X1SB 2CV5C 1ZLAC 3AZLD 2PYOA 5B2JD 3AZND 4WU9B 3AYWD 5F99B 3UT9D 5B32C 4CAYB 3AZGB 1P3FB 1M1AA 4YS3B 4ZBJC 5JRGD 2ZY3A 3NQUB 4XUJC 3AV2A 2L5AA 2BG1A 3X1SA 3W96B 1KX3B 5B24B 4R8PA 5B0ZB 1KX4A 5F99A 3WKJD 5E5AC 1ULYA 1F66C 3X1VB 5CPJC 4XZQC 3AZFD 3WA9C 4YM6B 4H9SA 3REID 4J8XD 3O62B 2Y2HA 4NE6A 5B1MA 3AZLB 1Z2CB 4H9NB 2PYOC 3AZNB 4ZUXA 3AYWB 5DNNB 4X23B 5B2IB 3UTBA 3UT9B 1HQ3D 1M1AC 2YFWA 3REKC 3KUYA 5BO0B 1P3OB 3TU4D 5AY8D 5CP6D 3EPLA 3VH6A 4JJND 4WV4B 2RVQC 1P3ID 4KUDD 4R8PC 4H9QB 5B2JA 3AZNA 3AZID 3AYWA 5GT0D 1N1JA 1KX4C 4E44A 3WKJB 3LZ0C 5AV9B 3UT9A 3A1KA 5AV6C 5AV8D 4DQYB 1S32C 5FUGA 1P34A 5JRGA 4H9PA 3VH6W 4EO5C 3REIB 1WWIA 4J8XB 5B1MC 3A6NA 5BT1D 5B40D 3MVDB 3B0DB 2Y2MA 3WAAD 3UTBC 1HQ3B 2FJ7C 3KUYC 3TU4B 5B31A 1JFIA 5CP6B 5AY8B 3C1BB 3AZFA 1TAFA 3AFAB 4JJNB 3REJD 3REIA 4J8XA 1P3IB 2BYMB 4KUDB 5B2JC 2Y2KA 3WTPB 3MGPB 2Y2GA 5GT3B 1P34C 5JRGC 4G92C 3TU4A 5CPIB 5CPKD 1P3LD 3AZJD 1BH8B 4JJNA 5AVCD 5B31G 1P3IA 2BYMA 3LJAA 4KUDA 3A6NC 4LD9D 2Y2IA 5B40B 5B33D 3AZIA 5GT0A 3W97B 1P3KB 3KXBD 4KGCB 3RELD 3UTAC 5AV5D 5AV8A 5B0YD 5B1LA 4J8UC 5B31C 1M18D 3AZFC 4WU8B 3MGSD 4H9OA 4WU9D 3AZMD 3LELB 5G49A 3REJB 3AZGD 1P3BD 5AVBD 2VQRA 3WAAA 4G91B 2AROA 2JCHA 3VH5W 3W98D 3W96D 5B24D 3AZJB 5B0ZD 5AVCB 3REJA 5C3IB 1P3MC 3LJAC 4LD9B 4QLCA 5B33B 3AZIC 3X1VD 4Z5TD 1M19A 3V9RB 3KXBB 3C1CC 3MGQC 4WJ3C 5AV5B 4YM6D 5AV8C 5B0YB 5B1LC 5BNXB 3O62D 5CPKA 3B0CW 1M18B 1P3AC 2NQBD 1P3LA 3MGSB 3AZMB 5AVCA 3R45B 3LZ1D 2ZM5A 5DNND 2Y2PA 4X23D 1BFMA 5B2ID 1KX5D 1EQZD 1TZYA 4LD9A 5KDMB 1P3BB 2JSSA 5B33A 1P3OD 5AVBB
chains in the Genus database with same CATH topology
3WAAC 3RELA 1AOIA 3AL0C 2AROC 3W98B 3MGRD 3AZHD 3MNNC 4J8WB 3MGSA 4WU9A 3X1TD 5AV9D 4CAYA 3AZGA 4QLCC 5KDMA 3X1UD 1P3BA 3P5JB 1P3FA 4YS3A 4Z5TB 4Z66D 5BNVB 3NQUA 1PZRA 4CSRB 5AVBA 3AZKC 3AN2D 1M19C 5GXQD 3LZ0B 1S32B 1U35D 2FFFB 4J8VD 3W96A 4AWLB 3W98A 2NQBB 1KX3A 5JA4B 5B24A 3W99D 5B0ZA 3MVDD 3LZ1B 4EO5B 1KX5B 1EQZB 1TZYC 3X1VA 5BNVA 1W2EA 4CSRA 3C1BD 1ID3B 3AV2C 1AOIC 2LY8A 4YM6A 3AFAD 2FJ7B 3X1SC 2YFVB 3O62A 3MGRB 2NQBA 3AZLA 4H9NA 3AZHB 2Y2JA 5F99C 3WTPD 5DNNA 4X23A 3X1TB 5B2IA 1EQZA 3MGPD 3REHB 1P3PB 3AZED 1P3FC 3X1UB 1WWSA 4YS3C 2ZY5A 5GT3D 5BO0A 4Z66B 1P3OA 3AN2B 5CPID 5GXQB 2NZDD 3AV1B 3NQJB 4H9SC 1U35B 2HIOD 3A1IA 4J8VB 3MGRA 1KX3C 5B24C 4H9QA 3W99B 4ZUXC 3W97D 4KHAB 1P3KD 3WKJA 1B6WA 3X1TA 4KGCD 4WNNB 5AV9A 3EPJA 2DF4C 2W8SA 3X1UA 1BH9B 3X1VC 4Z66A 5GSUD 4WU8D 5GXQA 3KFUG 3NQJA 3B6GD 3LELD 1KU5A 4DRBA 2IO5B 3AZLC 2CV5D 1ZLAD 2XD1A 3KWQB 3WTPE 3AZNC 3MVDA 3AYWC 3VH6T 5B2IC 4WNNA 3UT9C 2Y2NA 4Z2MH 1HQ3A 5B32D 3AZEB 1BH9A 1P3OC 3B6FB 5AY8A 5CP6A 3C1BA 2NZDB 4XUJD 3AFAA 3EPKA 4DRAA 2HIOB 2RIQA 1F1EA 4E45A 3WKJC 3WTPA 5AV9C 3MGPA 5E5AD 3VH5A 5GT3A 4HGAC 5DNMB 5GSUB 5CPIA 4H9RB 4XZQD 1P3GB 1BH8A 3C1CB 3WA9D 3B6GB 3REIC 4J8XC 2CV5B 1ZLAB 5B40A 3MVDC 3W97A 3B0DC 1P3KA 4KGCA 1HQ3C 2ZY2A 5B32B 1H3OB 1HTAA 5CHLB 3REKD 3TU4C 4ZBJB 5AY8C 5CP6C 4H9RA 4WU8A 2F8NK 4XUJB 3AFAC 4J8WD 4JJNC 3B6GA 3LELA 1P3IC 2RVQD 4KUDC 3EPHA 4R8PD 5GT0C 1KX4D 3WTPC 3LZ0D 5E5AB 1F66B 5AV6D 1S32D 5GT3C 1H3OA 5CPJB 5CPIC 4XZQB 3AZJA 3WA9B 2F8ND 2ZY4A 2G5IC 3EG5B 2PYOB 5BT1C 5B40C 1P3KC 1ID3D 3V9RA 3KXBA 4KGCC 5AV5A 5E5AA 1Q9CA 5B0YA 1M1AB 2FJ7D 5BNXA 4WZSB 3KUYD 3REKB 1M18A 5B32G 4WU8C 3AV2B 3AZMA 3LELC 3R45A 3REJC 3REHD 1P3PD 3B0CT 4R8PB 2BYKB 1KX4B 4NFTA 4G91C 3AV1D 2F8NH 5AV6B 3REKA 5CPKC 2Y2LA 1P34D 1P3LC 3AZJC 4J8WA 5AVCC 2F8NB 2HUEC 5C3IC 5B1MB 4LD9C 5B33C 3A6ND 2BYKA 4Z5TA 4ZUXB 3H0MC 3KXBC 3RELC 5AV5C 3LZ0A 3UTBB 3UTAD 5AV6A 5B0YC 1S32A 2YFWB 1M18C 3KUYB 5JA4A 5B31D 4J8UD 3KWQD 3KSYA 3MGSC 4WU9C 3AZMC 2F8NA 3LZ1A 2J8PA 1KX5A 1T3UA 3AZGC 1P3BC 4UUZB 5B2JB 3B6FD 5AVBC 1N1JB 1ID3A 1B67A 2G5HC 2XD5A 2FJ7A 5FUGB 2YFVA 3W96C 1P34B 3W98C 2JE5A 5JRGB 4G92B 3AZHA 4H9PB 5B0ZC 4J8WC 1A7WA 3REHA 1P3PA 1P3MD 2F8NG 3LJAD 5BS7A 3IP4C 3A6NB 4UUZA 4Z5TC 5DNMD 3AN2A 4NE5A 1P3GD 4YM6C 3C1CD 3MGQD 3UTAB 3AV1A 1U35A 4J8VA 3O62C 4AWLC 5B1LD 2NQBC 4HGAB 4J8UB 5B31B 1JFIB 1P3AD 3AZFB 3W99A 1TAFB 4KHAA 3LZ1C 5DNNC 4X23C 1KX5C 1EQZC 3H0LC 1ID3C 3UTAA 2AROD 3MGRC 4J8UA 3AZHC 2Y2QA 3KWQA 2F2AC 3MNND 3FDDA 3B0BA 4NE3A 3X1TC 4UPKA 3REHC 1P3PC 1P3MB 1F66D 3LJAB 3AZEA 5BS7C 3X1UC 4QLCD 4Z66C 5CPJD 3AZIB 5GT0B 3AN2C 3B6FA 1M19D 5GXQC 3AZKD 2NZDA 3AV1C 3MGQB 5AV8B 1U35C 2HIOA 4J8VC 5B1LB 2Y2OA 2PYOD 1P3AB 3W99C 4H9OB 2UWXA 5G49B 1P3MA 1R4VA 1TZYD 1M1AD 5DNMA 5GSUA 3C1BC 3WAAB 1P3GA 3AV2D 3C1CA 3MGQA 1AOID 2AROB 4Z2MG 2IO5C 3X1SD 2CV5A 2CWEA 3KWQC 1ZLAA 1P3AA 3MNNB 3F6TA 5F99D 3MGPC 2DQNC 3AZEC 5B32A 4QLCB 1P3FD 3B6FC 4YS3D 1M19B 3AZKB 2NZDC 4XUJA 2HIOC 5CPKB 4M6BA 5B1MD 3VH5T 1KX3D 3MNNA 1P3LB 3W97C 4ZUXD 2HUEB 3H0RC 3UTBD 1F66A 1TZYB 5DNMC 5CPJA 5GSUC 3AZKA 4XZQA 1P3GC 3RELB 1AOIB 3B6GC 3WA9A 3X1SB 2CV5C 1ZLAC 3AZLD 2PYOA 5B2JD 3AZND 4WU9B 3AYWD 5F99B 3UT9D 5B32C 4CAYB 3AZGB 1P3FB 1M1AA 4YS3B 4ZBJC 5JRGD 2ZY3A 3NQUB 4XUJC 3AV2A 2L5AA 2BG1A 3X1SA 3W96B 1KX3B 5B24B 4R8PA 5B0ZB 1KX4A 5F99A 3WKJD 5E5AC 1ULYA 1F66C 3X1VB 5CPJC 4XZQC 3AZFD 3WA9C 4YM6B 4H9SA 3REID 4J8XD 3O62B 2Y2HA 4NE6A 5B1MA 3AZLB 1Z2CB 4H9NB 2PYOC 3AZNB 4ZUXA 3AYWB 5DNNB 4X23B 5B2IB 3UTBA 3UT9B 1HQ3D 1M1AC 2YFWA 3REKC 3KUYA 5BO0B 1P3OB 3TU4D 5AY8D 5CP6D 3EPLA 3VH6A 4JJND 4WV4B 2RVQC 1P3ID 4KUDD 4R8PC 4H9QB 5B2JA 3AZNA 3AZID 3AYWA 5GT0D 1N1JA 1KX4C 4E44A 3WKJB 3LZ0C 5AV9B 3UT9A 3A1KA 5AV6C 5AV8D 4DQYB 1S32C 5FUGA 1P34A 5JRGA 4H9PA 3VH6W 4EO5C 3REIB 1WWIA 4J8XB 5B1MC 3A6NA 5BT1D 5B40D 3MVDB 3B0DB 2Y2MA 3WAAD 3UTBC 1HQ3B 2FJ7C 3KUYC 3TU4B 5B31A 1JFIA 5CP6B 5AY8B 3C1BB 3AZFA 1TAFA 3AFAB 4JJNB 3REJD 3REIA 4J8XA 1P3IB 2BYMB 4KUDB 5B2JC 2Y2KA 3WTPB 3MGPB 2Y2GA 5GT3B 1P34C 5JRGC 4G92C 3TU4A 5CPIB 5CPKD 1P3LD 3AZJD 1BH8B 4JJNA 5AVCD 5B31G 1P3IA 2BYMA 3LJAA 4KUDA 3A6NC 4LD9D 2Y2IA 5B40B 5B33D 3AZIA 5GT0A 3W97B 1P3KB 3KXBD 4KGCB 3RELD 3UTAC 5AV5D 5AV8A 5B0YD 5B1LA 4J8UC 5B31C 1M18D 3AZFC 4WU8B 3MGSD 4H9OA 4WU9D 3AZMD 3LELB 5G49A 3REJB 3AZGD 1P3BD 5AVBD 2VQRA 3WAAA 4G91B 2AROA 2JCHA 3VH5W 3W98D 3W96D 5B24D 3AZJB 5B0ZD 5AVCB 3REJA 5C3IB 1P3MC 3LJAC 4LD9B 4QLCA 5B33B 3AZIC 3X1VD 4Z5TD 1M19A 3V9RB 3KXBB 3C1CC 3MGQC 4WJ3C 5AV5B 4YM6D 5AV8C 5B0YB 5B1LC 5BNXB 3O62D 5CPKA 3B0CW 1M18B 1P3AC 2NQBD 1P3LA 3MGSB 3AZMB 5AVCA 3R45B 3LZ1D 2ZM5A 5DNND 2Y2PA 4X23D 1BFMA 5B2ID 1KX5D 1EQZD 1TZYA 4LD9A 5KDMB 1P3BB 2JSSA 5B33A 1P3OD 5AVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAA C;  3REL A;  1AOI A;  2ARO C;  3W98 B;  3MGR D;  3AZH D;  3MNN C;  4J8W B;  3MGS A;  4WU9 A;  3X1T D;  5AV9 D;  4CAY A;  3AZG A;  4QLC C;  5KDM A;  3X1U D;  1P3B A;  1P3F A;  4YS3 A;  4Z5T B;  4Z66 D;  5BNV B;  3NQU A;  5AVB A;  4CSR B;  3AZK C;  3AN2 D;  1M19 C;  5GXQ D;  3LZ0 B;  1S32 B;  1U35 D;  4J8V D;  3W96 A;  4AWL B;  3W98 A;  2NQB B;  1KX3 A;  5JA4 B;  5B24 A;  3W99 D;  5B0Z A;  3MVD D;  3LZ1 B;  4EO5 B;  1KX5 B;  1EQZ B;  1TZY C;  3X1V A;  5BNV A;  4CSR A;  3C1B D;  1ID3 B;  3AV2 C;  1AOI C;  2LY8 A;  4YM6 A;  3AFA D;  2FJ7 B;  3X1S C;  2YFV B;  3O62 A;  3MGR B;  2NQB A;  3AZL A;  4H9N A;  3AZH B;  5F99 C;  3WTP D;  5DNN A;  4X23 A;  3X1T B;  5B2I A;  1EQZ A;  3MGP D;  3REH B;  1P3P B;  3AZE D;  1P3F C;  3X1U B;  1WWS A;  4YS3 C;  5GT3 D;  5BO0 A;  4Z66 B;  1P3O A;  3AN2 B;  5CPI D;  5GXQ B;  2NZD D;  3AV1 B;  3NQJ B;  4H9S C;  1U35 B;  2HIO D;  4J8V B;  3MGR A;  1KX3 C;  5B24 C;  4H9Q A;  3W99 B;  4ZUX C;  3W97 D;  4KHA B;  1P3K D;  3WKJ A;  1B6W A;  3X1T A;  4KGC D;  4WNN B;  5AV9 A;  3X1U A;  1BH9 B;  3X1V C;  4Z66 A;  5GSU D;  4WU8 D;  5GXQ A;  3NQJ A;  3B6G D;  3LEL D;  1KU5 A;  4DRB A;  2IO5 B;  3AZL C;  2CV5 D;  1ZLA D;  3KWQ B;  3WTP E;  3AZN C;  3MVD A;  3AYW C;  3VH6 T;  5B2I C;  4WNN A;  3UT9 C;  4Z2M H;  1HQ3 A;  5B32 D;  3AZE B;  1BH9 A;  1P3O C;  3B6F B;  5AY8 A;  5CP6 A;  3C1B A;  2NZD B;  4XUJ D;  3AFA A;  4DRA A;  2HIO B;  1F1E A;  4E45 A;  3WKJ C;  3WTP A;  5AV9 C;  3MGP A;  5E5A D;  3VH5 A;  5GT3 A;  4HGA C;  5DNM B;  5GSU B;  5CPI A;  4H9R B;  4XZQ D;  1P3G B;  1BH8 A;  3C1C B;  3WA9 D;  3B6G B;  3REI C;  4J8X C;  2CV5 B;  1ZLA B;  5B40 A;  3MVD C;  3W97 A;  3B0D C;  1P3K A;  4KGC A;  1HQ3 C;  5B32 B;  1H3O B;  1HTA A;  5CHL B;  3REK D;  3TU4 C;  4ZBJ B;  5AY8 C;  5CP6 C;  4H9R A;  4WU8 A;  2F8N K;  4XUJ B;  3AFA C;  4J8W D;  4JJN C;  3B6G A;  3LEL A;  1P3I C;  2RVQ D;  4KUD C;  4R8P D;  5GT0 C;  1KX4 D;  3WTP C;  3LZ0 D;  5E5A B;  1F66 B;  5AV6 D;  1S32 D;  5GT3 C;  1H3O A;  5CPJ B;  5CPI C;  4XZQ B;  3AZJ A;  3WA9 B;  2F8N D;  2PYO B;  5BT1 C;  5B40 C;  1P3K C;  1ID3 D;  3V9R A;  3KXB A;  4KGC C;  5AV5 A;  5E5A A;  1Q9C A;  5B0Y A;  1M1A B;  2FJ7 D;  5BNX A;  4WZS B;  3KUY D;  3REK B;  1M18 A;  5B32 G;  4WU8 C;  3AV2 B;  3AZM A;  3LEL C;  3R45 A;  3REJ C;  3REH D;  1P3P D;  3B0C T;  4R8P B;  2BYK B;  1KX4 B;  4NFT A;  4G91 C;  3AV1 D;  2F8N H;  5AV6 B;  3REK A;  5CPK C;  1P34 D;  1P3L C;  3AZJ C;  4J8W A;  5AVC C;  2F8N B;  2HUE C;  5C3I C;  5B1M B;  4LD9 C;  5B33 C;  3A6N D;  2BYK A;  4Z5T A;  4ZUX B;  3KXB C;  3REL C;  5AV5 C;  3LZ0 A;  3UTB B;  3UTA D;  5AV6 A;  5B0Y C;  1S32 A;  2YFW B;  1M18 C;  3KUY B;  5JA4 A;  5B31 D;  4J8U D;  3KWQ D;  3KSY A;  3MGS C;  4WU9 C;  3AZM C;  2F8N A;  3LZ1 A;  1KX5 A;  3AZG C;  1P3B C;  4UUZ B;  5B2J B;  3B6F D;  5AVB C;  1N1J B;  1ID3 A;  1B67 A;  2FJ7 A;  5FUG B;  2YFV A;  3W96 C;  1P34 B;  3W98 C;  5JRG B;  4G92 B;  3AZH A;  4H9P B;  5B0Z C;  4J8W C;  1A7W A;  3REH A;  1P3P A;  1P3M D;  2F8N G;  3LJA D;  5BS7 A;  3A6N B;  4UUZ A;  4Z5T C;  5DNM D;  3AN2 A;  4NE5 A;  1P3G D;  4YM6 C;  3C1C D;  3MGQ D;  3UTA B;  3AV1 A;  1U35 A;  4J8V A;  3O62 C;  4AWL C;  5B1L D;  2NQB C;  4HGA B;  4J8U B;  5B31 B;  1JFI B;  1P3A D;  3AZF B;  3W99 A;  1TAF B;  4KHA A;  3LZ1 C;  5DNN C;  4X23 C;  1KX5 C;  1EQZ C;  1ID3 C;  3UTA A;  2ARO D;  3MGR C;  4J8U A;  3AZH C;  3KWQ A;  3MNN D;  3B0B A;  4NE3 A;  3X1T C;  3REH C;  1P3P C;  1P3M B;  1F66 D;  3LJA B;  3AZE A;  5BS7 C;  3X1U C;  4QLC D;  4Z66 C;  5CPJ D;  3AZI B;  5GT0 B;  3AN2 C;  3B6F A;  1M19 D;  5GXQ C;  3AZK D;  2NZD A;  3AV1 C;  3MGQ B;  5AV8 B;  1U35 C;  2HIO A;  4J8V C;  5B1L B;  2PYO D;  1P3A B;  3W99 C;  4H9O B;  5G49 B;  1P3M A;  1R4V A;  1TZY D;  1M1A D;  5DNM A;  5GSU A;  3C1B C;  3WAA B;  1P3G A;  3AV2 D;  3C1C A;  3MGQ A;  1AOI D;  2ARO B;  4Z2M G;  2IO5 C;  3X1S D;  2CV5 A;  2CWE A;  3KWQ C;  1ZLA A;  1P3A A;  3MNN B;  5F99 D;  3MGP C;  3AZE C;  5B32 A;  4QLC B;  1P3F D;  3B6F C;  4YS3 D;  1M19 B;  3AZK B;  2NZD C;  4XUJ A;  2HIO C;  5CPK B;  4M6B A;  5B1M D;  3VH5 T;  1KX3 D;  3MNN A;  1P3L B;  3W97 C;  4ZUX D;  2HUE B;  3UTB D;  1F66 A;  1TZY B;  5DNM C;  5CPJ A;  5GSU C;  3AZK A;  4XZQ A;  1P3G C;  3REL B;  1AOI B;  3B6G C;  3WA9 A;  3X1S B;  2CV5 C;  1ZLA C;  3AZL D;  2PYO A;  5B2J D;  3AZN D;  4WU9 B;  3AYW D;  5F99 B;  3UT9 D;  5B32 C;  4CAY B;  3AZG B;  1P3F B;  1M1A A;  4YS3 B;  4ZBJ C;  5JRG D;  3NQU B;  4XUJ C;  3AV2 A;  2L5A A;  3X1S A;  3W96 B;  1KX3 B;  5B24 B;  4R8P A;  5B0Z B;  1KX4 A;  5F99 A;  3WKJ D;  5E5A C;  1ULY A;  1F66 C;  3X1V B;  5CPJ C;  4XZQ C;  3AZF D;  3WA9 C;  4YM6 B;  4H9S A;  3REI D;  4J8X D;  3O62 B;  4NE6 A;  5B1M A;  3AZL B;  2PYO C;  4H9N B;  3AZN B;  4ZUX A;  3AYW B;  5DNN B;  4X23 B;  5B2I B;  3UTB A;  3UT9 B;  1HQ3 D;  1M1A C;  2YFW A;  3REK C;  3KUY A;  5BO0 B;  1P3O B;  3TU4 D;  5AY8 D;  5CP6 D;  3VH6 A;  4JJN D;  4WV4 B;  2RVQ C;  1P3I D;  4KUD D;  4R8P C;  4H9Q B;  5B2J A;  3AZN A;  3AZI D;  3AYW A;  5GT0 D;  1N1J A;  1KX4 C;  4E44 A;  3WKJ B;  3LZ0 C;  5AV9 B;  3UT9 A;  5AV6 C;  5AV8 D;  1S32 C;  5FUG A;  1P34 A;  5JRG A;  4H9P A;  3VH6 W;  4EO5 C;  3REI B;  1WWI A;  4J8X B;  5B1M C;  3A6N A;  5BT1 D;  5B40 D;  3MVD B;  3B0D B;  3WAA D;  3UTB C;  1HQ3 B;  2FJ7 C;  3KUY C;  3TU4 B;  5B31 A;  1JFI A;  5CP6 B;  5AY8 B;  3C1B B;  3AZF A;  1TAF A;  3AFA B;  4JJN B;  3REJ D;  3REI A;  4J8X A;  1P3I B;  2BYM B;  4KUD B;  5B2J C;  3WTP B;  3MGP B;  5GT3 B;  1P34 C;  5JRG C;  4G92 C;  3TU4 A;  5CPI B;  5CPK D;  1P3L D;  3AZJ D;  1BH8 B;  4JJN A;  5AVC D;  5B31 G;  1P3I A;  2BYM A;  3LJA A;  4KUD A;  3A6N C;  4LD9 D;  5B40 B;  5B33 D;  3AZI A;  5GT0 A;  3W97 B;  1P3K B;  3KXB D;  4KGC B;  3REL D;  3UTA C;  5AV5 D;  5AV8 A;  5B0Y D;  5B1L A;  4J8U C;  5B31 C;  1M18 D;  3AZF C;  4WU8 B;  3MGS D;  4H9O A;  4WU9 D;  3AZM D;  3LEL B;  5G49 A;  3REJ B;  3AZG D;  1P3B D;  5AVB D;  3WAA A;  4G91 B;  2ARO A;  3VH5 W;  3W98 D;  3W96 D;  5B24 D;  3AZJ B;  5B0Z D;  5AVC B;  3REJ A;  5C3I B;  1P3M C;  3LJA C;  4LD9 B;  4QLC A;  5B33 B;  3AZI C;  3X1V D;  4Z5T D;  1M19 A;  3V9R B;  3KXB B;  3C1C C;  3MGQ C;  5AV5 B;  4YM6 D;  5AV8 C;  5B0Y B;  5B1L C;  5BNX B;  3O62 D;  5CPK A;  3B0C W;  1M18 B;  1P3A C;  2NQB D;  1P3L A;  3MGS B;  3AZM B;  5AVC A;  3R45 B;  3LZ1 D;  5DNN D;  4X23 D;  1BFM A;  5B2I D;  1KX5 D;  1EQZ D;  1TZY A;  4LD9 A;  5KDM B;  1P3B B;  2JSS A;  5B33 A;  1P3O D;  5AVB B; 
#chains in the Genus database with same CATH topology
 3WAA C;  3REL A;  1AOI A;  3AL0 C;  2ARO C;  3W98 B;  3MGR D;  3AZH D;  3MNN C;  4J8W B;  3MGS A;  4WU9 A;  3X1T D;  5AV9 D;  4CAY A;  3AZG A;  4QLC C;  5KDM A;  3X1U D;  1P3B A;  3P5J B;  1P3F A;  4YS3 A;  4Z5T B;  4Z66 D;  5BNV B;  3NQU A;  1PZR A;  4CSR B;  5AVB A;  3AZK C;  3AN2 D;  1M19 C;  5GXQ D;  3LZ0 B;  1S32 B;  1U35 D;  2FFF B;  4J8V D;  3W96 A;  4AWL B;  3W98 A;  2NQB B;  1KX3 A;  5JA4 B;  5B24 A;  3W99 D;  5B0Z A;  3MVD D;  3LZ1 B;  4EO5 B;  1KX5 B;  1EQZ B;  1TZY C;  3X1V A;  5BNV A;  1W2E A;  4CSR A;  3C1B D;  1ID3 B;  3AV2 C;  1AOI C;  2LY8 A;  4YM6 A;  3AFA D;  2FJ7 B;  3X1S C;  2YFV B;  3O62 A;  3MGR B;  2NQB A;  3AZL A;  4H9N A;  3AZH B;  2Y2J A;  5F99 C;  3WTP D;  5DNN A;  4X23 A;  3X1T B;  5B2I A;  1EQZ A;  3MGP D;  3REH B;  1P3P B;  3AZE D;  1P3F C;  3X1U B;  1WWS A;  4YS3 C;  2ZY5 A;  5GT3 D;  5BO0 A;  4Z66 B;  1P3O A;  3AN2 B;  5CPI D;  5GXQ B;  2NZD D;  3AV1 B;  3NQJ B;  4H9S C;  1U35 B;  2HIO D;  3A1I A;  4J8V B;  3MGR A;  1KX3 C;  5B24 C;  4H9Q A;  3W99 B;  4ZUX C;  3W97 D;  4KHA B;  1P3K D;  3WKJ A;  1B6W A;  3X1T A;  4KGC D;  4WNN B;  5AV9 A;  3EPJ A;  2DF4 C;  2W8S A;  3X1U A;  1BH9 B;  3X1V C;  4Z66 A;  5GSU D;  4WU8 D;  5GXQ A;  3KFU G;  3NQJ A;  3B6G D;  3LEL D;  1KU5 A;  4DRB A;  2IO5 B;  3AZL C;  2CV5 D;  1ZLA D;  2XD1 A;  3KWQ B;  3WTP E;  3AZN C;  3MVD A;  3AYW C;  3VH6 T;  5B2I C;  4WNN A;  3UT9 C;  2Y2N A;  4Z2M H;  1HQ3 A;  5B32 D;  3AZE B;  1BH9 A;  1P3O C;  3B6F B;  5AY8 A;  5CP6 A;  3C1B A;  2NZD B;  4XUJ D;  3AFA A;  3EPK A;  4DRA A;  2HIO B;  2RIQ A;  1F1E A;  4E45 A;  3WKJ C;  3WTP A;  5AV9 C;  3MGP A;  5E5A D;  3VH5 A;  5GT3 A;  4HGA C;  5DNM B;  5GSU B;  5CPI A;  4H9R B;  4XZQ D;  1P3G B;  1BH8 A;  3C1C B;  3WA9 D;  3B6G B;  3REI C;  4J8X C;  2CV5 B;  1ZLA B;  5B40 A;  3MVD C;  3W97 A;  3B0D C;  1P3K A;  4KGC A;  1HQ3 C;  2ZY2 A;  5B32 B;  1H3O B;  1HTA A;  5CHL B;  3REK D;  3TU4 C;  4ZBJ B;  5AY8 C;  5CP6 C;  4H9R A;  4WU8 A;  2F8N K;  4XUJ B;  3AFA C;  4J8W D;  4JJN C;  3B6G A;  3LEL A;  1P3I C;  2RVQ D;  4KUD C;  3EPH A;  4R8P D;  5GT0 C;  1KX4 D;  3WTP C;  3LZ0 D;  5E5A B;  1F66 B;  5AV6 D;  1S32 D;  5GT3 C;  1H3O A;  5CPJ B;  5CPI C;  4XZQ B;  3AZJ A;  3WA9 B;  2F8N D;  2ZY4 A;  2G5I C;  3EG5 B;  2PYO B;  5BT1 C;  5B40 C;  1P3K C;  1ID3 D;  3V9R A;  3KXB A;  4KGC C;  5AV5 A;  5E5A A;  1Q9C A;  5B0Y A;  1M1A B;  2FJ7 D;  5BNX A;  4WZS B;  3KUY D;  3REK B;  1M18 A;  5B32 G;  4WU8 C;  3AV2 B;  3AZM A;  3LEL C;  3R45 A;  3REJ C;  3REH D;  1P3P D;  3B0C T;  4R8P B;  2BYK B;  1KX4 B;  4NFT A;  4G91 C;  3AV1 D;  2F8N H;  5AV6 B;  3REK A;  5CPK C;  2Y2L A;  1P34 D;  1P3L C;  3AZJ C;  4J8W A;  5AVC C;  2F8N B;  2HUE C;  5C3I C;  5B1M B;  4LD9 C;  5B33 C;  3A6N D;  2BYK A;  4Z5T A;  4ZUX B;  3H0M C;  3KXB C;  3REL C;  5AV5 C;  3LZ0 A;  3UTB B;  3UTA D;  5AV6 A;  5B0Y C;  1S32 A;  2YFW B;  1M18 C;  3KUY B;  5JA4 A;  5B31 D;  4J8U D;  3KWQ D;  3KSY A;  3MGS C;  4WU9 C;  3AZM C;  2F8N A;  3LZ1 A;  2J8P A;  1KX5 A;  1T3U A;  3AZG C;  1P3B C;  4UUZ B;  5B2J B;  3B6F D;  5AVB C;  1N1J B;  1ID3 A;  1B67 A;  2G5H C;  2XD5 A;  2FJ7 A;  5FUG B;  2YFV A;  3W96 C;  1P34 B;  3W98 C;  2JE5 A;  5JRG B;  4G92 B;  3AZH A;  4H9P B;  5B0Z C;  4J8W C;  1A7W A;  3REH A;  1P3P A;  1P3M D;  2F8N G;  3LJA D;  5BS7 A;  3IP4 C;  3A6N B;  4UUZ A;  4Z5T C;  5DNM D;  3AN2 A;  4NE5 A;  1P3G D;  4YM6 C;  3C1C D;  3MGQ D;  3UTA B;  3AV1 A;  1U35 A;  4J8V A;  3O62 C;  4AWL C;  5B1L D;  2NQB C;  4HGA B;  4J8U B;  5B31 B;  1JFI B;  1P3A D;  3AZF B;  3W99 A;  1TAF B;  4KHA A;  3LZ1 C;  5DNN C;  4X23 C;  1KX5 C;  1EQZ C;  3H0L C;  1ID3 C;  3UTA A;  2ARO D;  3MGR C;  4J8U A;  3AZH C;  2Y2Q A;  3KWQ A;  2F2A C;  3MNN D;  3FDD A;  3B0B A;  4NE3 A;  3X1T C;  4UPK A;  3REH C;  1P3P C;  1P3M B;  1F66 D;  3LJA B;  3AZE A;  5BS7 C;  3X1U C;  4QLC D;  4Z66 C;  5CPJ D;  3AZI B;  5GT0 B;  3AN2 C;  3B6F A;  1M19 D;  5GXQ C;  3AZK D;  2NZD A;  3AV1 C;  3MGQ B;  5AV8 B;  1U35 C;  2HIO A;  4J8V C;  5B1L B;  2Y2O A;  2PYO D;  1P3A B;  3W99 C;  4H9O B;  2UWX A;  5G49 B;  1P3M A;  1R4V A;  1TZY D;  1M1A D;  5DNM A;  5GSU A;  3C1B C;  3WAA B;  1P3G A;  3AV2 D;  3C1C A;  3MGQ A;  1AOI D;  2ARO B;  4Z2M G;  2IO5 C;  3X1S D;  2CV5 A;  2CWE A;  3KWQ C;  1ZLA A;  1P3A A;  3MNN B;  3F6T A;  5F99 D;  3MGP C;  2DQN C;  3AZE C;  5B32 A;  4QLC B;  1P3F D;  3B6F C;  4YS3 D;  1M19 B;  3AZK B;  2NZD C;  4XUJ A;  2HIO C;  5CPK B;  4M6B A;  5B1M D;  3VH5 T;  1KX3 D;  3MNN A;  1P3L B;  3W97 C;  4ZUX D;  2HUE B;  3H0R C;  3UTB D;  1F66 A;  1TZY B;  5DNM C;  5CPJ A;  5GSU C;  3AZK A;  4XZQ A;  1P3G C;  3REL B;  1AOI B;  3B6G C;  3WA9 A;  3X1S B;  2CV5 C;  1ZLA C;  3AZL D;  2PYO A;  5B2J D;  3AZN D;  4WU9 B;  3AYW D;  5F99 B;  3UT9 D;  5B32 C;  4CAY B;  3AZG B;  1P3F B;  1M1A A;  4YS3 B;  4ZBJ C;  5JRG D;  2ZY3 A;  3NQU B;  4XUJ C;  3AV2 A;  2L5A A;  2BG1 A;  3X1S A;  3W96 B;  1KX3 B;  5B24 B;  4R8P A;  5B0Z B;  1KX4 A;  5F99 A;  3WKJ D;  5E5A C;  1ULY A;  1F66 C;  3X1V B;  5CPJ C;  4XZQ C;  3AZF D;  3WA9 C;  4YM6 B;  4H9S A;  3REI D;  4J8X D;  3O62 B;  2Y2H A;  4NE6 A;  5B1M A;  3AZL B;  1Z2C B;  4H9N B;  2PYO C;  3AZN B;  4ZUX A;  3AYW B;  5DNN B;  4X23 B;  5B2I B;  3UTB A;  3UT9 B;  1HQ3 D;  1M1A C;  2YFW A;  3REK C;  3KUY A;  5BO0 B;  1P3O B;  3TU4 D;  5AY8 D;  5CP6 D;  3EPL A;  3VH6 A;  4JJN D;  4WV4 B;  2RVQ C;  1P3I D;  4KUD D;  4R8P C;  4H9Q B;  5B2J A;  3AZN A;  3AZI D;  3AYW A;  5GT0 D;  1N1J A;  1KX4 C;  4E44 A;  3WKJ B;  3LZ0 C;  5AV9 B;  3UT9 A;  3A1K A;  5AV6 C;  5AV8 D;  4DQY B;  1S32 C;  5FUG A;  1P34 A;  5JRG A;  4H9P A;  3VH6 W;  4EO5 C;  3REI B;  1WWI A;  4J8X B;  5B1M C;  3A6N A;  5BT1 D;  5B40 D;  3MVD B;  3B0D B;  2Y2M A;  3WAA D;  3UTB C;  1HQ3 B;  2FJ7 C;  3KUY C;  3TU4 B;  5B31 A;  1JFI A;  5CP6 B;  5AY8 B;  3C1B B;  3AZF A;  1TAF A;  3AFA B;  4JJN B;  3REJ D;  3REI A;  4J8X A;  1P3I B;  2BYM B;  4KUD B;  5B2J C;  2Y2K A;  3WTP B;  3MGP B;  2Y2G A;  5GT3 B;  1P34 C;  5JRG C;  4G92 C;  3TU4 A;  5CPI B;  5CPK D;  1P3L D;  3AZJ D;  1BH8 B;  4JJN A;  5AVC D;  5B31 G;  1P3I A;  2BYM A;  3LJA A;  4KUD A;  3A6N C;  4LD9 D;  2Y2I A;  5B40 B;  5B33 D;  3AZI A;  5GT0 A;  3W97 B;  1P3K B;  3KXB D;  4KGC B;  3REL D;  3UTA C;  5AV5 D;  5AV8 A;  5B0Y D;  5B1L A;  4J8U C;  5B31 C;  1M18 D;  3AZF C;  4WU8 B;  3MGS D;  4H9O A;  4WU9 D;  3AZM D;  3LEL B;  5G49 A;  3REJ B;  3AZG D;  1P3B D;  5AVB D;  2VQR A;  3WAA A;  4G91 B;  2ARO A;  2JCH A;  3VH5 W;  3W98 D;  3W96 D;  5B24 D;  3AZJ B;  5B0Z D;  5AVC B;  3REJ A;  5C3I B;  1P3M C;  3LJA C;  4LD9 B;  4QLC A;  5B33 B;  3AZI C;  3X1V D;  4Z5T D;  1M19 A;  3V9R B;  3KXB B;  3C1C C;  3MGQ C;  4WJ3 C;  5AV5 B;  4YM6 D;  5AV8 C;  5B0Y B;  5B1L C;  5BNX B;  3O62 D;  5CPK A;  3B0C W;  1M18 B;  1P3A C;  2NQB D;  1P3L A;  3MGS B;  3AZM B;  5AVC A;  3R45 B;  3LZ1 D;  2ZM5 A;  5DNN D;  2Y2P A;  4X23 D;  1BFM A;  5B2I D;  1KX5 D;  1EQZ D;  1TZY A;  4LD9 A;  5KDM B;  1P3B B;  2JSS A;  5B33 A;  1P3O D;  5AVB B; 
#chains in the Genus database with same CATH homology
 3WAA C;  3REL A;  1AOI A;  3AL0 C;  2ARO C;  3W98 B;  3MGR D;  3AZH D;  3MNN C;  4J8W B;  3MGS A;  4WU9 A;  3X1T D;  5AV9 D;  4CAY A;  3AZG A;  4QLC C;  5KDM A;  3X1U D;  1P3B A;  3P5J B;  1P3F A;  4YS3 A;  4Z5T B;  4Z66 D;  5BNV B;  3NQU A;  1PZR A;  4CSR B;  5AVB A;  3AZK C;  3AN2 D;  1M19 C;  5GXQ D;  3LZ0 B;  1S32 B;  1U35 D;  2FFF B;  4J8V D;  3W96 A;  4AWL B;  3W98 A;  2NQB B;  1KX3 A;  5JA4 B;  5B24 A;  3W99 D;  5B0Z A;  3MVD D;  3LZ1 B;  4EO5 B;  1KX5 B;  1EQZ B;  1TZY C;  3X1V A;  5BNV A;  1W2E A;  4CSR A;  3C1B D;  1ID3 B;  3AV2 C;  1AOI C;  2LY8 A;  4YM6 A;  3AFA D;  2FJ7 B;  3X1S C;  2YFV B;  3O62 A;  3MGR B;  2NQB A;  3AZL A;  4H9N A;  3AZH B;  2Y2J A;  5F99 C;  3WTP D;  5DNN A;  4X23 A;  3X1T B;  5B2I A;  1EQZ A;  3MGP D;  3REH B;  1P3P B;  3AZE D;  1P3F C;  3X1U B;  1WWS A;  4YS3 C;  2ZY5 A;  5GT3 D;  5BO0 A;  4Z66 B;  1P3O A;  3AN2 B;  5CPI D;  5GXQ B;  2NZD D;  3AV1 B;  3NQJ B;  4H9S C;  1U35 B;  2HIO D;  3A1I A;  4J8V B;  3MGR A;  1KX3 C;  5B24 C;  4H9Q A;  3W99 B;  4ZUX C;  3W97 D;  4KHA B;  1P3K D;  3WKJ A;  1B6W A;  3X1T A;  4KGC D;  4WNN B;  5AV9 A;  3EPJ A;  2DF4 C;  2W8S A;  3X1U A;  1BH9 B;  3X1V C;  4Z66 A;  5GSU D;  4WU8 D;  5GXQ A;  3KFU G;  3NQJ A;  3B6G D;  3LEL D;  1KU5 A;  4DRB A;  2IO5 B;  3AZL C;  2CV5 D;  1ZLA D;  2XD1 A;  3KWQ B;  3WTP E;  3AZN C;  3MVD A;  3AYW C;  3VH6 T;  5B2I C;  4WNN A;  3UT9 C;  2Y2N A;  4Z2M H;  1HQ3 A;  5B32 D;  3AZE B;  1BH9 A;  1P3O C;  3B6F B;  5AY8 A;  5CP6 A;  3C1B A;  2NZD B;  4XUJ D;  3AFA A;  3EPK A;  4DRA A;  2HIO B;  2RIQ A;  1F1E A;  4E45 A;  3WKJ C;  3WTP A;  5AV9 C;  3MGP A;  5E5A D;  3VH5 A;  5GT3 A;  4HGA C;  5DNM B;  5GSU B;  5CPI A;  4H9R B;  4XZQ D;  1P3G B;  1BH8 A;  3C1C B;  3WA9 D;  3B6G B;  3REI C;  4J8X C;  2CV5 B;  1ZLA B;  5B40 A;  3MVD C;  3W97 A;  3B0D C;  1P3K A;  4KGC A;  1HQ3 C;  2ZY2 A;  5B32 B;  1H3O B;  1HTA A;  5CHL B;  3REK D;  3TU4 C;  4ZBJ B;  5AY8 C;  5CP6 C;  4H9R A;  4WU8 A;  2F8N K;  4XUJ B;  3AFA C;  4J8W D;  4JJN C;  3B6G A;  3LEL A;  1P3I C;  2RVQ D;  4KUD C;  3EPH A;  4R8P D;  5GT0 C;  1KX4 D;  3WTP C;  3LZ0 D;  5E5A B;  1F66 B;  5AV6 D;  1S32 D;  5GT3 C;  1H3O A;  5CPJ B;  5CPI C;  4XZQ B;  3AZJ A;  3WA9 B;  2F8N D;  2ZY4 A;  2G5I C;  3EG5 B;  2PYO B;  5BT1 C;  5B40 C;  1P3K C;  1ID3 D;  3V9R A;  3KXB A;  4KGC C;  5AV5 A;  5E5A A;  1Q9C A;  5B0Y A;  1M1A B;  2FJ7 D;  5BNX A;  4WZS B;  3KUY D;  3REK B;  1M18 A;  5B32 G;  4WU8 C;  3AV2 B;  3AZM A;  3LEL C;  3R45 A;  3REJ C;  3REH D;  1P3P D;  3B0C T;  4R8P B;  2BYK B;  1KX4 B;  4NFT A;  4G91 C;  3AV1 D;  2F8N H;  5AV6 B;  3REK A;  5CPK C;  2Y2L A;  1P34 D;  1P3L C;  3AZJ C;  4J8W A;  5AVC C;  2F8N B;  2HUE C;  5C3I C;  5B1M B;  4LD9 C;  5B33 C;  3A6N D;  2BYK A;  4Z5T A;  4ZUX B;  3H0M C;  3KXB C;  3REL C;  5AV5 C;  3LZ0 A;  3UTB B;  3UTA D;  5AV6 A;  5B0Y C;  1S32 A;  2YFW B;  1M18 C;  3KUY B;  5JA4 A;  5B31 D;  4J8U D;  3KWQ D;  3KSY A;  3MGS C;  4WU9 C;  3AZM C;  2F8N A;  3LZ1 A;  2J8P A;  1KX5 A;  1T3U A;  3AZG C;  1P3B C;  4UUZ B;  5B2J B;  3B6F D;  5AVB C;  1N1J B;  1ID3 A;  1B67 A;  2G5H C;  2XD5 A;  2FJ7 A;  5FUG B;  2YFV A;  3W96 C;  1P34 B;  3W98 C;  2JE5 A;  5JRG B;  4G92 B;  3AZH A;  4H9P B;  5B0Z C;  4J8W C;  1A7W A;  3REH A;  1P3P A;  1P3M D;  2F8N G;  3LJA D;  5BS7 A;  3IP4 C;  3A6N B;  4UUZ A;  4Z5T C;  5DNM D;  3AN2 A;  4NE5 A;  1P3G D;  4YM6 C;  3C1C D;  3MGQ D;  3UTA B;  3AV1 A;  1U35 A;  4J8V A;  3O62 C;  4AWL C;  5B1L D;  2NQB C;  4HGA B;  4J8U B;  5B31 B;  1JFI B;  1P3A D;  3AZF B;  3W99 A;  1TAF B;  4KHA A;  3LZ1 C;  5DNN C;  4X23 C;  1KX5 C;  1EQZ C;  3H0L C;  1ID3 C;  3UTA A;  2ARO D;  3MGR C;  4J8U A;  3AZH C;  2Y2Q A;  3KWQ A;  2F2A C;  3MNN D;  3FDD A;  3B0B A;  4NE3 A;  3X1T C;  4UPK A;  3REH C;  1P3P C;  1P3M B;  1F66 D;  3LJA B;  3AZE A;  5BS7 C;  3X1U C;  4QLC D;  4Z66 C;  5CPJ D;  3AZI B;  5GT0 B;  3AN2 C;  3B6F A;  1M19 D;  5GXQ C;  3AZK D;  2NZD A;  3AV1 C;  3MGQ B;  5AV8 B;  1U35 C;  2HIO A;  4J8V C;  5B1L B;  2Y2O A;  2PYO D;  1P3A B;  3W99 C;  4H9O B;  2UWX A;  5G49 B;  1P3M A;  1R4V A;  1TZY D;  1M1A D;  5DNM A;  5GSU A;  3C1B C;  3WAA B;  1P3G A;  3AV2 D;  3C1C A;  3MGQ A;  1AOI D;  2ARO B;  4Z2M G;  2IO5 C;  3X1S D;  2CV5 A;  2CWE A;  3KWQ C;  1ZLA A;  1P3A A;  3MNN B;  3F6T A;  5F99 D;  3MGP C;  2DQN C;  3AZE C;  5B32 A;  4QLC B;  1P3F D;  3B6F C;  4YS3 D;  1M19 B;  3AZK B;  2NZD C;  4XUJ A;  2HIO C;  5CPK B;  4M6B A;  5B1M D;  3VH5 T;  1KX3 D;  3MNN A;  1P3L B;  3W97 C;  4ZUX D;  2HUE B;  3H0R C;  3UTB D;  1F66 A;  1TZY B;  5DNM C;  5CPJ A;  5GSU C;  3AZK A;  4XZQ A;  1P3G C;  3REL B;  1AOI B;  3B6G C;  3WA9 A;  3X1S B;  2CV5 C;  1ZLA C;  3AZL D;  2PYO A;  5B2J D;  3AZN D;  4WU9 B;  3AYW D;  5F99 B;  3UT9 D;  5B32 C;  4CAY B;  3AZG B;  1P3F B;  1M1A A;  4YS3 B;  4ZBJ C;  5JRG D;  2ZY3 A;  3NQU B;  4XUJ C;  3AV2 A;  2L5A A;  2BG1 A;  3X1S A;  3W96 B;  1KX3 B;  5B24 B;  4R8P A;  5B0Z B;  1KX4 A;  5F99 A;  3WKJ D;  5E5A C;  1ULY A;  1F66 C;  3X1V B;  5CPJ C;  4XZQ C;  3AZF D;  3WA9 C;  4YM6 B;  4H9S A;  3REI D;  4J8X D;  3O62 B;  2Y2H A;  4NE6 A;  5B1M A;  3AZL B;  1Z2C B;  4H9N B;  2PYO C;  3AZN B;  4ZUX A;  3AYW B;  5DNN B;  4X23 B;  5B2I B;  3UTB A;  3UT9 B;  1HQ3 D;  1M1A C;  2YFW A;  3REK C;  3KUY A;  5BO0 B;  1P3O B;  3TU4 D;  5AY8 D;  5CP6 D;  3EPL A;  3VH6 A;  4JJN D;  4WV4 B;  2RVQ C;  1P3I D;  4KUD D;  4R8P C;  4H9Q B;  5B2J A;  3AZN A;  3AZI D;  3AYW A;  5GT0 D;  1N1J A;  1KX4 C;  4E44 A;  3WKJ B;  3LZ0 C;  5AV9 B;  3UT9 A;  3A1K A;  5AV6 C;  5AV8 D;  4DQY B;  1S32 C;  5FUG A;  1P34 A;  5JRG A;  4H9P A;  3VH6 W;  4EO5 C;  3REI B;  1WWI A;  4J8X B;  5B1M C;  3A6N A;  5BT1 D;  5B40 D;  3MVD B;  3B0D B;  2Y2M A;  3WAA D;  3UTB C;  1HQ3 B;  2FJ7 C;  3KUY C;  3TU4 B;  5B31 A;  1JFI A;  5CP6 B;  5AY8 B;  3C1B B;  3AZF A;  1TAF A;  3AFA B;  4JJN B;  3REJ D;  3REI A;  4J8X A;  1P3I B;  2BYM B;  4KUD B;  5B2J C;  2Y2K A;  3WTP B;  3MGP B;  2Y2G A;  5GT3 B;  1P34 C;  5JRG C;  4G92 C;  3TU4 A;  5CPI B;  5CPK D;  1P3L D;  3AZJ D;  1BH8 B;  4JJN A;  5AVC D;  5B31 G;  1P3I A;  2BYM A;  3LJA A;  4KUD A;  3A6N C;  4LD9 D;  2Y2I A;  5B40 B;  5B33 D;  3AZI A;  5GT0 A;  3W97 B;  1P3K B;  3KXB D;  4KGC B;  3REL D;  3UTA C;  5AV5 D;  5AV8 A;  5B0Y D;  5B1L A;  4J8U C;  5B31 C;  1M18 D;  3AZF C;  4WU8 B;  3MGS D;  4H9O A;  4WU9 D;  3AZM D;  3LEL B;  5G49 A;  3REJ B;  3AZG D;  1P3B D;  5AVB D;  2VQR A;  3WAA A;  4G91 B;  2ARO A;  2JCH A;  3VH5 W;  3W98 D;  3W96 D;  5B24 D;  3AZJ B;  5B0Z D;  5AVC B;  3REJ A;  5C3I B;  1P3M C;  3LJA C;  4LD9 B;  4QLC A;  5B33 B;  3AZI C;  3X1V D;  4Z5T D;  1M19 A;  3V9R B;  3KXB B;  3C1C C;  3MGQ C;  4WJ3 C;  5AV5 B;  4YM6 D;  5AV8 C;  5B0Y B;  5B1L C;  5BNX B;  3O62 D;  5CPK A;  3B0C W;  1M18 B;  1P3A C;  2NQB D;  1P3L A;  3MGS B;  3AZM B;  5AVC A;  3R45 B;  3LZ1 D;  2ZM5 A;  5DNN D;  2Y2P A;  4X23 D;  1BFM A;  5B2I D;  1KX5 D;  1EQZ D;  1TZY A;  4LD9 A;  5KDM B;  1P3B B;  2JSS A;  5B33 A;  1P3O D;  5AVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...