4CAYA

Crystal structure of a human anp32e-h2a.z-h2b complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
86
Chain Sequence
SRSQRAGLQFPVGRIHRHLKSRGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HISTONE H2A.Z
publication title Anp32E is a Histone Chaperone that Removes H2A.Z from Chromatin
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 86
sequence length 90
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4cayA00
3X1SA 1M18C 2NZDC 3MVDC 5GT3A 4R8PC 3LZ1A 4KUDB 5B31G 1P3BD 5B24A 4KUDC 3REJD 1P34D 5B32A 4H9PB 1N1JB 3AFAD 5GSUB 3AZGA 3UT9D 5GSUC 5DNMD 4ZUXD 3KXBA 3C1BB 5AV5A 1KX4B 1KX4C 4KGCD 3REIB 3W96B 5CP6D 3AYWB 3NQUB 3LZ0A 3MGRA 5B31C 3REIC 3X1UB 3AYWC 3MGPB 1TZYB 1WWSA 1P3LB 4WNNB 5B1LB 5KDMA 3X1UC 1TZYC 1P3LC 1F1EA 3WAAA 2PYOA 4EO5B 4EO5C 2YFWB 1U35B 3AN2B 4J8XD 3LJAB 1HQ3D 3B0BA 1U35C 3AN2C 4J8UD 5B32G 3WA9B 4YS3B 5B1MC 3AZFB 4YS3C 3X1SB 3AZFC 4WU9A 3AV2B 3X1SC 5AVBA 4J8VD 3R45A 5GT3C 3LZ1C 5B24C 4WU8B 3B6FA 1P3MA 3UTBA 5B32C 5JRGA 3AZGC 3KXBB 3KXBC 1F66A 5AV5C 1M18D 2NZDD 5AVCA 3MVDD 3LZ0B 3LZ0C 3MGRC 5KDMB 1P34A 3O62D 3WAAB 5CPJA 3W99B 3WAAC 3AFAA 5GSUD 2PYOC 4NE5A 3UT9A 5DNMA 1KX4D 3C1BD 3W97D 1P3FD 4KGCA 5B2JA 3REID 3W96D 3VH5T 5CP6A 3AYWD 1P3AD 3X1UD 3MGPD 5GT0A 5B1LD 2JSSA 3VH5W 1KX3D 4WU9B 5AVBB 3R45B 4WU9C 5AVBC 4DRAA 1U35D 3AN2D 3B6FB 5CHLB 4Z2MG 3LJAD 1HQ3A 1P3MB 3UTBB 3B6FC 5JRGB 1TAFA 1P3MC 3UTBC 5JRGC 3WA9D 5JA4A 1F66B 5B40B 3AZID 1F66C 3X1SD 1ID3D 5AVCC 3AV2D 3V9RA 1H3OA 4Z66D 5BT1C 5B2IB 5CPID 2YFVB 4WU8D 1P34B 4Z2MH 5CPJB 5CPKA 1P34C 3AFAB 5CPJC 4UUZA 3UT9B 3AFAC 5DNMB 3UT9C 5DNMC 4KGCB 2CWEA 5B2JB 2HIOD 4CSRA 4KGCC 5B2JC 5CP6C 5GT0B 4NFTA 1BH8B 5BS7A 5GT0C 3O62A 5B0YA 3W99D 3C1BA 5AV6D 3W97A 1P3FA 1HQ3B 4DRBA 4J8WA 1HQ3C 1TAFB 3W96A 1P3AA 4H9SA 5JA4B 3MGPA 5B1LA 1KX3A 3V9RB 3B6FD 1BH9A 5FUGB 3LJAA 5CPKB 5JRGD 4UUZB 5CPKC 3WA9A 1F66D 1M1AA 4CSRB 5B40D 3AZIA 1ID3A 4H9OA 3AV2A 5BT1D 4Z66A 4XUJB 5B2ID 5CPIA 4WU8A 3MGSA 5BS7C 3O62B 5B0YB 5CPJD 3O62C 5B0YC 3W97B 1P3FB 3WTPB 3C1BC 5B2JD 3W97C 2HIOA 4J8WB 1P3FC 1P3AB 4J8WC 3W96C 5B33D 1P3AC 4H9SC 5GT0D 3MGPC 5B1LC 1KX3B 2BYMA 3W99A 1P3IA 1KX3C 1EQZA 3AZNB 5AV6A 1BH9B 3LJAC 4G92B 5AY8B 4NE6A 1M1AB 4G92C 3NQJA 3WA9C 1M1AC 3AZIB 1ID3B 4H9OB 3AZIC 3UTAD 1ID3C 4Z66B 3AZJD 3AV2C 4Z66C 5CPIB 2FJ7D 4E44A 3MGSB 5CPIC 3MGSC 4WU8C 5CPKD 2F8NK 3AZMA 4JJNA 2HIOB 4X23A 5B40A 1P3KD 3WTPE 2HIOC 3AZHB 5GXQD 4CAYA 4XUJD 5B2IA 2F8ND 2YFVA 3B0DB 5B0YD 2BYMB 3B0DC 1P3IB 1EQZB 3W99C 1P3IC 1AOID 1EQZC 5AV6B 3WTPD 5AV6C 4G91B 4J8WD 4G91C 5B33A 3NQJB 1BH8A 5E5AD 4ZBJB 2RVQD 4ZBJC 3AZKA 3AZND 1ZLAD 3AZMB 5B0ZD 4JJNB 3AZMC 4JJNC 5G49A 5AY8D 1M1AD 4Z5TD 4X23B 4X23C 3MNNA 5B40C 4CAYB 3UTAA 3AZJA 1ULYA 2FJ7A 3MGSD 5B2IC 5FUGA 3TU4A 3LELD 1P3KA 3AZHD 2AROA 1KU5A 5B33B 5GXQA 3KUYA 2CV5A 4XUJA 5B33C 4XZQA 2F8NA 1P3ID 1EQZD 1AOIA 3AZKB 3A6NA 3AZKC 3WTPA 3X1TD 1R4VA 5G49B 3W98A 1HTAA 2NQBD 2LY8A 5E5AA 1S32D 3MNNB 5DNNB 4WV4B 3UTAB 3MNNC 3AZJB 3UTAC 2FJ7B 3AZJC 3AZNA 3AV1D 1ZLAA 2FJ7C 3KWQA 3AZMD 4JJND 5B0ZA 1M19A 3TU4B 2F8NG 3TU4C 1P3OD 5AY8A 4X23D 4Z5TA 1WWIA 5AV8A 1P3KB 2AROB 3KUYB 5GXQB 3REKA 2CV5B 1P3GB 1P3KC 1KX5A 2AROC 3KUYC 5GXQC 3B0CT 4XZQB 3X1VD 2CV5C 4LD9B 4XUJC 2F8NB 4XZQC 3RELA 3B0CW 4YM6B 2F8NH 4HGAB 1AOIB 3AZED 4HGAC 3A6NB 1AOIC 5BNXB 3REHB 3A6NC 3WTPC 3LELA 3AZHA 1JFIB 3W98B 3W98C 5E5AB 5E5AC 4R8PB 2RVQC 3AZKD 1ZLAB 5AV9D 3AZNC 1ZLAC 3KWQB 3WKJA 3X1TA 5B0ZB 1M19B 3KWQC 5B0ZC 1M19C 3AZLD 1P3PD 2NQBA 5BO0B 4Z5TB 5AY8C 2BYKA 5AV8B 3MNND 4Z5TC 5DNND 1S32A 5B31B 5AV8C 3REKB 1KX5B 4NE3A 3REKC 1KX5C 3AV1A 3RELB 4QLCD 3RELC 3TU4D 1P3OA 3LELB 2AROD 3KUYD 3LELC 2CV5D 1P3GD 3B6GA 3AZHC 4LD9D 3X1VA 4XZQD 5B1MB 4YM6D 5GT3B 3LZ1B 3AZEA 5B24B 3A6ND 3MGQD 3REHD 5B32B 3X1TB 3WKJB 1A7WA 3X1TC 3WKJC 3AZGB 3W98D 2NQBB 5AV5B 2NQBC 5F99A 3C1CD 2BYKB 4H9NA 1S32B 1S32C 4R8PD 3MGRB 4KUDD 3AV1B 1P3BA 3REJA 5AV9A 3AV1C 3KWQD 1M19D 2PYOB 3AZLA 1P3OB 1P3PA 4ZUXA 1P3OC 2HUEB 5AV8D 4KHAA 2HUEC 5DNNA 5B31D 3REKD 4WZSB 1KX5D 3B6GB 3X1VB 3B6GC 1TZYD 3X1VC 1P3LD 3RELD 1B67A 4QLCA 1B6WA 4M6BA 2L5AA 3AZEB 1BFMA 3AZEC 4J8XA 3VH5A 4J8UA 1P3GA 4LD9A 5B1MD 5F99B 4YS3D 4H9NB 4H9RA 3AZFD 5F99C 3VH6T 5AVCB 4YM6A 5GT3D 3LZ1D 4J8VA 1P3BB 3VH6W 5B24D 3REJB 5BNXA 5AV9B 3MGQA 3REHA 1P3BC 3REJC 3KSYA 5B32D 5AV9C 4H9QA 4E45A 3WKJD 2IO5B 1JFIA 3AZGD 5BNVA 3AZLB 1P3PB 2IO5C 3KXBD 4ZUXB 3AZLC 5AV5D 1P3PC 3C1CA 3VH6A 4ZUXC 1M18A 4KHAB 2NZDA 5CP6B 3LZ0D 4R8PA 5DNNC 3MVDA 3MGRD 4KUDA 4AWLB 4QLCB 3WAAD 4AWLC 4H9PA 4QLCC 2PYOD 1N1JA 5GSUA 1KX4A 5BO0A 4J8XB 4J8XC 3REIA 5B31A 4J8UB 3B6GD 3AYWA 3NQUA 4J8UC 1P3GC 3X1UA 4LD9C 1TZYA 1P3LA 4H9RB 4WNNA 4WU9D 5AVBD 4YM6C 4J8VB 1H3OB 1Q9CA 4J8VC 2YFWA 3MGQB 1U35A 3AN2A 3MGQC 3REHC 4H9QB 1P3MD 1M18B 3UTBD 5BNVB 5C3IB 5B1MA 5F99D 3C1CB 5C3IC 4YS3A 3AZFA 3C1CC 2NZDB 5AVCD 3MVDB
chains in the Genus database with same CATH superfamily
3X1SA 1M18C 2NZDC 3MVDC 5GT3A 4R8PC 3LZ1A 4KUDB 5B31G 1P3BD 5B24A 4KUDC 3REJD 1P34D 5B32A 4H9PB 1N1JB 3AFAD 5GSUB 2JCHA 3AZGA 3UT9D 5GSUC 5DNMD 4ZUXD 3KXBA 3C1BB 5AV5A 1KX4B 1KX4C 4KGCD 2G5HC 3REIB 3W96B 5CP6D 3AYWB 3NQUB 3LZ0A 3MGRA 5B31C 3REIC 3X1UB 3AYWC 3MGPB 1TZYB 1WWSA 1P3LB 4WNNB 5B1LB 3A1KA 5KDMA 1TZYC 3X1UC 1P3LC 1F1EA 3WAAA 2PYOA 4EO5B 4EO5C 2YFWB 1Z2CB 2FFFB 1U35B 2Y2PA 4J8XD 3LJAB 3AN2B 1HQ3D 2DF4C 3B0BA 1U35C 3AN2C 4J8UD 5B32G 3WA9B 4YS3B 5B1MC 3AZFB 4YS3C 3X1SB 3AZFC 4WU9A 3AV2B 3X1SC 5AVBA 2ZY4A 4J8VD 3R45A 2Y2GA 5GT3C 3LZ1C 5B24C 4WU8B 3B6FA 1P3MA 3UTBA 5B32C 5JRGA 3AZGC 3KXBB 3KXBC 1F66A 5AV5C 1M18D 2NZDD 5AVCA 3MVDD 3LZ0B 3LZ0C 3MGRC 2UWXA 5KDMB 1P34A 3O62D 3WAAB 5CPJA 3W99B 3WAAC 3AFAA 5GSUD 2PYOC 4NE5A 3UT9A 5DNMA 1KX4D 3C1BD 3W97D 1P3FD 2Y2MA 4KGCA 5B2JA 3REID 3W96D 3VH5T 5CP6A 3AYWD 1P3AD 3X1UD 3MGPD 5GT0A 5B1LD 2JSSA 2Y2LA 3VH5W 1KX3D 4WU9B 5AVBB 3R45B 4WU9C 5AVBC 4DRAA 1U35D 3AN2D 3B6FB 5CHLB 4Z2MG 3IP4C 1HQ3A 3LJAD 3UTBB 1P3MB 3B6FC 5JRGB 1TAFA 1P3MC 3UTBC 5JRGC 2Y2IA 3WA9D 5JA4A 1F66B 5B40B 3AZID 1F66C 3X1SD 1ID3D 5AVCC 3AV2D 3V9RA 1H3OA 4Z66D 5BT1C 5B2IB 3F6TA 5CPID 2W8SA 2YFVB 4WU8D 1P34B 4Z2MH 5CPJB 5CPKA 1P34C 3AFAB 5CPJC 4UUZA 3UT9B 3AFAC 5DNMB 3UT9C 5DNMC 4KGCB 2CWEA 5B2JB 2HIOD 4CSRA 3KFUG 4KGCC 5B2JC 5CP6C 2Y2NA 5GT0B 4NFTA 1BH8B 5BS7A 5GT0C 3O62A 5B0YA 3W99D 3C1BA 1T3UA 3W97A 5AV6D 1P3FA 1HQ3B 4DRBA 4J8WA 1HQ3C 1TAFB 3W96A 1P3AA 4H9SA 5JA4B 3MGPA 5B1LA 2RIQA 3FDDA 1KX3A 3V9RB 1W2EA 3B6FD 1BH9A 5FUGB 3LJAA 5CPKB 5JRGD 4UUZB 5CPKC 3WA9A 2JE5A 1M1AA 1F66D 4CSRB 2ZY2A 2ZY5A 5B40D 3AZIA 1ID3A 4H9OA 3AV2A 2G5IC 5BT1D 4Z66A 4XUJB 5B2ID 3A1IA 5CPIA 2ZM5A 4WU8A 3MGSA 5BS7C 3O62B 5B0YB 5CPJD 3O62C 5B0YC 3W97B 1P3FB 3WTPB 3C1BC 5B2JD 3W97C 2HIOA 3P5JB 4J8WB 1P3FC 4DQYB 1P3AB 4J8WC 3W96C 5B33D 1P3AC 4H9SC 5GT0D 3MGPC 5B1LC 1KX3B 2BYMA 3W99A 1P3IA 1KX3C 1EQZA 3AZNB 5AV6A 1BH9B 3EPJA 3LJAC 4G92B 5AY8B 4NE6A 1M1AB 4G92C 3NQJA 3WA9C 1M1AC 3AZIB 1ID3B 4H9OB 3AZIC 3UTAD 1ID3C 4Z66B 3AZJD 3AV2C 4Z66C 5CPIB 2FJ7D 4E44A 3MGSB 5CPIC 3MGSC 4WU8C 5CPKD 2F8NK 3AZMA 4JJNA 2DQNC 3H0RC 2Y2HA 2HIOB 4X23A 5B40A 1P3KD 3WTPE 2HIOC 3AZHB 5GXQD 4CAYA 4XUJD 5B2IA 2F8ND 2YFVA 3B0DB 5B0YD 2BYMB 3B0DC 1P3IB 1EQZB 3W99C 1P3IC 1AOID 1EQZC 5AV6B 3WTPD 5AV6C 4G91B 4J8WD 3H0LC 2Y2QA 4G91C 5B33A 3NQJB 1BH8A 5E5AD 4ZBJB 2RVQD 4ZBJC 3AZKA 3AZND 1ZLAD 3AZMB 5B0ZD 4JJNB 3AZMC 4JJNC 5G49A 5AY8D 1M1AD 4Z5TD 4X23B 4X23C 3MNNA 5B40C 4CAYB 3UTAA 3AZJA 1ULYA 2FJ7A 3MGSD 5B2IC 2BG1A 5FUGA 3TU4A 3LELD 1P3KA 3AZHD 2AROA 1KU5A 5B33B 5GXQA 3KUYA 2CV5A 4XUJA 5B33C 4XZQA 2F8NA 1P3ID 1EQZD 1AOIA 3AZKB 3A6NA 3AZKC 3WTPA 3X1TD 1R4VA 5G49B 3W98A 1HTAA 2NQBD 2LY8A 5E5AA 1S32D 3MNNB 5DNNB 4WV4B 3UTAB 3MNNC 3AZJB 3UTAC 2FJ7B 3AZJC 3AZNA 3AV1D 1ZLAA 2FJ7C 3KWQA 3AZMD 2Y2JA 5B0ZA 4JJND 3TU4B 1M19A 2F8NG 3TU4C 1P3OD 5AY8A 4X23D 4Z5TA 1WWIA 5AV8A 2J8PA 1P3KB 2AROB 3KUYB 5GXQB 3REKA 2CV5B 1P3GB 1P3KC 1KX5A 2AROC 3KUYC 5GXQC 3B0CT 4XZQB 3X1VD 2CV5C 4LD9B 4XUJC 2F8NB 4XZQC 3RELA 3B0CW 4YM6B 1PZRA 2F8NH 4HGAB 1AOIB 3AZED 4HGAC 3A6NB 1AOIC 5BNXB 3REHB 3A6NC 3AL0C 3WTPC 3LELA 3AZHA 1JFIB 3W98B 3W98C 5E5AB 5E5AC 3EPLA 4R8PB 2RVQC 3AZKD 1ZLAB 5AV9D 3AZNC 1ZLAC 3KWQB 3WKJA 3X1TA 5B0ZB 1M19B 3KWQC 5B0ZC 1M19C 3AZLD 1P3PD 2NQBA 5BO0B 4Z5TB 5AY8C 2BYKA 5AV8B 3MNND 4Z5TC 5DNND 1S32A 5B31B 5AV8C 3REKB 1KX5B 4NE3A 3REKC 1KX5C 3AV1A 3RELB 4QLCD 3RELC 3TU4D 3EG5B 1P3OA 3LELB 2AROD 3KUYD 3LELC 2CV5D 1P3GD 3B6GA 3AZHC 4LD9D 3X1VA 4XZQD 5B1MB 4UPKA 4YM6D 5GT3B 3LZ1B 3AZEA 5B24B 3A6ND 3MGQD 3REHD 3EPKA 5B32B 3X1TB 3WKJB 1A7WA 3X1TC 3WKJC 3AZGB 3H0MC 3W98D 2NQBB 5AV5B 2NQBC 5F99A 3C1CD 2BYKB 4H9NA 1S32B 1S32C 4R8PD 3MGRB 4KUDD 3AV1B 1P3BA 3REJA 5AV9A 3AV1C 2VQRA 3KWQD 1M19D 2PYOB 3AZLA 1P3OB 1P3PA 4ZUXA 1P3OC 2HUEB 5AV8D 4KHAA 2HUEC 5DNNA 5B31D 3REKD 4WZSB 1KX5D 3B6GB 3X1VB 3B6GC 1TZYD 3X1VC 1P3LD 3RELD 1B67A 4QLCA 1B6WA 4M6BA 2L5AA 3AZEB 1BFMA 3AZEC 4J8XA 3VH5A 4J8UA 1P3GA 4LD9A 5B1MD 5F99B 4YS3D 4H9NB 2Y2OA 4H9RA 3AZFD 5F99C 3VH6T 5AVCB 4YM6A 5GT3D 3LZ1D 4J8VA 1P3BB 3VH6W 5B24D 3REJB 5BNXA 5AV9B 3MGQA 3REHA 1P3BC 3REJC 5AV9C 3KSYA 5B32D 4H9QA 4E45A 3WKJD 2IO5B 1JFIA 3AZGD 5BNVA 3AZLB 1P3PB 2IO5C 2Y2KA 3KXBD 4ZUXB 3AZLC 5AV5D 1P3PC 3C1CA 3VH6A 4ZUXC 1M18A 4KHAB 2NZDA 5CP6B 3LZ0D 4R8PA 5DNNC 3MVDA 3MGRD 4KUDA 4AWLB 4QLCB 3WAAD 4AWLC 4H9PA 4QLCC 2PYOD 4WJ3C 1N1JA 5GSUA 2F2AC 1KX4A 5BO0A 4J8XB 4J8XC 3REIA 5B31A 4J8UB 3B6GD 3AYWA 3NQUA 2ZY3A 4J8UC 1P3GC 3X1UA 4LD9C 1TZYA 1P3LA 4H9RB 4WNNA 4WU9D 5AVBD 4YM6C 4J8VB 1H3OB 1Q9CA 4J8VC 2XD1A 2YFWA 3MGQB 1U35A 3AN2A 3MGQC 3REHC 4H9QB 1P3MD 1M18B 3UTBD 2XD5A 5BNVB 5C3IB 5B1MA 3EPHA 5F99D 3C1CB 5C3IC 4YS3A 3AZFA 3C1CC 2NZDB 5AVCD 3MVDB
chains in the Genus database with same CATH topology
3X1SA 1M18C 2NZDC 3MVDC 5GT3A 4R8PC 3LZ1A 4KUDB 5B31G 1P3BD 5B24A 4KUDC 3REJD 1P34D 5B32A 4H9PB 1N1JB 3AFAD 5GSUB 2JCHA 3AZGA 3UT9D 5GSUC 5DNMD 4ZUXD 3KXBA 3C1BB 5AV5A 1KX4B 1KX4C 4KGCD 2G5HC 3REIB 3W96B 5CP6D 3AYWB 3NQUB 3LZ0A 3MGRA 5B31C 3REIC 3X1UB 3AYWC 3MGPB 1TZYB 1WWSA 1P3LB 4WNNB 5B1LB 3A1KA 5KDMA 1TZYC 3X1UC 1P3LC 1F1EA 3WAAA 2PYOA 4EO5B 4EO5C 2YFWB 1Z2CB 2FFFB 1U35B 2Y2PA 4J8XD 3LJAB 3AN2B 1HQ3D 2DF4C 3B0BA 1U35C 3AN2C 4J8UD 5B32G 3WA9B 4YS3B 5B1MC 3AZFB 4YS3C 3X1SB 3AZFC 4WU9A 3AV2B 3X1SC 5AVBA 2ZY4A 4J8VD 3R45A 2Y2GA 5GT3C 3LZ1C 5B24C 4WU8B 3B6FA 1P3MA 3UTBA 5B32C 5JRGA 3AZGC 3KXBB 3KXBC 1F66A 5AV5C 1M18D 2NZDD 5AVCA 3MVDD 3LZ0B 3LZ0C 3MGRC 2UWXA 5KDMB 1P34A 3O62D 3WAAB 5CPJA 3W99B 3WAAC 3AFAA 5GSUD 2PYOC 4NE5A 3UT9A 5DNMA 1KX4D 3C1BD 3W97D 1P3FD 2Y2MA 4KGCA 5B2JA 3REID 3W96D 3VH5T 5CP6A 3AYWD 1P3AD 3X1UD 3MGPD 5GT0A 5B1LD 2JSSA 2Y2LA 3VH5W 1KX3D 4WU9B 5AVBB 3R45B 4WU9C 5AVBC 4DRAA 1U35D 3AN2D 3B6FB 5CHLB 4Z2MG 3IP4C 1HQ3A 3LJAD 3UTBB 1P3MB 3B6FC 5JRGB 1TAFA 1P3MC 3UTBC 5JRGC 2Y2IA 3WA9D 5JA4A 1F66B 5B40B 3AZID 1F66C 3X1SD 1ID3D 5AVCC 3AV2D 3V9RA 1H3OA 4Z66D 5BT1C 5B2IB 3F6TA 5CPID 2W8SA 2YFVB 4WU8D 1P34B 4Z2MH 5CPJB 5CPKA 1P34C 3AFAB 5CPJC 4UUZA 3UT9B 3AFAC 5DNMB 3UT9C 5DNMC 4KGCB 2CWEA 5B2JB 2HIOD 4CSRA 3KFUG 4KGCC 5B2JC 5CP6C 2Y2NA 5GT0B 4NFTA 1BH8B 5BS7A 5GT0C 3O62A 5B0YA 3W99D 3C1BA 1T3UA 3W97A 5AV6D 1P3FA 1HQ3B 4DRBA 4J8WA 1HQ3C 1TAFB 3W96A 1P3AA 4H9SA 5JA4B 3MGPA 5B1LA 2RIQA 3FDDA 1KX3A 3V9RB 1W2EA 3B6FD 1BH9A 5FUGB 3LJAA 5CPKB 5JRGD 4UUZB 5CPKC 3WA9A 2JE5A 1M1AA 1F66D 4CSRB 2ZY2A 2ZY5A 5B40D 3AZIA 1ID3A 4H9OA 3AV2A 2G5IC 5BT1D 4Z66A 4XUJB 5B2ID 3A1IA 5CPIA 2ZM5A 4WU8A 3MGSA 5BS7C 3O62B 5B0YB 5CPJD 3O62C 5B0YC 3W97B 1P3FB 3WTPB 3C1BC 5B2JD 3W97C 2HIOA 3P5JB 4J8WB 1P3FC 4DQYB 1P3AB 4J8WC 3W96C 5B33D 1P3AC 4H9SC 5GT0D 3MGPC 5B1LC 1KX3B 2BYMA 3W99A 1P3IA 1KX3C 1EQZA 3AZNB 5AV6A 1BH9B 3EPJA 3LJAC 4G92B 5AY8B 4NE6A 1M1AB 4G92C 3NQJA 3WA9C 1M1AC 3AZIB 1ID3B 4H9OB 3AZIC 3UTAD 1ID3C 4Z66B 3AZJD 3AV2C 4Z66C 5CPIB 2FJ7D 4E44A 3MGSB 5CPIC 3MGSC 4WU8C 5CPKD 2F8NK 3AZMA 4JJNA 2DQNC 3H0RC 2Y2HA 2HIOB 4X23A 5B40A 1P3KD 3WTPE 2HIOC 3AZHB 5GXQD 4CAYA 4XUJD 5B2IA 2F8ND 2YFVA 3B0DB 5B0YD 2BYMB 3B0DC 1P3IB 1EQZB 3W99C 1P3IC 1AOID 1EQZC 5AV6B 3WTPD 5AV6C 4G91B 4J8WD 3H0LC 2Y2QA 4G91C 5B33A 3NQJB 1BH8A 5E5AD 4ZBJB 2RVQD 4ZBJC 3AZKA 3AZND 1ZLAD 3AZMB 5B0ZD 4JJNB 3AZMC 4JJNC 5G49A 5AY8D 1M1AD 4Z5TD 4X23B 4X23C 3MNNA 5B40C 4CAYB 3UTAA 3AZJA 1ULYA 2FJ7A 3MGSD 5B2IC 2BG1A 5FUGA 3TU4A 3LELD 1P3KA 3AZHD 2AROA 1KU5A 5B33B 5GXQA 3KUYA 2CV5A 4XUJA 5B33C 4XZQA 2F8NA 1P3ID 1EQZD 1AOIA 3AZKB 3A6NA 3AZKC 3WTPA 3X1TD 1R4VA 5G49B 3W98A 1HTAA 2NQBD 2LY8A 5E5AA 1S32D 3MNNB 5DNNB 4WV4B 3UTAB 3MNNC 3AZJB 3UTAC 2FJ7B 3AZJC 3AZNA 3AV1D 1ZLAA 2FJ7C 3KWQA 3AZMD 2Y2JA 5B0ZA 4JJND 3TU4B 1M19A 2F8NG 3TU4C 1P3OD 5AY8A 4X23D 4Z5TA 1WWIA 5AV8A 2J8PA 1P3KB 2AROB 3KUYB 5GXQB 3REKA 2CV5B 1P3GB 1P3KC 1KX5A 2AROC 3KUYC 5GXQC 3B0CT 4XZQB 3X1VD 2CV5C 4LD9B 4XUJC 2F8NB 4XZQC 3RELA 3B0CW 4YM6B 1PZRA 2F8NH 4HGAB 1AOIB 3AZED 4HGAC 3A6NB 1AOIC 5BNXB 3REHB 3A6NC 3AL0C 3WTPC 3LELA 3AZHA 1JFIB 3W98B 3W98C 5E5AB 5E5AC 3EPLA 4R8PB 2RVQC 3AZKD 1ZLAB 5AV9D 3AZNC 1ZLAC 3KWQB 3WKJA 3X1TA 5B0ZB 1M19B 3KWQC 5B0ZC 1M19C 3AZLD 1P3PD 2NQBA 5BO0B 4Z5TB 5AY8C 2BYKA 5AV8B 3MNND 4Z5TC 5DNND 1S32A 5B31B 5AV8C 3REKB 1KX5B 4NE3A 3REKC 1KX5C 3AV1A 3RELB 4QLCD 3RELC 3TU4D 3EG5B 1P3OA 3LELB 2AROD 3KUYD 3LELC 2CV5D 1P3GD 3B6GA 3AZHC 4LD9D 3X1VA 4XZQD 5B1MB 4UPKA 4YM6D 5GT3B 3LZ1B 3AZEA 5B24B 3A6ND 3MGQD 3REHD 3EPKA 5B32B 3X1TB 3WKJB 1A7WA 3X1TC 3WKJC 3AZGB 3H0MC 3W98D 2NQBB 5AV5B 2NQBC 5F99A 3C1CD 2BYKB 4H9NA 1S32B 1S32C 4R8PD 3MGRB 4KUDD 3AV1B 1P3BA 3REJA 5AV9A 3AV1C 2VQRA 3KWQD 1M19D 2PYOB 3AZLA 1P3OB 1P3PA 4ZUXA 1P3OC 2HUEB 5AV8D 4KHAA 2HUEC 5DNNA 5B31D 3REKD 4WZSB 1KX5D 3B6GB 3X1VB 3B6GC 1TZYD 3X1VC 1P3LD 3RELD 1B67A 4QLCA 1B6WA 4M6BA 2L5AA 3AZEB 1BFMA 3AZEC 4J8XA 3VH5A 4J8UA 1P3GA 4LD9A 5B1MD 5F99B 4YS3D 4H9NB 2Y2OA 4H9RA 3AZFD 5F99C 3VH6T 5AVCB 4YM6A 5GT3D 3LZ1D 4J8VA 1P3BB 3VH6W 5B24D 3REJB 5BNXA 5AV9B 3MGQA 3REHA 1P3BC 3REJC 5AV9C 3KSYA 5B32D 4H9QA 4E45A 3WKJD 2IO5B 1JFIA 3AZGD 5BNVA 3AZLB 1P3PB 2IO5C 2Y2KA 3KXBD 4ZUXB 3AZLC 5AV5D 1P3PC 3C1CA 3VH6A 4ZUXC 1M18A 4KHAB 2NZDA 5CP6B 3LZ0D 4R8PA 5DNNC 3MVDA 3MGRD 4KUDA 4AWLB 4QLCB 3WAAD 4AWLC 4H9PA 4QLCC 2PYOD 4WJ3C 1N1JA 5GSUA 2F2AC 1KX4A 5BO0A 4J8XB 4J8XC 3REIA 5B31A 4J8UB 3B6GD 3AYWA 3NQUA 2ZY3A 4J8UC 1P3GC 3X1UA 4LD9C 1TZYA 1P3LA 4H9RB 4WNNA 4WU9D 5AVBD 4YM6C 4J8VB 1H3OB 1Q9CA 4J8VC 2XD1A 2YFWA 3MGQB 1U35A 3AN2A 3MGQC 3REHC 4H9QB 1P3MD 1M18B 3UTBD 2XD5A 5BNVB 5C3IB 5B1MA 3EPHA 5F99D 3C1CB 5C3IC 4YS3A 3AZFA 3C1CC 2NZDB 5AVCD 3MVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S A;  1M18 C;  2NZD C;  3MVD C;  5GT3 A;  4R8P C;  3LZ1 A;  4KUD B;  5B31 G;  1P3B D;  5B24 A;  4KUD C;  3REJ D;  1P34 D;  5B32 A;  4H9P B;  1N1J B;  3AFA D;  5GSU B;  3AZG A;  3UT9 D;  5GSU C;  5DNM D;  4ZUX D;  3KXB A;  3C1B B;  5AV5 A;  1KX4 B;  1KX4 C;  4KGC D;  3REI B;  3W96 B;  5CP6 D;  3AYW B;  3NQU B;  3LZ0 A;  3MGR A;  5B31 C;  3REI C;  3X1U B;  3AYW C;  3MGP B;  1TZY B;  1WWS A;  1P3L B;  4WNN B;  5B1L B;  5KDM A;  3X1U C;  1TZY C;  1P3L C;  1F1E A;  3WAA A;  2PYO A;  4EO5 B;  4EO5 C;  2YFW B;  1U35 B;  3AN2 B;  4J8X D;  3LJA B;  1HQ3 D;  3B0B A;  1U35 C;  3AN2 C;  4J8U D;  5B32 G;  3WA9 B;  4YS3 B;  5B1M C;  3AZF B;  4YS3 C;  3X1S B;  3AZF C;  4WU9 A;  3AV2 B;  3X1S C;  5AVB A;  4J8V D;  3R45 A;  5GT3 C;  3LZ1 C;  5B24 C;  4WU8 B;  3B6F A;  1P3M A;  3UTB A;  5B32 C;  5JRG A;  3AZG C;  3KXB B;  3KXB C;  1F66 A;  5AV5 C;  1M18 D;  2NZD D;  5AVC A;  3MVD D;  3LZ0 B;  3LZ0 C;  3MGR C;  5KDM B;  1P34 A;  3O62 D;  3WAA B;  5CPJ A;  3W99 B;  3WAA C;  3AFA A;  5GSU D;  2PYO C;  4NE5 A;  3UT9 A;  5DNM A;  1KX4 D;  3C1B D;  3W97 D;  1P3F D;  4KGC A;  5B2J A;  3REI D;  3W96 D;  3VH5 T;  5CP6 A;  3AYW D;  1P3A D;  3X1U D;  3MGP D;  5GT0 A;  5B1L D;  2JSS A;  3VH5 W;  1KX3 D;  4WU9 B;  5AVB B;  3R45 B;  4WU9 C;  5AVB C;  4DRA A;  1U35 D;  3AN2 D;  3B6F B;  5CHL B;  4Z2M G;  3LJA D;  1HQ3 A;  1P3M B;  3UTB B;  3B6F C;  5JRG B;  1TAF A;  1P3M C;  3UTB C;  5JRG C;  3WA9 D;  5JA4 A;  1F66 B;  5B40 B;  3AZI D;  1F66 C;  3X1S D;  1ID3 D;  5AVC C;  3AV2 D;  3V9R A;  1H3O A;  4Z66 D;  5BT1 C;  5B2I B;  5CPI D;  2YFV B;  4WU8 D;  1P34 B;  4Z2M H;  5CPJ B;  5CPK A;  1P34 C;  3AFA B;  5CPJ C;  4UUZ A;  3UT9 B;  3AFA C;  5DNM B;  3UT9 C;  5DNM C;  4KGC B;  2CWE A;  5B2J B;  2HIO D;  4CSR A;  4KGC C;  5B2J C;  5CP6 C;  5GT0 B;  4NFT A;  1BH8 B;  5BS7 A;  5GT0 C;  3O62 A;  5B0Y A;  3W99 D;  3C1B A;  5AV6 D;  3W97 A;  1P3F A;  1HQ3 B;  4DRB A;  4J8W A;  1HQ3 C;  1TAF B;  3W96 A;  1P3A A;  4H9S A;  5JA4 B;  3MGP A;  5B1L A;  1KX3 A;  3V9R B;  3B6F D;  1BH9 A;  5FUG B;  3LJA A;  5CPK B;  5JRG D;  4UUZ B;  5CPK C;  3WA9 A;  1F66 D;  1M1A A;  4CSR B;  5B40 D;  3AZI A;  1ID3 A;  4H9O A;  3AV2 A;  5BT1 D;  4Z66 A;  4XUJ B;  5B2I D;  5CPI A;  4WU8 A;  3MGS A;  5BS7 C;  3O62 B;  5B0Y B;  5CPJ D;  3O62 C;  5B0Y C;  3W97 B;  1P3F B;  3WTP B;  3C1B C;  5B2J D;  3W97 C;  2HIO A;  4J8W B;  1P3F C;  1P3A B;  4J8W C;  3W96 C;  5B33 D;  1P3A C;  4H9S C;  5GT0 D;  3MGP C;  5B1L C;  1KX3 B;  2BYM A;  3W99 A;  1P3I A;  1KX3 C;  1EQZ A;  3AZN B;  5AV6 A;  1BH9 B;  3LJA C;  4G92 B;  5AY8 B;  4NE6 A;  1M1A B;  4G92 C;  3NQJ A;  3WA9 C;  1M1A C;  3AZI B;  1ID3 B;  4H9O B;  3AZI C;  3UTA D;  1ID3 C;  4Z66 B;  3AZJ D;  3AV2 C;  4Z66 C;  5CPI B;  2FJ7 D;  4E44 A;  3MGS B;  5CPI C;  3MGS C;  4WU8 C;  5CPK D;  2F8N K;  3AZM A;  4JJN A;  2HIO B;  4X23 A;  5B40 A;  1P3K D;  3WTP E;  2HIO C;  3AZH B;  5GXQ D;  4CAY A;  4XUJ D;  5B2I A;  2F8N D;  2YFV A;  3B0D B;  5B0Y D;  2BYM B;  3B0D C;  1P3I B;  1EQZ B;  3W99 C;  1P3I C;  1AOI D;  1EQZ C;  5AV6 B;  3WTP D;  5AV6 C;  4G91 B;  4J8W D;  4G91 C;  5B33 A;  3NQJ B;  1BH8 A;  5E5A D;  4ZBJ B;  2RVQ D;  4ZBJ C;  3AZK A;  3AZN D;  1ZLA D;  3AZM B;  5B0Z D;  4JJN B;  3AZM C;  4JJN C;  5G49 A;  5AY8 D;  1M1A D;  4Z5T D;  4X23 B;  4X23 C;  3MNN A;  5B40 C;  4CAY B;  3UTA A;  3AZJ A;  1ULY A;  2FJ7 A;  3MGS D;  5B2I C;  5FUG A;  3TU4 A;  3LEL D;  1P3K A;  3AZH D;  2ARO A;  1KU5 A;  5B33 B;  5GXQ A;  3KUY A;  2CV5 A;  4XUJ A;  5B33 C;  4XZQ A;  2F8N A;  1P3I D;  1EQZ D;  1AOI A;  3AZK B;  3A6N A;  3AZK C;  3WTP A;  3X1T D;  1R4V A;  5G49 B;  3W98 A;  1HTA A;  2NQB D;  2LY8 A;  5E5A A;  1S32 D;  3MNN B;  5DNN B;  4WV4 B;  3UTA B;  3MNN C;  3AZJ B;  3UTA C;  2FJ7 B;  3AZJ C;  3AZN A;  3AV1 D;  1ZLA A;  2FJ7 C;  3KWQ A;  3AZM D;  4JJN D;  5B0Z A;  1M19 A;  3TU4 B;  2F8N G;  3TU4 C;  1P3O D;  5AY8 A;  4X23 D;  4Z5T A;  1WWI A;  5AV8 A;  1P3K B;  2ARO B;  3KUY B;  5GXQ B;  3REK A;  2CV5 B;  1P3G B;  1P3K C;  1KX5 A;  2ARO C;  3KUY C;  5GXQ C;  3B0C T;  4XZQ B;  3X1V D;  2CV5 C;  4LD9 B;  4XUJ C;  2F8N B;  4XZQ C;  3REL A;  3B0C W;  4YM6 B;  2F8N H;  4HGA B;  1AOI B;  3AZE D;  4HGA C;  3A6N B;  1AOI C;  5BNX B;  3REH B;  3A6N C;  3WTP C;  3LEL A;  3AZH A;  1JFI B;  3W98 B;  3W98 C;  5E5A B;  5E5A C;  4R8P B;  2RVQ C;  3AZK D;  1ZLA B;  5AV9 D;  3AZN C;  1ZLA C;  3KWQ B;  3WKJ A;  3X1T A;  5B0Z B;  1M19 B;  3KWQ C;  5B0Z C;  1M19 C;  3AZL D;  1P3P D;  2NQB A;  5BO0 B;  4Z5T B;  5AY8 C;  2BYK A;  5AV8 B;  3MNN D;  4Z5T C;  5DNN D;  1S32 A;  5B31 B;  5AV8 C;  3REK B;  1KX5 B;  4NE3 A;  3REK C;  1KX5 C;  3AV1 A;  3REL B;  4QLC D;  3REL C;  3TU4 D;  1P3O A;  3LEL B;  2ARO D;  3KUY D;  3LEL C;  2CV5 D;  1P3G D;  3B6G A;  3AZH C;  4LD9 D;  3X1V A;  4XZQ D;  5B1M B;  4YM6 D;  5GT3 B;  3LZ1 B;  3AZE A;  5B24 B;  3A6N D;  3MGQ D;  3REH D;  5B32 B;  3X1T B;  3WKJ B;  1A7W A;  3X1T C;  3WKJ C;  3AZG B;  3W98 D;  2NQB B;  5AV5 B;  2NQB C;  5F99 A;  3C1C D;  2BYK B;  4H9N A;  1S32 B;  1S32 C;  4R8P D;  3MGR B;  4KUD D;  3AV1 B;  1P3B A;  3REJ A;  5AV9 A;  3AV1 C;  3KWQ D;  1M19 D;  2PYO B;  3AZL A;  1P3O B;  1P3P A;  4ZUX A;  1P3O C;  2HUE B;  5AV8 D;  4KHA A;  2HUE C;  5DNN A;  5B31 D;  3REK D;  4WZS B;  1KX5 D;  3B6G B;  3X1V B;  3B6G C;  1TZY D;  3X1V C;  1P3L D;  3REL D;  1B67 A;  4QLC A;  1B6W A;  4M6B A;  2L5A A;  3AZE B;  1BFM A;  3AZE C;  4J8X A;  3VH5 A;  4J8U A;  1P3G A;  4LD9 A;  5B1M D;  5F99 B;  4YS3 D;  4H9N B;  4H9R A;  3AZF D;  5F99 C;  3VH6 T;  5AVC B;  4YM6 A;  5GT3 D;  3LZ1 D;  4J8V A;  1P3B B;  3VH6 W;  5B24 D;  3REJ B;  5BNX A;  5AV9 B;  3MGQ A;  3REH A;  1P3B C;  3REJ C;  3KSY A;  5B32 D;  5AV9 C;  4H9Q A;  4E45 A;  3WKJ D;  2IO5 B;  1JFI A;  3AZG D;  5BNV A;  3AZL B;  1P3P B;  2IO5 C;  3KXB D;  4ZUX B;  3AZL C;  5AV5 D;  1P3P C;  3C1C A;  3VH6 A;  4ZUX C;  1M18 A;  4KHA B;  2NZD A;  5CP6 B;  3LZ0 D;  4R8P A;  5DNN C;  3MVD A;  3MGR D;  4KUD A;  4AWL B;  4QLC B;  3WAA D;  4AWL C;  4H9P A;  4QLC C;  2PYO D;  1N1J A;  5GSU A;  1KX4 A;  5BO0 A;  4J8X B;  4J8X C;  3REI A;  5B31 A;  4J8U B;  3B6G D;  3AYW A;  3NQU A;  4J8U C;  1P3G C;  3X1U A;  4LD9 C;  1TZY A;  1P3L A;  4H9R B;  4WNN A;  4WU9 D;  5AVB D;  4YM6 C;  4J8V B;  1H3O B;  1Q9C A;  4J8V C;  2YFW A;  3MGQ B;  1U35 A;  3AN2 A;  3MGQ C;  3REH C;  4H9Q B;  1P3M D;  1M18 B;  3UTB D;  5BNV B;  5C3I B;  5B1M A;  5F99 D;  3C1C B;  5C3I C;  4YS3 A;  3AZF A;  3C1C C;  2NZD B;  5AVC D;  3MVD B; 
#chains in the Genus database with same CATH topology
 3X1S A;  1M18 C;  2NZD C;  3MVD C;  5GT3 A;  4R8P C;  3LZ1 A;  4KUD B;  5B31 G;  1P3B D;  5B24 A;  4KUD C;  3REJ D;  1P34 D;  5B32 A;  4H9P B;  1N1J B;  3AFA D;  5GSU B;  2JCH A;  3AZG A;  3UT9 D;  5GSU C;  5DNM D;  4ZUX D;  3KXB A;  3C1B B;  5AV5 A;  1KX4 B;  1KX4 C;  4KGC D;  2G5H C;  3REI B;  3W96 B;  5CP6 D;  3AYW B;  3NQU B;  3LZ0 A;  3MGR A;  5B31 C;  3REI C;  3X1U B;  3AYW C;  3MGP B;  1TZY B;  1WWS A;  1P3L B;  4WNN B;  5B1L B;  3A1K A;  5KDM A;  1TZY C;  3X1U C;  1P3L C;  1F1E A;  3WAA A;  2PYO A;  4EO5 B;  4EO5 C;  2YFW B;  1Z2C B;  2FFF B;  1U35 B;  2Y2P A;  4J8X D;  3LJA B;  3AN2 B;  1HQ3 D;  2DF4 C;  3B0B A;  1U35 C;  3AN2 C;  4J8U D;  5B32 G;  3WA9 B;  4YS3 B;  5B1M C;  3AZF B;  4YS3 C;  3X1S B;  3AZF C;  4WU9 A;  3AV2 B;  3X1S C;  5AVB A;  2ZY4 A;  4J8V D;  3R45 A;  2Y2G A;  5GT3 C;  3LZ1 C;  5B24 C;  4WU8 B;  3B6F A;  1P3M A;  3UTB A;  5B32 C;  5JRG A;  3AZG C;  3KXB B;  3KXB C;  1F66 A;  5AV5 C;  1M18 D;  2NZD D;  5AVC A;  3MVD D;  3LZ0 B;  3LZ0 C;  3MGR C;  2UWX A;  5KDM B;  1P34 A;  3O62 D;  3WAA B;  5CPJ A;  3W99 B;  3WAA C;  3AFA A;  5GSU D;  2PYO C;  4NE5 A;  3UT9 A;  5DNM A;  1KX4 D;  3C1B D;  3W97 D;  1P3F D;  2Y2M A;  4KGC A;  5B2J A;  3REI D;  3W96 D;  3VH5 T;  5CP6 A;  3AYW D;  1P3A D;  3X1U D;  3MGP D;  5GT0 A;  5B1L D;  2JSS A;  2Y2L A;  3VH5 W;  1KX3 D;  4WU9 B;  5AVB B;  3R45 B;  4WU9 C;  5AVB C;  4DRA A;  1U35 D;  3AN2 D;  3B6F B;  5CHL B;  4Z2M G;  3IP4 C;  1HQ3 A;  3LJA D;  3UTB B;  1P3M B;  3B6F C;  5JRG B;  1TAF A;  1P3M C;  3UTB C;  5JRG C;  2Y2I A;  3WA9 D;  5JA4 A;  1F66 B;  5B40 B;  3AZI D;  1F66 C;  3X1S D;  1ID3 D;  5AVC C;  3AV2 D;  3V9R A;  1H3O A;  4Z66 D;  5BT1 C;  5B2I B;  3F6T A;  5CPI D;  2W8S A;  2YFV B;  4WU8 D;  1P34 B;  4Z2M H;  5CPJ B;  5CPK A;  1P34 C;  3AFA B;  5CPJ C;  4UUZ A;  3UT9 B;  3AFA C;  5DNM B;  3UT9 C;  5DNM C;  4KGC B;  2CWE A;  5B2J B;  2HIO D;  4CSR A;  3KFU G;  4KGC C;  5B2J C;  5CP6 C;  2Y2N A;  5GT0 B;  4NFT A;  1BH8 B;  5BS7 A;  5GT0 C;  3O62 A;  5B0Y A;  3W99 D;  3C1B A;  1T3U A;  3W97 A;  5AV6 D;  1P3F A;  1HQ3 B;  4DRB A;  4J8W A;  1HQ3 C;  1TAF B;  3W96 A;  1P3A A;  4H9S A;  5JA4 B;  3MGP A;  5B1L A;  2RIQ A;  3FDD A;  1KX3 A;  3V9R B;  1W2E A;  3B6F D;  1BH9 A;  5FUG B;  3LJA A;  5CPK B;  5JRG D;  4UUZ B;  5CPK C;  3WA9 A;  2JE5 A;  1M1A A;  1F66 D;  4CSR B;  2ZY2 A;  2ZY5 A;  5B40 D;  3AZI A;  1ID3 A;  4H9O A;  3AV2 A;  2G5I C;  5BT1 D;  4Z66 A;  4XUJ B;  5B2I D;  3A1I A;  5CPI A;  2ZM5 A;  4WU8 A;  3MGS A;  5BS7 C;  3O62 B;  5B0Y B;  5CPJ D;  3O62 C;  5B0Y C;  3W97 B;  1P3F B;  3WTP B;  3C1B C;  5B2J D;  3W97 C;  2HIO A;  3P5J B;  4J8W B;  1P3F C;  4DQY B;  1P3A B;  4J8W C;  3W96 C;  5B33 D;  1P3A C;  4H9S C;  5GT0 D;  3MGP C;  5B1L C;  1KX3 B;  2BYM A;  3W99 A;  1P3I A;  1KX3 C;  1EQZ A;  3AZN B;  5AV6 A;  1BH9 B;  3EPJ A;  3LJA C;  4G92 B;  5AY8 B;  4NE6 A;  1M1A B;  4G92 C;  3NQJ A;  3WA9 C;  1M1A C;  3AZI B;  1ID3 B;  4H9O B;  3AZI C;  3UTA D;  1ID3 C;  4Z66 B;  3AZJ D;  3AV2 C;  4Z66 C;  5CPI B;  2FJ7 D;  4E44 A;  3MGS B;  5CPI C;  3MGS C;  4WU8 C;  5CPK D;  2F8N K;  3AZM A;  4JJN A;  2DQN C;  3H0R C;  2Y2H A;  2HIO B;  4X23 A;  5B40 A;  1P3K D;  3WTP E;  2HIO C;  3AZH B;  5GXQ D;  4CAY A;  4XUJ D;  5B2I A;  2F8N D;  2YFV A;  3B0D B;  5B0Y D;  2BYM B;  3B0D C;  1P3I B;  1EQZ B;  3W99 C;  1P3I C;  1AOI D;  1EQZ C;  5AV6 B;  3WTP D;  5AV6 C;  4G91 B;  4J8W D;  3H0L C;  2Y2Q A;  4G91 C;  5B33 A;  3NQJ B;  1BH8 A;  5E5A D;  4ZBJ B;  2RVQ D;  4ZBJ C;  3AZK A;  3AZN D;  1ZLA D;  3AZM B;  5B0Z D;  4JJN B;  3AZM C;  4JJN C;  5G49 A;  5AY8 D;  1M1A D;  4Z5T D;  4X23 B;  4X23 C;  3MNN A;  5B40 C;  4CAY B;  3UTA A;  3AZJ A;  1ULY A;  2FJ7 A;  3MGS D;  5B2I C;  2BG1 A;  5FUG A;  3TU4 A;  3LEL D;  1P3K A;  3AZH D;  2ARO A;  1KU5 A;  5B33 B;  5GXQ A;  3KUY A;  2CV5 A;  4XUJ A;  5B33 C;  4XZQ A;  2F8N A;  1P3I D;  1EQZ D;  1AOI A;  3AZK B;  3A6N A;  3AZK C;  3WTP A;  3X1T D;  1R4V A;  5G49 B;  3W98 A;  1HTA A;  2NQB D;  2LY8 A;  5E5A A;  1S32 D;  3MNN B;  5DNN B;  4WV4 B;  3UTA B;  3MNN C;  3AZJ B;  3UTA C;  2FJ7 B;  3AZJ C;  3AZN A;  3AV1 D;  1ZLA A;  2FJ7 C;  3KWQ A;  3AZM D;  2Y2J A;  5B0Z A;  4JJN D;  3TU4 B;  1M19 A;  2F8N G;  3TU4 C;  1P3O D;  5AY8 A;  4X23 D;  4Z5T A;  1WWI A;  5AV8 A;  2J8P A;  1P3K B;  2ARO B;  3KUY B;  5GXQ B;  3REK A;  2CV5 B;  1P3G B;  1P3K C;  1KX5 A;  2ARO C;  3KUY C;  5GXQ C;  3B0C T;  4XZQ B;  3X1V D;  2CV5 C;  4LD9 B;  4XUJ C;  2F8N B;  4XZQ C;  3REL A;  3B0C W;  4YM6 B;  1PZR A;  2F8N H;  4HGA B;  1AOI B;  3AZE D;  4HGA C;  3A6N B;  1AOI C;  5BNX B;  3REH B;  3A6N C;  3AL0 C;  3WTP C;  3LEL A;  3AZH A;  1JFI B;  3W98 B;  3W98 C;  5E5A B;  5E5A C;  3EPL A;  4R8P B;  2RVQ C;  3AZK D;  1ZLA B;  5AV9 D;  3AZN C;  1ZLA C;  3KWQ B;  3WKJ A;  3X1T A;  5B0Z B;  1M19 B;  3KWQ C;  5B0Z C;  1M19 C;  3AZL D;  1P3P D;  2NQB A;  5BO0 B;  4Z5T B;  5AY8 C;  2BYK A;  5AV8 B;  3MNN D;  4Z5T C;  5DNN D;  1S32 A;  5B31 B;  5AV8 C;  3REK B;  1KX5 B;  4NE3 A;  3REK C;  1KX5 C;  3AV1 A;  3REL B;  4QLC D;  3REL C;  3TU4 D;  3EG5 B;  1P3O A;  3LEL B;  2ARO D;  3KUY D;  3LEL C;  2CV5 D;  1P3G D;  3B6G A;  3AZH C;  4LD9 D;  3X1V A;  4XZQ D;  5B1M B;  4UPK A;  4YM6 D;  5GT3 B;  3LZ1 B;  3AZE A;  5B24 B;  3A6N D;  3MGQ D;  3REH D;  3EPK A;  5B32 B;  3X1T B;  3WKJ B;  1A7W A;  3X1T C;  3WKJ C;  3AZG B;  3H0M C;  3W98 D;  2NQB B;  5AV5 B;  2NQB C;  5F99 A;  3C1C D;  2BYK B;  4H9N A;  1S32 B;  1S32 C;  4R8P D;  3MGR B;  4KUD D;  3AV1 B;  1P3B A;  3REJ A;  5AV9 A;  3AV1 C;  2VQR A;  3KWQ D;  1M19 D;  2PYO B;  3AZL A;  1P3O B;  1P3P A;  4ZUX A;  1P3O C;  2HUE B;  5AV8 D;  4KHA A;  2HUE C;  5DNN A;  5B31 D;  3REK D;  4WZS B;  1KX5 D;  3B6G B;  3X1V B;  3B6G C;  1TZY D;  3X1V C;  1P3L D;  3REL D;  1B67 A;  4QLC A;  1B6W A;  4M6B A;  2L5A A;  3AZE B;  1BFM A;  3AZE C;  4J8X A;  3VH5 A;  4J8U A;  1P3G A;  4LD9 A;  5B1M D;  5F99 B;  4YS3 D;  4H9N B;  2Y2O A;  4H9R A;  3AZF D;  5F99 C;  3VH6 T;  5AVC B;  4YM6 A;  5GT3 D;  3LZ1 D;  4J8V A;  1P3B B;  3VH6 W;  5B24 D;  3REJ B;  5BNX A;  5AV9 B;  3MGQ A;  3REH A;  1P3B C;  3REJ C;  5AV9 C;  3KSY A;  5B32 D;  4H9Q A;  4E45 A;  3WKJ D;  2IO5 B;  1JFI A;  3AZG D;  5BNV A;  3AZL B;  1P3P B;  2IO5 C;  2Y2K A;  3KXB D;  4ZUX B;  3AZL C;  5AV5 D;  1P3P C;  3C1C A;  3VH6 A;  4ZUX C;  1M18 A;  4KHA B;  2NZD A;  5CP6 B;  3LZ0 D;  4R8P A;  5DNN C;  3MVD A;  3MGR D;  4KUD A;  4AWL B;  4QLC B;  3WAA D;  4AWL C;  4H9P A;  4QLC C;  2PYO D;  4WJ3 C;  1N1J A;  5GSU A;  2F2A C;  1KX4 A;  5BO0 A;  4J8X B;  4J8X C;  3REI A;  5B31 A;  4J8U B;  3B6G D;  3AYW A;  3NQU A;  2ZY3 A;  4J8U C;  1P3G C;  3X1U A;  4LD9 C;  1TZY A;  1P3L A;  4H9R B;  4WNN A;  4WU9 D;  5AVB D;  4YM6 C;  4J8V B;  1H3O B;  1Q9C A;  4J8V C;  2XD1 A;  2YFW A;  3MGQ B;  1U35 A;  3AN2 A;  3MGQ C;  3REH C;  4H9Q B;  1P3M D;  1M18 B;  3UTB D;  2XD5 A;  5BNV B;  5C3I B;  5B1M A;  3EPH A;  5F99 D;  3C1C B;  5C3I C;  4YS3 A;  3AZF A;  3C1C C;  2NZD B;  5AVC D;  3MVD B; 
#chains in the Genus database with same CATH homology
 3X1S A;  1M18 C;  2NZD C;  3MVD C;  5GT3 A;  4R8P C;  3LZ1 A;  4KUD B;  5B31 G;  1P3B D;  5B24 A;  4KUD C;  3REJ D;  1P34 D;  5B32 A;  4H9P B;  1N1J B;  3AFA D;  5GSU B;  2JCH A;  3AZG A;  3UT9 D;  5GSU C;  5DNM D;  4ZUX D;  3KXB A;  3C1B B;  5AV5 A;  1KX4 B;  1KX4 C;  4KGC D;  2G5H C;  3REI B;  3W96 B;  5CP6 D;  3AYW B;  3NQU B;  3LZ0 A;  3MGR A;  5B31 C;  3REI C;  3X1U B;  3AYW C;  3MGP B;  1TZY B;  1WWS A;  1P3L B;  4WNN B;  5B1L B;  3A1K A;  5KDM A;  1TZY C;  3X1U C;  1P3L C;  1F1E A;  3WAA A;  2PYO A;  4EO5 B;  4EO5 C;  2YFW B;  1Z2C B;  2FFF B;  1U35 B;  2Y2P A;  4J8X D;  3LJA B;  3AN2 B;  1HQ3 D;  2DF4 C;  3B0B A;  1U35 C;  3AN2 C;  4J8U D;  5B32 G;  3WA9 B;  4YS3 B;  5B1M C;  3AZF B;  4YS3 C;  3X1S B;  3AZF C;  4WU9 A;  3AV2 B;  3X1S C;  5AVB A;  2ZY4 A;  4J8V D;  3R45 A;  2Y2G A;  5GT3 C;  3LZ1 C;  5B24 C;  4WU8 B;  3B6F A;  1P3M A;  3UTB A;  5B32 C;  5JRG A;  3AZG C;  3KXB B;  3KXB C;  1F66 A;  5AV5 C;  1M18 D;  2NZD D;  5AVC A;  3MVD D;  3LZ0 B;  3LZ0 C;  3MGR C;  2UWX A;  5KDM B;  1P34 A;  3O62 D;  3WAA B;  5CPJ A;  3W99 B;  3WAA C;  3AFA A;  5GSU D;  2PYO C;  4NE5 A;  3UT9 A;  5DNM A;  1KX4 D;  3C1B D;  3W97 D;  1P3F D;  2Y2M A;  4KGC A;  5B2J A;  3REI D;  3W96 D;  3VH5 T;  5CP6 A;  3AYW D;  1P3A D;  3X1U D;  3MGP D;  5GT0 A;  5B1L D;  2JSS A;  2Y2L A;  3VH5 W;  1KX3 D;  4WU9 B;  5AVB B;  3R45 B;  4WU9 C;  5AVB C;  4DRA A;  1U35 D;  3AN2 D;  3B6F B;  5CHL B;  4Z2M G;  3IP4 C;  1HQ3 A;  3LJA D;  3UTB B;  1P3M B;  3B6F C;  5JRG B;  1TAF A;  1P3M C;  3UTB C;  5JRG C;  2Y2I A;  3WA9 D;  5JA4 A;  1F66 B;  5B40 B;  3AZI D;  1F66 C;  3X1S D;  1ID3 D;  5AVC C;  3AV2 D;  3V9R A;  1H3O A;  4Z66 D;  5BT1 C;  5B2I B;  3F6T A;  5CPI D;  2W8S A;  2YFV B;  4WU8 D;  1P34 B;  4Z2M H;  5CPJ B;  5CPK A;  1P34 C;  3AFA B;  5CPJ C;  4UUZ A;  3UT9 B;  3AFA C;  5DNM B;  3UT9 C;  5DNM C;  4KGC B;  2CWE A;  5B2J B;  2HIO D;  4CSR A;  3KFU G;  4KGC C;  5B2J C;  5CP6 C;  2Y2N A;  5GT0 B;  4NFT A;  1BH8 B;  5BS7 A;  5GT0 C;  3O62 A;  5B0Y A;  3W99 D;  3C1B A;  1T3U A;  3W97 A;  5AV6 D;  1P3F A;  1HQ3 B;  4DRB A;  4J8W A;  1HQ3 C;  1TAF B;  3W96 A;  1P3A A;  4H9S A;  5JA4 B;  3MGP A;  5B1L A;  2RIQ A;  3FDD A;  1KX3 A;  3V9R B;  1W2E A;  3B6F D;  1BH9 A;  5FUG B;  3LJA A;  5CPK B;  5JRG D;  4UUZ B;  5CPK C;  3WA9 A;  2JE5 A;  1M1A A;  1F66 D;  4CSR B;  2ZY2 A;  2ZY5 A;  5B40 D;  3AZI A;  1ID3 A;  4H9O A;  3AV2 A;  2G5I C;  5BT1 D;  4Z66 A;  4XUJ B;  5B2I D;  3A1I A;  5CPI A;  2ZM5 A;  4WU8 A;  3MGS A;  5BS7 C;  3O62 B;  5B0Y B;  5CPJ D;  3O62 C;  5B0Y C;  3W97 B;  1P3F B;  3WTP B;  3C1B C;  5B2J D;  3W97 C;  2HIO A;  3P5J B;  4J8W B;  1P3F C;  4DQY B;  1P3A B;  4J8W C;  3W96 C;  5B33 D;  1P3A C;  4H9S C;  5GT0 D;  3MGP C;  5B1L C;  1KX3 B;  2BYM A;  3W99 A;  1P3I A;  1KX3 C;  1EQZ A;  3AZN B;  5AV6 A;  1BH9 B;  3EPJ A;  3LJA C;  4G92 B;  5AY8 B;  4NE6 A;  1M1A B;  4G92 C;  3NQJ A;  3WA9 C;  1M1A C;  3AZI B;  1ID3 B;  4H9O B;  3AZI C;  3UTA D;  1ID3 C;  4Z66 B;  3AZJ D;  3AV2 C;  4Z66 C;  5CPI B;  2FJ7 D;  4E44 A;  3MGS B;  5CPI C;  3MGS C;  4WU8 C;  5CPK D;  2F8N K;  3AZM A;  4JJN A;  2DQN C;  3H0R C;  2Y2H A;  2HIO B;  4X23 A;  5B40 A;  1P3K D;  3WTP E;  2HIO C;  3AZH B;  5GXQ D;  4CAY A;  4XUJ D;  5B2I A;  2F8N D;  2YFV A;  3B0D B;  5B0Y D;  2BYM B;  3B0D C;  1P3I B;  1EQZ B;  3W99 C;  1P3I C;  1AOI D;  1EQZ C;  5AV6 B;  3WTP D;  5AV6 C;  4G91 B;  4J8W D;  3H0L C;  2Y2Q A;  4G91 C;  5B33 A;  3NQJ B;  1BH8 A;  5E5A D;  4ZBJ B;  2RVQ D;  4ZBJ C;  3AZK A;  3AZN D;  1ZLA D;  3AZM B;  5B0Z D;  4JJN B;  3AZM C;  4JJN C;  5G49 A;  5AY8 D;  1M1A D;  4Z5T D;  4X23 B;  4X23 C;  3MNN A;  5B40 C;  4CAY B;  3UTA A;  3AZJ A;  1ULY A;  2FJ7 A;  3MGS D;  5B2I C;  2BG1 A;  5FUG A;  3TU4 A;  3LEL D;  1P3K A;  3AZH D;  2ARO A;  1KU5 A;  5B33 B;  5GXQ A;  3KUY A;  2CV5 A;  4XUJ A;  5B33 C;  4XZQ A;  2F8N A;  1P3I D;  1EQZ D;  1AOI A;  3AZK B;  3A6N A;  3AZK C;  3WTP A;  3X1T D;  1R4V A;  5G49 B;  3W98 A;  1HTA A;  2NQB D;  2LY8 A;  5E5A A;  1S32 D;  3MNN B;  5DNN B;  4WV4 B;  3UTA B;  3MNN C;  3AZJ B;  3UTA C;  2FJ7 B;  3AZJ C;  3AZN A;  3AV1 D;  1ZLA A;  2FJ7 C;  3KWQ A;  3AZM D;  2Y2J A;  5B0Z A;  4JJN D;  3TU4 B;  1M19 A;  2F8N G;  3TU4 C;  1P3O D;  5AY8 A;  4X23 D;  4Z5T A;  1WWI A;  5AV8 A;  2J8P A;  1P3K B;  2ARO B;  3KUY B;  5GXQ B;  3REK A;  2CV5 B;  1P3G B;  1P3K C;  1KX5 A;  2ARO C;  3KUY C;  5GXQ C;  3B0C T;  4XZQ B;  3X1V D;  2CV5 C;  4LD9 B;  4XUJ C;  2F8N B;  4XZQ C;  3REL A;  3B0C W;  4YM6 B;  1PZR A;  2F8N H;  4HGA B;  1AOI B;  3AZE D;  4HGA C;  3A6N B;  1AOI C;  5BNX B;  3REH B;  3A6N C;  3AL0 C;  3WTP C;  3LEL A;  3AZH A;  1JFI B;  3W98 B;  3W98 C;  5E5A B;  5E5A C;  3EPL A;  4R8P B;  2RVQ C;  3AZK D;  1ZLA B;  5AV9 D;  3AZN C;  1ZLA C;  3KWQ B;  3WKJ A;  3X1T A;  5B0Z B;  1M19 B;  3KWQ C;  5B0Z C;  1M19 C;  3AZL D;  1P3P D;  2NQB A;  5BO0 B;  4Z5T B;  5AY8 C;  2BYK A;  5AV8 B;  3MNN D;  4Z5T C;  5DNN D;  1S32 A;  5B31 B;  5AV8 C;  3REK B;  1KX5 B;  4NE3 A;  3REK C;  1KX5 C;  3AV1 A;  3REL B;  4QLC D;  3REL C;  3TU4 D;  3EG5 B;  1P3O A;  3LEL B;  2ARO D;  3KUY D;  3LEL C;  2CV5 D;  1P3G D;  3B6G A;  3AZH C;  4LD9 D;  3X1V A;  4XZQ D;  5B1M B;  4UPK A;  4YM6 D;  5GT3 B;  3LZ1 B;  3AZE A;  5B24 B;  3A6N D;  3MGQ D;  3REH D;  3EPK A;  5B32 B;  3X1T B;  3WKJ B;  1A7W A;  3X1T C;  3WKJ C;  3AZG B;  3H0M C;  3W98 D;  2NQB B;  5AV5 B;  2NQB C;  5F99 A;  3C1C D;  2BYK B;  4H9N A;  1S32 B;  1S32 C;  4R8P D;  3MGR B;  4KUD D;  3AV1 B;  1P3B A;  3REJ A;  5AV9 A;  3AV1 C;  2VQR A;  3KWQ D;  1M19 D;  2PYO B;  3AZL A;  1P3O B;  1P3P A;  4ZUX A;  1P3O C;  2HUE B;  5AV8 D;  4KHA A;  2HUE C;  5DNN A;  5B31 D;  3REK D;  4WZS B;  1KX5 D;  3B6G B;  3X1V B;  3B6G C;  1TZY D;  3X1V C;  1P3L D;  3REL D;  1B67 A;  4QLC A;  1B6W A;  4M6B A;  2L5A A;  3AZE B;  1BFM A;  3AZE C;  4J8X A;  3VH5 A;  4J8U A;  1P3G A;  4LD9 A;  5B1M D;  5F99 B;  4YS3 D;  4H9N B;  2Y2O A;  4H9R A;  3AZF D;  5F99 C;  3VH6 T;  5AVC B;  4YM6 A;  5GT3 D;  3LZ1 D;  4J8V A;  1P3B B;  3VH6 W;  5B24 D;  3REJ B;  5BNX A;  5AV9 B;  3MGQ A;  3REH A;  1P3B C;  3REJ C;  5AV9 C;  3KSY A;  5B32 D;  4H9Q A;  4E45 A;  3WKJ D;  2IO5 B;  1JFI A;  3AZG D;  5BNV A;  3AZL B;  1P3P B;  2IO5 C;  2Y2K A;  3KXB D;  4ZUX B;  3AZL C;  5AV5 D;  1P3P C;  3C1C A;  3VH6 A;  4ZUX C;  1M18 A;  4KHA B;  2NZD A;  5CP6 B;  3LZ0 D;  4R8P A;  5DNN C;  3MVD A;  3MGR D;  4KUD A;  4AWL B;  4QLC B;  3WAA D;  4AWL C;  4H9P A;  4QLC C;  2PYO D;  4WJ3 C;  1N1J A;  5GSU A;  2F2A C;  1KX4 A;  5BO0 A;  4J8X B;  4J8X C;  3REI A;  5B31 A;  4J8U B;  3B6G D;  3AYW A;  3NQU A;  2ZY3 A;  4J8U C;  1P3G C;  3X1U A;  4LD9 C;  1TZY A;  1P3L A;  4H9R B;  4WNN A;  4WU9 D;  5AVB D;  4YM6 C;  4J8V B;  1H3O B;  1Q9C A;  4J8V C;  2XD1 A;  2YFW A;  3MGQ B;  1U35 A;  3AN2 A;  3MGQ C;  3REH C;  4H9Q B;  1P3M D;  1M18 B;  3UTB D;  2XD5 A;  5BNV B;  5C3I B;  5B1M A;  3EPH A;  5F99 D;  3C1C B;  5C3I C;  4YS3 A;  3AZF A;  3C1C C;  2NZD B;  5AVC D;  3MVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...