4Z5TC

The nucleosome containing human h3.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tC00
1M18B 4G92B 3O62C 5B40B 5B2IC 3W96A 5B2JB 3REKD 1P3MA 3UTAC 5B32G 4WU8B 3KUYA 5CPID 2BYMA 5F99C 5B31G 3WAAD 5BNXB 3AZMB 4EO5B 3LZ1B 4LD9C 2FJ7B 5DNMA 4Z5TC 3KXBD 3A6NC 4H9OB 1BH8B 3AZLB 4J8XA 5BO0B 1KX5C 3NQUA 4KUDB 1TZYC 5AY8D 3LJAB 1P3FB 3REHA 3KSYA 2CV5B 3WTPB 5AVBC 5CP6A 3VH6A 3VH5A 4H9SC 4J8VB 3W96C 1P3MC 1EQZD 3MGQC 3AZNA 3AZKA 4Z66A 1JFIA 2NQBC 3B6GB 3AN2D 5CPJD 5B2IB 4H9QB 4J8WA 3AZHC 2F8NG 5DNMC 3UTBD 5B0ZD 3AZFD 1P34A 3X1TD 4E45A 5F99B 5AV6D 3MGSC 1U35A 4J8XC 4YS3A 3WA9A 3AFAA 5B32B 3REHC 3W99D 3A6NB 1P3LA 3AV2B 5CPKC 5B24D 1P3OB 2IO5C 3V9RA 5AV9B 3O62D 1ID3A 5C3IC 1TZYB 1N1JA 3X1SD 3B6FB 5GXQD 1ULYA 4CSRB 3AZNC 3REIA 4CAYA 3AZEA 5AVBB 4WNNA 2RVQD 3VH6W 4X23D 3WAAA 4J8WC 3VH5W 1P34C 3MGQB 3C1CB 1WWIA 1KU5A 1P3AC 2NQBB 1Q9CA 4KHAB 1B6WA 5BNVA 3MGPD 3AZHB 1WWSA 4NE6A 1KX3D 2AROD 3VH6T 4Z2MH 3WA9C 3AFAC 5JRGD 3VH5T 5GT3A 1P3LC 3C1BA 3MGSB 4XUJB 1ID3C 3KUYD 5GT0D 1EQZA 5CPKB 2IO5B 5CPIC 1BH9A 3WAAC 3WKJB 3AN2A 1KX4A 5CPJA 1BFMA 1P3KB 4H9PB 1S32D 3KWQD 5B0ZA 1P3IB 5CHLB 3AZFA 1M1AB 3KXBC 3AZIB 5AV6A 4J8WB 1TAFB 4HGAC 1P3AB 4NE3A 2F8NK 5AY8C 5CP6D 3TU4B 3B0CW 5B1LB 4ZBJC 4H9NB 3B0DC 3REJB 5B24A 4R8PB 2HUEB 3AZND 3AZKD 1EQZC 4Z66D 1M19D 3UT9B 1HQ3B 2PYOD 1P3BB 3B0CT 3AN2C 4YM6B 5CPJC 4X23A 1P34D 3REKB 2YFVB 4WNNB 3UTBC 5B0ZC 5CPIB 1U35D 3MGRD 3AZFC 3X1TC 4KGCA 3AYWB 3AZJD 4YS3D 5AV6C 4XZQB 3RELA 4ZUXD 1ZLAB 4QLCD 2L5AA 3AFAD 3AZGB 3MNNB 3MGPA 1KX3A 3X1UB 5B33D 2NZDB 5JRGA 4WU9D 3KXBB 3W99C 2HIOB 5B24C 4HGAB 3REID 3AZED 5AY8B 3X1SC 4ZBJB 5GXQC 3B0DB 4JJNB 5GT0A 3LZ0A 2RVQC 1P3GA 4X23C 1F66A 3WTPE 5B31A 5DNNB 5E5AB 1S32A 3KWQA 5CPJB 1P3PD 5GT3D 3MGPC 3C1BD 1KX3C 2AROC 5B0ZB 3UTBB 4H9RB 3AZFB 5JRGC 3X1TB 3X1VD 3W97B 3W98D 3AV1D 4DRAA 1AOID 4DRBA 3KUYC 4UUZA 3W99B 5GT0C 1M19A 5B24B 1H3OA 1P3GC 2PYOA 1KX4D 3O62B 4WV4B 3UTAB 3X1SB 5GXQB 1M18D 1F1EA 3NQJA 1S32C 5B2JD 5JA4A 3KWQC 3LELA 3MGRA 4LD9B 4WU8D 2F8NH 3AZJA 2BYKB 4ZUXA 3AZMD 4QLCA 4Z5TB 5AVCA 3LZ1D 5B0YA 5B33A 2YFWA 5BS7A 5CP6C 4WU9A 1KX5B 3MGPB 2AROB 3AZLD 2JSSA 5JRGB 3MVDD 3AZKC 4Z66C 1M19C 2PYOC 3LJAD 1P3FD 1P3MB 3W96B 2CV5D 3WTPD 3KUYB 4KGCD 2BYMB 5B1MD 5AV5A 1U35C 3RELD 3MGRC 3AZJC 4YS3C 5DNMB 4ZUXC 4QLCC 4J8UA 3B6GD 1P3PA 5B0YC 5B33C 3KWQB 5BS7C 4J8XB 4WU9C 3X1VA 3NQUB 3W98A 3REHB 3AV1A 4M6BA 3REIC 1A7WA 3AZEC 3LZ0D 5CP6B 1AOIA 4NE5A 1P3GD 5G49A 5B32D 1F66D 5C3IB 3AV2D 1P3OD 5B31D 3AZNB 3AZKB 4Z66B 5AV5C 5KDMA 1JFIB 1M18A 3B6FD 5B40A 5B2JA 4WU8A 1P34B 1P3PC 5GT3C 3C1BC 5JA4B 3AZMA 1U35B 3X1VC 3LZ1A 4YS3B 3C1CD 3W98C 4ZUXB 3WA9B 3AFAB 3AV1C 1P3LB 4H9OA 5B33B 1BH8A 1AOIC 3AZLA 3V9RB 4WU9B 5BO0A 3MVDA 1ID3B 1N1JB 3LJAA 1P3FA 1KX4C 3REIB 4CAYB 3AZEB 4XUJD 2CV5A 3WTPA 3LELD 1M18C 2F8ND 5B1MA 3WAAB 5B2JC 4WU8C 1B67A 5AVCD 5B0YD 3AZMC 3B6GA 4EO5C 3LZ1C 5BNVB 5B2IA 4H9QA 1P3KD 5AV8D 5BT1D 1M1AD 1P3ID 5GT3B 3AZID 5F99A 3C1BB 4AWLC 3AZLC 5FUGA 3MVDC 3W98B 3LJAC 1P3FC 3TU4D 5B1LD 5B32A 3REJD 1EQZB 5AV5D 1AOIB 3AV2A 2CV5C 3WTPC 1P3OA 4R8PD 1R4VA 5AV9A 4KGCC 1BH9B 5B1MC 3RELC 3AN2B 1KX4B 3B6FA 4J8UD 1HQ3D 1P3BD 4CSRA 5AVBA 3B6GC 4YM6D 2CWEA 4H9SA 4E44A 5AV6B 3MGQA 3C1CA 3AYWD 5GSUD 2NQBA 4XZQD 1ZLAD 4KHAA 3AZGD 3MNND 3LZ0C 3AZHA 3X1UD 3R45A 2NZDD 5B32C 1F66C 2HIOD 4AWLB 3MGSA 3AV2C 1P3OC 5B31C 5AV9C 3MVDB 4XUJA 5B40D 3B6FC 4X23B 2F8NA 4JJND 5CPKA 4KGCB 5B1MB 2FJ7D 3RELB 3WKJA 5DNND 3C1CC 1P3KA 1KX3B 4H9PA 5E5AD 5AV8A 1M1AA 1P3IA 3AZIA 4KUDD 1TAFA 3W97D 1P3AA 5FUGB 3TU4A 5B1LA 4H9NA 3REJA 5GT0B 3LZ0B 4XUJC 4J8VD 3LELC 4R8PA 1P3GB 1F66B 5B31B 3UT9A 5AVCC 1HQ3A 1P3BA 5B2ID 1S32B 3UTAD 3WKJC 4YM6A 4NFTA 4G91C 1P3KC 5F99D 3REKA 5AV8C 2YFVA 5BT1C 5CPIA 1P3IC 1M1AC 4LD9D 4WZSB 3AYWA 5GSUA 3AZIC 4XZQA 1ZLAA 4Z5TD 3AZGA 3MNNA 3A6ND 4Z2MG 2LY8A 3X1UA 3B0BA 4UUZB 2NZDA 3TU4C 5AV9D 5B1LC 3KXBA 3REJC 1KX5D 2HIOA 1M19B 1H3OB 1TZYD 4R8PC 3R45B 2PYOB 2HUEC 5AY8A 5AVBD 3UT9C 4J8UC 1HQ3C 1P3BC 3NQJB 4JJNA 1P3MD 3W96D 5BNXA 3LELB 3MGRB 2F8NB 4YM6C 3AZJB 3MGQD 2FJ7A 3REKC 2NQBD 4QLCB 5AVCB 5DNNA 5B0YB 5GSUC 3AYWC 5E5AA 2YFWB 3AZHD 4XZQC 5DNMD 1ZLAC 3AZGC 4G91B 3MNNC 5AV8B 3MGSD 3X1UC 4KUDA 3UTBA 2NZDC 4H9RA 4J8XD 3X1TA 3W97A 2HIOC 4G92C 3REHD 5B40C 4J8VA 5CPKD 1HTAA 3W99A 4JJNC 5AV5B 3WKJD 3O62A 2FJ7C 3UTAA 3X1SA 5GXQA 4J8UB 1P3PB 5DNNC 5E5AC 4J8WD 3X1VB 4LD9A 1P3AD 4KUDC 2BYKA 3AV1B 4Z5TA 5GSUB 3A6NA 3W97C 3WA9D 5G49B 1KX5A 1P3LD 4J8VC 1TZYA 2AROA 3UT9D 1ID3D 5KDMB
chains in the Genus database with same CATH superfamily
1M18B 4G92B 1PZRA 3O62C 5B40B 5B2IC 3W96A 5B2JB 3REKD 1P3MA 3UTAC 5B32G 4WU8B 3KUYA 5CPID 2BYMA 5F99C 5B31G 3WAAD 5BNXB 3AZMB 4EO5B 3LZ1B 4LD9C 2FJ7B 5DNMA 4Z5TC 3KXBD 3A6NC 4H9OB 1BH8B 3AZLB 4J8XA 5BO0B 1KX5C 3NQUA 4KUDB 1TZYC 5AY8D 3LJAB 1P3FB 3REHA 3A1KA 3KSYA 2CV5B 3WTPB 5AVBC 5CP6A 3VH6A 3VH5A 4H9SC 4J8VB 3W96C 1P3MC 1EQZD 3MGQC 3AZNA 3AZKA 4Z66A 1JFIA 2NQBC 3B6GB 3AN2D 5CPJD 5B2IB 4H9QB 4J8WA 3AZHC 2F8NG 5DNMC 3UTBD 5B0ZD 3AZFD 1P34A 3H0MC 4E45A 3X1TD 5F99B 5AV6D 3MGSC 1U35A 4J8XC 1W2EA 4YS3A 3WA9A 2ZY3A 5B32B 3AFAA 3REHC 3W99D 3A6NB 1P3LA 3AV2B 5CPKC 5B24D 1P3OB 2IO5C 3V9RA 5AV9B 3O62D 1ID3A 5C3IC 1TZYB 1N1JA 3X1SD 3B6FB 5GXQD 1ULYA 4CSRB 3AZNC 3REIA 4CAYA 3AZEA 5AVBB 4WNNA 2RVQD 3VH6W 4X23D 3WAAA 4J8WC 3VH5W 1P34C 3MGQB 3C1CB 1WWIA 1KU5A 1P3AC 2NQBB 1Q9CA 4KHAB 4DQYB 1B6WA 2UWXA 3A1IA 5BNVA 1WWSA 4NE6A 3MGPD 2AROD 3VH6T 4Z2MH 3AZHB 1KX3D 3AFAC 5JRGD 3WA9C 3VH5T 5GT3A 1P3LC 3C1BA 3MGSB 4XUJB 1ID3C 3KUYD 5GT0D 1EQZA 5CPKB 2IO5B 5CPIC 1BH9A 3WAAC 3WKJB 3AN2A 1KX4A 5CPJA 1BFMA 1P3KB 3EPKA 4H9PB 1S32D 3KWQD 5B0ZA 1P3IB 5CHLB 3AZFA 1M1AB 3KXBC 3AZIB 5AV6A 4J8WB 1TAFB 4HGAC 1P3AB 4NE3A 2F8NK 5AY8C 5CP6D 3TU4B 3B0CW 5B1LB 4ZBJC 4H9NB 3B0DC 3REJB 2G5HC 5B24A 4R8PB 2HUEB 3AZND 3AZKD 1EQZC 4Z66D 1M19D 3UT9B 1HQ3B 2PYOD 1P3BB 2J8PA 3B0CT 3AN2C 4YM6B 5CPJC 4X23A 1P34D 3REKB 2YFVB 4WNNB 3UTBC 5B0ZC 5CPIB 1U35D 3MGRD 3AZFC 3X1TC 4KGCA 3AYWB 3AZJD 2ZY4A 5AV6C 4YS3D 4XZQB 3RELA 4ZUXD 1ZLAB 4QLCD 2L5AA 3AFAD 3AZGB 3MNNB 3MGPA 1KX3A 3X1UB 5B33D 2NZDB 5JRGA 4WU9D 3KXBB 3W99C 2HIOB 5B24C 3EPHA 4HGAB 3EPLA 2DQNC 3KFUG 3REID 3AZED 5AY8B 3X1SC 4ZBJB 5GXQC 3B0DB 2ZM5A 5GT0A 4JJNB 3LZ0A 2RVQC 1P3GA 4X23C 1F66A 3WTPE 5B31A 5DNNB 5E5AB 1S32A 3KWQA 5CPJB 1P3PD 5GT3D 3MGPC 3C1BD 1KX3C 2AROC 5B0ZB 3UTBB 4H9RB 3AZFB 2BG1A 5JRGC 3X1TB 3X1VD 3W97B 3F6TA 3W98D 2FFFB 2F2AC 3AV1D 4DRAA 1AOID 4DRBA 3KUYC 4UUZA 3W99B 5GT0C 2Y2HA 1M19A 5B24B 1H3OA 2XD5A 1P3GC 2PYOA 1KX4D 3O62B 2Y2LA 4WV4B 2Y2JA 3UTAB 3X1SB 5GXQB 1M18D 1F1EA 3NQJA 1S32C 5B2JD 5JA4A 3KWQC 3FDDA 3LELA 3MGRA 4LD9B 4WU8D 2F8NH 3AZJA 2BYKB 4ZUXA 3AZMD 4QLCA 4Z5TB 5AVCA 3LZ1D 5B0YA 5B33A 2YFWA 5BS7A 5CP6C 4WU9A 1KX5B 3MGPB 2AROB 3AZLD 2JSSA 2Y2PA 5JRGB 3MVDD 3AZKC 4Z66C 1M19C 2PYOC 3LJAD 1P3FD 1P3MB 3W96B 2CV5D 3WTPD 3KUYB 4KGCD 2BYMB 5B1MD 5AV5A 1U35C 3RELD 3MGRC 3IP4C 3AZJC 4YS3C 5DNMB 4ZUXC 4QLCC 4J8UA 3B6GD 1P3PA 5B0YC 5B33C 3KWQB 5BS7C 4J8XB 4WU9C 3X1VA 3NQUB 3W98A 3REHB 3AV1A 4M6BA 3REIC 1A7WA 3AZEC 3LZ0D 5CP6B 1AOIA 4NE5A 1P3GD 5G49A 5B32D 1F66D 5C3IB 3AV2D 1P3OD 5B31D 3AZNB 3AZKB 4Z66B 5AV5C 5KDMA 1JFIB 1M18A 3B6FD 5B40A 5B2JA 4WU8A 1P34B 1P3PC 5GT3C 3C1BC 5JA4B 3AZMA 1U35B 3X1VC 2Y2KA 3LZ1A 4YS3B 3C1CD 3W98C 4ZUXB 3WA9B 3AFAB 3AV1C 1P3LB 4H9OA 5B33B 1BH8A 1AOIC 3AZLA 3V9RB 4WU9B 5BO0A 3MVDA 1ID3B 2Y2MA 1N1JB 3LJAA 1P3FA 1KX4C 1T3UA 3REIB 4CAYB 3AZEB 4XUJD 3EG5B 2CV5A 3WTPA 3LELD 1M18C 2F8ND 5B1MA 2Y2IA 3WAAB 5B2JC 4WU8C 1B67A 5AVCD 5B0YD 3AZMC 3B6GA 4EO5C 3LZ1C 5BNVB 5B2IA 4H9QA 1P3KD 5AV8D 5BT1D 1M1AD 1P3ID 5GT3B 3AZID 5F99A 3C1BB 4AWLC 3AZLC 5FUGA 3MVDC 3AL0C 3W98B 3LJAC 1P3FC 3TU4D 5B1LD 5B32A 3REJD 1EQZB 5AV5D 1AOIB 3AV2A 2CV5C 3WTPC 1P3OA 4R8PD 1R4VA 5AV9A 4KGCC 1BH9B 5B1MC 3RELC 3AN2B 1KX4B 3B6FA 4J8UD 1HQ3D 1P3BD 4CSRA 5AVBA 3B6GC 4YM6D 2CWEA 4H9SA 4E44A 5AV6B 4UPKA 2Y2OA 3MGQA 3C1CA 3AYWD 5GSUD 3H0RC 2NQBA 4XZQD 1ZLAD 2JCHA 4KHAA 3AZGD 3MNND 3LZ0C 3AZHA 3X1UD 3R45A 2NZDD 2Y2NA 5B32C 1F66C 2HIOD 4AWLB 3MGSA 3AV2C 1P3OC 5B31C 2DF4C 5AV9C 3MVDB 4XUJA 5B40D 2VQRA 3B6FC 4X23B 2F8NA 4JJND 5CPKA 4KGCB 5B1MB 2FJ7D 3RELB 3WKJA 5DNND 3C1CC 1P3KA 1KX3B 4H9PA 5E5AD 5AV8A 1M1AA 1P3IA 3AZIA 4KUDD 1TAFA 3W97D 1P3AA 5FUGB 3TU4A 5B1LA 4H9NA 3REJA 5GT0B 3LZ0B 4XUJC 4J8VD 3LELC 4R8PA 1P3GB 1F66B 5B31B 3UT9A 3P5JB 1HQ3A 5AVCC 1P3BA 5B2ID 1S32B 3UTAD 3WKJC 4YM6A 4NFTA 4G91C 1P3KC 5F99D 3REKA 5AV8C 2YFVA 5BT1C 5CPIA 1P3IC 1M1AC 4LD9D 4WZSB 3AYWA 5GSUA 3AZIC 4XZQA 1ZLAA 4Z5TD 3AZGA 3MNNA 3A6ND 2Y2GA 3H0LC 2LY8A 4Z2MG 3X1UA 3B0BA 4UUZB 2NZDA 3TU4C 5AV9D 5B1LC 3KXBA 3REJC 1KX5D 2HIOA 1M19B 1H3OB 1Z2CB 1TZYD 3EPJA 4R8PC 3R45B 2PYOB 4WJ3C 2HUEC 5AY8A 5AVBD 3UT9C 4J8UC 1HQ3C 1P3BC 3NQJB 4JJNA 1P3MD 3W96D 5BNXA 3LELB 3MGRB 2F8NB 2W8SA 4YM6C 2G5IC 3MGQD 3AZJB 2FJ7A 3REKC 2NQBD 4QLCB 5AVCB 5DNNA 5B0YB 5GSUC 3AYWC 5E5AA 2Y2QA 2YFWB 3AZHD 4XZQC 5DNMD 1ZLAC 3AZGC 4G91B 3MNNC 5AV8B 3MGSD 3X1UC 4KUDA 3UTBA 2NZDC 4H9RA 4J8XD 3X1TA 3W97A 2HIOC 2RIQA 4G92C 3REHD 5B40C 4J8VA 5CPKD 1HTAA 3W99A 4JJNC 2JE5A 2ZY5A 5AV5B 3WKJD 3O62A 2FJ7C 3UTAA 3X1SA 5GXQA 4J8UB 1P3PB 5DNNC 5E5AC 4J8WD 3X1VB 4LD9A 1P3AD 4KUDC 2BYKA 3AV1B 4Z5TA 5GSUB 3A6NA 3W97C 2XD1A 3WA9D 5G49B 1KX5A 1P3LD 4J8VC 1TZYA 2AROA 3UT9D 2ZY2A 1ID3D 5KDMB
chains in the Genus database with same CATH topology
1M18B 4G92B 1PZRA 3O62C 5B40B 5B2IC 3W96A 5B2JB 3REKD 1P3MA 3UTAC 5B32G 4WU8B 3KUYA 5CPID 2BYMA 5F99C 5B31G 3WAAD 5BNXB 3AZMB 4EO5B 3LZ1B 4LD9C 2FJ7B 5DNMA 4Z5TC 3KXBD 3A6NC 4H9OB 1BH8B 3AZLB 4J8XA 5BO0B 1KX5C 3NQUA 4KUDB 1TZYC 5AY8D 3LJAB 1P3FB 3REHA 3A1KA 3KSYA 2CV5B 3WTPB 5AVBC 5CP6A 3VH6A 3VH5A 4H9SC 4J8VB 3W96C 1P3MC 1EQZD 3MGQC 3AZNA 3AZKA 4Z66A 1JFIA 2NQBC 3B6GB 3AN2D 5CPJD 5B2IB 4H9QB 4J8WA 3AZHC 2F8NG 5DNMC 3UTBD 5B0ZD 3AZFD 1P34A 3H0MC 4E45A 3X1TD 5F99B 5AV6D 3MGSC 1U35A 4J8XC 1W2EA 4YS3A 3WA9A 2ZY3A 5B32B 3AFAA 3REHC 3W99D 3A6NB 1P3LA 3AV2B 5CPKC 5B24D 1P3OB 2IO5C 3V9RA 5AV9B 3O62D 1ID3A 5C3IC 1TZYB 1N1JA 3X1SD 3B6FB 5GXQD 1ULYA 4CSRB 3AZNC 3REIA 4CAYA 3AZEA 5AVBB 4WNNA 2RVQD 3VH6W 4X23D 3WAAA 4J8WC 3VH5W 1P34C 3MGQB 3C1CB 1WWIA 1KU5A 1P3AC 2NQBB 1Q9CA 4KHAB 4DQYB 1B6WA 2UWXA 3A1IA 5BNVA 1WWSA 4NE6A 3MGPD 2AROD 3VH6T 4Z2MH 3AZHB 1KX3D 3AFAC 5JRGD 3WA9C 3VH5T 5GT3A 1P3LC 3C1BA 3MGSB 4XUJB 1ID3C 3KUYD 5GT0D 1EQZA 5CPKB 2IO5B 5CPIC 1BH9A 3WAAC 3WKJB 3AN2A 1KX4A 5CPJA 1BFMA 1P3KB 3EPKA 4H9PB 1S32D 3KWQD 5B0ZA 1P3IB 5CHLB 3AZFA 1M1AB 3KXBC 3AZIB 5AV6A 4J8WB 1TAFB 4HGAC 1P3AB 4NE3A 2F8NK 5AY8C 5CP6D 3TU4B 3B0CW 5B1LB 4ZBJC 4H9NB 3B0DC 3REJB 2G5HC 5B24A 4R8PB 2HUEB 3AZND 3AZKD 1EQZC 4Z66D 1M19D 3UT9B 1HQ3B 2PYOD 1P3BB 2J8PA 3B0CT 3AN2C 4YM6B 5CPJC 4X23A 1P34D 3REKB 2YFVB 4WNNB 3UTBC 5B0ZC 5CPIB 1U35D 3MGRD 3AZFC 3X1TC 4KGCA 3AYWB 3AZJD 2ZY4A 5AV6C 4YS3D 4XZQB 3RELA 4ZUXD 1ZLAB 4QLCD 2L5AA 3AFAD 3AZGB 3MNNB 3MGPA 1KX3A 3X1UB 5B33D 2NZDB 5JRGA 4WU9D 3KXBB 3W99C 2HIOB 5B24C 3EPHA 4HGAB 3EPLA 2DQNC 3KFUG 3REID 3AZED 5AY8B 3X1SC 4ZBJB 5GXQC 3B0DB 2ZM5A 5GT0A 4JJNB 3LZ0A 2RVQC 1P3GA 4X23C 1F66A 3WTPE 5B31A 5DNNB 5E5AB 1S32A 3KWQA 5CPJB 1P3PD 5GT3D 3MGPC 3C1BD 1KX3C 2AROC 5B0ZB 3UTBB 4H9RB 3AZFB 2BG1A 5JRGC 3X1TB 3X1VD 3W97B 3F6TA 3W98D 2FFFB 2F2AC 3AV1D 4DRAA 1AOID 4DRBA 3KUYC 4UUZA 3W99B 5GT0C 2Y2HA 1M19A 5B24B 1H3OA 2XD5A 1P3GC 2PYOA 1KX4D 3O62B 2Y2LA 4WV4B 2Y2JA 3UTAB 3X1SB 5GXQB 1M18D 1F1EA 3NQJA 1S32C 5B2JD 5JA4A 3KWQC 3FDDA 3LELA 3MGRA 4LD9B 4WU8D 2F8NH 3AZJA 2BYKB 4ZUXA 3AZMD 4QLCA 4Z5TB 5AVCA 3LZ1D 5B0YA 5B33A 2YFWA 5BS7A 5CP6C 4WU9A 1KX5B 3MGPB 2AROB 3AZLD 2JSSA 2Y2PA 5JRGB 3MVDD 3AZKC 4Z66C 1M19C 2PYOC 3LJAD 1P3FD 1P3MB 3W96B 2CV5D 3WTPD 3KUYB 4KGCD 2BYMB 5B1MD 5AV5A 1U35C 3RELD 3MGRC 3IP4C 3AZJC 4YS3C 5DNMB 4ZUXC 4QLCC 4J8UA 3B6GD 1P3PA 5B0YC 5B33C 3KWQB 5BS7C 4J8XB 4WU9C 3X1VA 3NQUB 3W98A 3REHB 3AV1A 4M6BA 3REIC 1A7WA 3AZEC 3LZ0D 5CP6B 1AOIA 4NE5A 1P3GD 5G49A 5B32D 1F66D 5C3IB 3AV2D 1P3OD 5B31D 3AZNB 3AZKB 4Z66B 5AV5C 5KDMA 1JFIB 1M18A 3B6FD 5B40A 5B2JA 4WU8A 1P34B 1P3PC 5GT3C 3C1BC 5JA4B 3AZMA 1U35B 3X1VC 2Y2KA 3LZ1A 4YS3B 3C1CD 3W98C 4ZUXB 3WA9B 3AFAB 3AV1C 1P3LB 4H9OA 5B33B 1BH8A 1AOIC 3AZLA 3V9RB 4WU9B 5BO0A 3MVDA 1ID3B 2Y2MA 1N1JB 3LJAA 1P3FA 1KX4C 1T3UA 3REIB 4CAYB 3AZEB 4XUJD 3EG5B 2CV5A 3WTPA 3LELD 1M18C 2F8ND 5B1MA 2Y2IA 3WAAB 5B2JC 4WU8C 1B67A 5AVCD 5B0YD 3AZMC 3B6GA 4EO5C 3LZ1C 5BNVB 5B2IA 4H9QA 1P3KD 5AV8D 5BT1D 1M1AD 1P3ID 5GT3B 3AZID 5F99A 3C1BB 4AWLC 3AZLC 5FUGA 3MVDC 3AL0C 3W98B 3LJAC 1P3FC 3TU4D 5B1LD 5B32A 3REJD 1EQZB 5AV5D 1AOIB 3AV2A 2CV5C 3WTPC 1P3OA 4R8PD 1R4VA 5AV9A 4KGCC 1BH9B 5B1MC 3RELC 3AN2B 1KX4B 3B6FA 4J8UD 1HQ3D 1P3BD 4CSRA 5AVBA 3B6GC 4YM6D 2CWEA 4H9SA 4E44A 5AV6B 4UPKA 2Y2OA 3MGQA 3C1CA 3AYWD 5GSUD 3H0RC 2NQBA 4XZQD 1ZLAD 2JCHA 4KHAA 3AZGD 3MNND 3LZ0C 3AZHA 3X1UD 3R45A 2NZDD 2Y2NA 5B32C 1F66C 2HIOD 4AWLB 3MGSA 3AV2C 1P3OC 5B31C 2DF4C 5AV9C 3MVDB 4XUJA 5B40D 2VQRA 3B6FC 4X23B 2F8NA 4JJND 5CPKA 4KGCB 5B1MB 2FJ7D 3RELB 3WKJA 5DNND 3C1CC 1P3KA 1KX3B 4H9PA 5E5AD 5AV8A 1M1AA 1P3IA 3AZIA 4KUDD 1TAFA 3W97D 1P3AA 5FUGB 3TU4A 5B1LA 4H9NA 3REJA 5GT0B 3LZ0B 4XUJC 4J8VD 3LELC 4R8PA 1P3GB 1F66B 5B31B 3UT9A 3P5JB 1HQ3A 5AVCC 1P3BA 5B2ID 1S32B 3UTAD 3WKJC 4YM6A 4NFTA 4G91C 1P3KC 5F99D 3REKA 5AV8C 2YFVA 5BT1C 5CPIA 1P3IC 1M1AC 4LD9D 4WZSB 3AYWA 5GSUA 3AZIC 4XZQA 1ZLAA 4Z5TD 3AZGA 3MNNA 3A6ND 2Y2GA 3H0LC 2LY8A 4Z2MG 3X1UA 3B0BA 4UUZB 2NZDA 3TU4C 5AV9D 5B1LC 3KXBA 3REJC 1KX5D 2HIOA 1M19B 1H3OB 1Z2CB 1TZYD 3EPJA 4R8PC 3R45B 2PYOB 4WJ3C 2HUEC 5AY8A 5AVBD 3UT9C 4J8UC 1HQ3C 1P3BC 3NQJB 4JJNA 1P3MD 3W96D 5BNXA 3LELB 3MGRB 2F8NB 2W8SA 4YM6C 2G5IC 3MGQD 3AZJB 2FJ7A 3REKC 2NQBD 4QLCB 5AVCB 5DNNA 5B0YB 5GSUC 3AYWC 5E5AA 2Y2QA 2YFWB 3AZHD 4XZQC 5DNMD 1ZLAC 3AZGC 4G91B 3MNNC 5AV8B 3MGSD 3X1UC 4KUDA 3UTBA 2NZDC 4H9RA 4J8XD 3X1TA 3W97A 2HIOC 2RIQA 4G92C 3REHD 5B40C 4J8VA 5CPKD 1HTAA 3W99A 4JJNC 2JE5A 2ZY5A 5AV5B 3WKJD 3O62A 2FJ7C 3UTAA 3X1SA 5GXQA 4J8UB 1P3PB 5DNNC 5E5AC 4J8WD 3X1VB 4LD9A 1P3AD 4KUDC 2BYKA 3AV1B 4Z5TA 5GSUB 3A6NA 3W97C 2XD1A 3WA9D 5G49B 1KX5A 1P3LD 4J8VC 1TZYA 2AROA 3UT9D 2ZY2A 1ID3D 5KDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 B;  4G92 B;  3O62 C;  5B40 B;  5B2I C;  3W96 A;  5B2J B;  3REK D;  1P3M A;  3UTA C;  5B32 G;  4WU8 B;  3KUY A;  5CPI D;  2BYM A;  5F99 C;  5B31 G;  3WAA D;  5BNX B;  3AZM B;  4EO5 B;  3LZ1 B;  4LD9 C;  2FJ7 B;  5DNM A;  4Z5T C;  3KXB D;  3A6N C;  4H9O B;  1BH8 B;  3AZL B;  4J8X A;  5BO0 B;  1KX5 C;  3NQU A;  4KUD B;  1TZY C;  5AY8 D;  3LJA B;  1P3F B;  3REH A;  3KSY A;  2CV5 B;  3WTP B;  5AVB C;  5CP6 A;  3VH6 A;  3VH5 A;  4H9S C;  4J8V B;  3W96 C;  1P3M C;  1EQZ D;  3MGQ C;  3AZN A;  3AZK A;  4Z66 A;  1JFI A;  2NQB C;  3B6G B;  3AN2 D;  5CPJ D;  5B2I B;  4H9Q B;  4J8W A;  3AZH C;  2F8N G;  5DNM C;  3UTB D;  5B0Z D;  3AZF D;  1P34 A;  3X1T D;  4E45 A;  5F99 B;  5AV6 D;  3MGS C;  1U35 A;  4J8X C;  4YS3 A;  3WA9 A;  3AFA A;  5B32 B;  3REH C;  3W99 D;  3A6N B;  1P3L A;  3AV2 B;  5CPK C;  5B24 D;  1P3O B;  2IO5 C;  3V9R A;  5AV9 B;  3O62 D;  1ID3 A;  5C3I C;  1TZY B;  1N1J A;  3X1S D;  3B6F B;  5GXQ D;  1ULY A;  4CSR B;  3AZN C;  3REI A;  4CAY A;  3AZE A;  5AVB B;  4WNN A;  2RVQ D;  3VH6 W;  4X23 D;  3WAA A;  4J8W C;  3VH5 W;  1P34 C;  3MGQ B;  3C1C B;  1WWI A;  1KU5 A;  1P3A C;  2NQB B;  1Q9C A;  4KHA B;  1B6W A;  5BNV A;  3MGP D;  3AZH B;  1WWS A;  4NE6 A;  1KX3 D;  2ARO D;  3VH6 T;  4Z2M H;  3WA9 C;  3AFA C;  5JRG D;  3VH5 T;  5GT3 A;  1P3L C;  3C1B A;  3MGS B;  4XUJ B;  1ID3 C;  3KUY D;  5GT0 D;  1EQZ A;  5CPK B;  2IO5 B;  5CPI C;  1BH9 A;  3WAA C;  3WKJ B;  3AN2 A;  1KX4 A;  5CPJ A;  1BFM A;  1P3K B;  4H9P B;  1S32 D;  3KWQ D;  5B0Z A;  1P3I B;  5CHL B;  3AZF A;  1M1A B;  3KXB C;  3AZI B;  5AV6 A;  4J8W B;  1TAF B;  4HGA C;  1P3A B;  4NE3 A;  2F8N K;  5AY8 C;  5CP6 D;  3TU4 B;  3B0C W;  5B1L B;  4ZBJ C;  4H9N B;  3B0D C;  3REJ B;  5B24 A;  4R8P B;  2HUE B;  3AZN D;  3AZK D;  1EQZ C;  4Z66 D;  1M19 D;  3UT9 B;  1HQ3 B;  2PYO D;  1P3B B;  3B0C T;  3AN2 C;  4YM6 B;  5CPJ C;  4X23 A;  1P34 D;  3REK B;  2YFV B;  4WNN B;  3UTB C;  5B0Z C;  5CPI B;  1U35 D;  3MGR D;  3AZF C;  3X1T C;  4KGC A;  3AYW B;  3AZJ D;  4YS3 D;  5AV6 C;  4XZQ B;  3REL A;  4ZUX D;  1ZLA B;  4QLC D;  2L5A A;  3AFA D;  3AZG B;  3MNN B;  3MGP A;  1KX3 A;  3X1U B;  5B33 D;  2NZD B;  5JRG A;  4WU9 D;  3KXB B;  3W99 C;  2HIO B;  5B24 C;  4HGA B;  3REI D;  3AZE D;  5AY8 B;  3X1S C;  4ZBJ B;  5GXQ C;  3B0D B;  4JJN B;  5GT0 A;  3LZ0 A;  2RVQ C;  1P3G A;  4X23 C;  1F66 A;  3WTP E;  5B31 A;  5DNN B;  5E5A B;  1S32 A;  3KWQ A;  5CPJ B;  1P3P D;  5GT3 D;  3MGP C;  3C1B D;  1KX3 C;  2ARO C;  5B0Z B;  3UTB B;  4H9R B;  3AZF B;  5JRG C;  3X1T B;  3X1V D;  3W97 B;  3W98 D;  3AV1 D;  4DRA A;  1AOI D;  4DRB A;  3KUY C;  4UUZ A;  3W99 B;  5GT0 C;  1M19 A;  5B24 B;  1H3O A;  1P3G C;  2PYO A;  1KX4 D;  3O62 B;  4WV4 B;  3UTA B;  3X1S B;  5GXQ B;  1M18 D;  1F1E A;  3NQJ A;  1S32 C;  5B2J D;  5JA4 A;  3KWQ C;  3LEL A;  3MGR A;  4LD9 B;  4WU8 D;  2F8N H;  3AZJ A;  2BYK B;  4ZUX A;  3AZM D;  4QLC A;  4Z5T B;  5AVC A;  3LZ1 D;  5B0Y A;  5B33 A;  2YFW A;  5BS7 A;  5CP6 C;  4WU9 A;  1KX5 B;  3MGP B;  2ARO B;  3AZL D;  2JSS A;  5JRG B;  3MVD D;  3AZK C;  4Z66 C;  1M19 C;  2PYO C;  3LJA D;  1P3F D;  1P3M B;  3W96 B;  2CV5 D;  3WTP D;  3KUY B;  4KGC D;  2BYM B;  5B1M D;  5AV5 A;  1U35 C;  3REL D;  3MGR C;  3AZJ C;  4YS3 C;  5DNM B;  4ZUX C;  4QLC C;  4J8U A;  3B6G D;  1P3P A;  5B0Y C;  5B33 C;  3KWQ B;  5BS7 C;  4J8X B;  4WU9 C;  3X1V A;  3NQU B;  3W98 A;  3REH B;  3AV1 A;  4M6B A;  3REI C;  1A7W A;  3AZE C;  3LZ0 D;  5CP6 B;  1AOI A;  4NE5 A;  1P3G D;  5G49 A;  5B32 D;  1F66 D;  5C3I B;  3AV2 D;  1P3O D;  5B31 D;  3AZN B;  3AZK B;  4Z66 B;  5AV5 C;  5KDM A;  1JFI B;  1M18 A;  3B6F D;  5B40 A;  5B2J A;  4WU8 A;  1P34 B;  1P3P C;  5GT3 C;  3C1B C;  5JA4 B;  3AZM A;  1U35 B;  3X1V C;  3LZ1 A;  4YS3 B;  3C1C D;  3W98 C;  4ZUX B;  3WA9 B;  3AFA B;  3AV1 C;  1P3L B;  4H9O A;  5B33 B;  1BH8 A;  1AOI C;  3AZL A;  3V9R B;  4WU9 B;  5BO0 A;  3MVD A;  1ID3 B;  1N1J B;  3LJA A;  1P3F A;  1KX4 C;  3REI B;  4CAY B;  3AZE B;  4XUJ D;  2CV5 A;  3WTP A;  3LEL D;  1M18 C;  2F8N D;  5B1M A;  3WAA B;  5B2J C;  4WU8 C;  1B67 A;  5AVC D;  5B0Y D;  3AZM C;  3B6G A;  4EO5 C;  3LZ1 C;  5BNV B;  5B2I A;  4H9Q A;  1P3K D;  5AV8 D;  5BT1 D;  1M1A D;  1P3I D;  5GT3 B;  3AZI D;  5F99 A;  3C1B B;  4AWL C;  3AZL C;  5FUG A;  3MVD C;  3W98 B;  3LJA C;  1P3F C;  3TU4 D;  5B1L D;  5B32 A;  3REJ D;  1EQZ B;  5AV5 D;  1AOI B;  3AV2 A;  2CV5 C;  3WTP C;  1P3O A;  4R8P D;  1R4V A;  5AV9 A;  4KGC C;  1BH9 B;  5B1M C;  3REL C;  3AN2 B;  1KX4 B;  3B6F A;  4J8U D;  1HQ3 D;  1P3B D;  4CSR A;  5AVB A;  3B6G C;  4YM6 D;  2CWE A;  4H9S A;  4E44 A;  5AV6 B;  3MGQ A;  3C1C A;  3AYW D;  5GSU D;  2NQB A;  4XZQ D;  1ZLA D;  4KHA A;  3AZG D;  3MNN D;  3LZ0 C;  3AZH A;  3X1U D;  3R45 A;  2NZD D;  5B32 C;  1F66 C;  2HIO D;  4AWL B;  3MGS A;  3AV2 C;  1P3O C;  5B31 C;  5AV9 C;  3MVD B;  4XUJ A;  5B40 D;  3B6F C;  4X23 B;  2F8N A;  4JJN D;  5CPK A;  4KGC B;  5B1M B;  2FJ7 D;  3REL B;  3WKJ A;  5DNN D;  3C1C C;  1P3K A;  1KX3 B;  4H9P A;  5E5A D;  5AV8 A;  1M1A A;  1P3I A;  3AZI A;  4KUD D;  1TAF A;  3W97 D;  1P3A A;  5FUG B;  3TU4 A;  5B1L A;  4H9N A;  3REJ A;  5GT0 B;  3LZ0 B;  4XUJ C;  4J8V D;  3LEL C;  4R8P A;  1P3G B;  1F66 B;  5B31 B;  3UT9 A;  5AVC C;  1HQ3 A;  1P3B A;  5B2I D;  1S32 B;  3UTA D;  3WKJ C;  4YM6 A;  4NFT A;  4G91 C;  1P3K C;  5F99 D;  3REK A;  5AV8 C;  2YFV A;  5BT1 C;  5CPI A;  1P3I C;  1M1A C;  4LD9 D;  4WZS B;  3AYW A;  5GSU A;  3AZI C;  4XZQ A;  1ZLA A;  4Z5T D;  3AZG A;  3MNN A;  3A6N D;  4Z2M G;  2LY8 A;  3X1U A;  3B0B A;  4UUZ B;  2NZD A;  3TU4 C;  5AV9 D;  5B1L C;  3KXB A;  3REJ C;  1KX5 D;  2HIO A;  1M19 B;  1H3O B;  1TZY D;  4R8P C;  3R45 B;  2PYO B;  2HUE C;  5AY8 A;  5AVB D;  3UT9 C;  4J8U C;  1HQ3 C;  1P3B C;  3NQJ B;  4JJN A;  1P3M D;  3W96 D;  5BNX A;  3LEL B;  3MGR B;  2F8N B;  4YM6 C;  3AZJ B;  3MGQ D;  2FJ7 A;  3REK C;  2NQB D;  4QLC B;  5AVC B;  5DNN A;  5B0Y B;  5GSU C;  3AYW C;  5E5A A;  2YFW B;  3AZH D;  4XZQ C;  5DNM D;  1ZLA C;  3AZG C;  4G91 B;  3MNN C;  5AV8 B;  3MGS D;  3X1U C;  4KUD A;  3UTB A;  2NZD C;  4H9R A;  4J8X D;  3X1T A;  3W97 A;  2HIO C;  4G92 C;  3REH D;  5B40 C;  4J8V A;  5CPK D;  1HTA A;  3W99 A;  4JJN C;  5AV5 B;  3WKJ D;  3O62 A;  2FJ7 C;  3UTA A;  3X1S A;  5GXQ A;  4J8U B;  1P3P B;  5DNN C;  5E5A C;  4J8W D;  3X1V B;  4LD9 A;  1P3A D;  4KUD C;  2BYK A;  3AV1 B;  4Z5T A;  5GSU B;  3A6N A;  3W97 C;  3WA9 D;  5G49 B;  1KX5 A;  1P3L D;  4J8V C;  1TZY A;  2ARO A;  3UT9 D;  1ID3 D;  5KDM B; 
#chains in the Genus database with same CATH topology
 1M18 B;  4G92 B;  1PZR A;  3O62 C;  5B40 B;  5B2I C;  3W96 A;  5B2J B;  3REK D;  1P3M A;  3UTA C;  5B32 G;  4WU8 B;  3KUY A;  5CPI D;  2BYM A;  5F99 C;  5B31 G;  3WAA D;  5BNX B;  3AZM B;  4EO5 B;  3LZ1 B;  4LD9 C;  2FJ7 B;  5DNM A;  4Z5T C;  3KXB D;  3A6N C;  4H9O B;  1BH8 B;  3AZL B;  4J8X A;  5BO0 B;  1KX5 C;  3NQU A;  4KUD B;  1TZY C;  5AY8 D;  3LJA B;  1P3F B;  3REH A;  3A1K A;  3KSY A;  2CV5 B;  3WTP B;  5AVB C;  5CP6 A;  3VH6 A;  3VH5 A;  4H9S C;  4J8V B;  3W96 C;  1P3M C;  1EQZ D;  3MGQ C;  3AZN A;  3AZK A;  4Z66 A;  1JFI A;  2NQB C;  3B6G B;  3AN2 D;  5CPJ D;  5B2I B;  4H9Q B;  4J8W A;  3AZH C;  2F8N G;  5DNM C;  3UTB D;  5B0Z D;  3AZF D;  1P34 A;  3H0M C;  4E45 A;  3X1T D;  5F99 B;  5AV6 D;  3MGS C;  1U35 A;  4J8X C;  1W2E A;  4YS3 A;  3WA9 A;  2ZY3 A;  5B32 B;  3AFA A;  3REH C;  3W99 D;  3A6N B;  1P3L A;  3AV2 B;  5CPK C;  5B24 D;  1P3O B;  2IO5 C;  3V9R A;  5AV9 B;  3O62 D;  1ID3 A;  5C3I C;  1TZY B;  1N1J A;  3X1S D;  3B6F B;  5GXQ D;  1ULY A;  4CSR B;  3AZN C;  3REI A;  4CAY A;  3AZE A;  5AVB B;  4WNN A;  2RVQ D;  3VH6 W;  4X23 D;  3WAA A;  4J8W C;  3VH5 W;  1P34 C;  3MGQ B;  3C1C B;  1WWI A;  1KU5 A;  1P3A C;  2NQB B;  1Q9C A;  4KHA B;  4DQY B;  1B6W A;  2UWX A;  3A1I A;  5BNV A;  1WWS A;  4NE6 A;  3MGP D;  2ARO D;  3VH6 T;  4Z2M H;  3AZH B;  1KX3 D;  3AFA C;  5JRG D;  3WA9 C;  3VH5 T;  5GT3 A;  1P3L C;  3C1B A;  3MGS B;  4XUJ B;  1ID3 C;  3KUY D;  5GT0 D;  1EQZ A;  5CPK B;  2IO5 B;  5CPI C;  1BH9 A;  3WAA C;  3WKJ B;  3AN2 A;  1KX4 A;  5CPJ A;  1BFM A;  1P3K B;  3EPK A;  4H9P B;  1S32 D;  3KWQ D;  5B0Z A;  1P3I B;  5CHL B;  3AZF A;  1M1A B;  3KXB C;  3AZI B;  5AV6 A;  4J8W B;  1TAF B;  4HGA C;  1P3A B;  4NE3 A;  2F8N K;  5AY8 C;  5CP6 D;  3TU4 B;  3B0C W;  5B1L B;  4ZBJ C;  4H9N B;  3B0D C;  3REJ B;  2G5H C;  5B24 A;  4R8P B;  2HUE B;  3AZN D;  3AZK D;  1EQZ C;  4Z66 D;  1M19 D;  3UT9 B;  1HQ3 B;  2PYO D;  1P3B B;  2J8P A;  3B0C T;  3AN2 C;  4YM6 B;  5CPJ C;  4X23 A;  1P34 D;  3REK B;  2YFV B;  4WNN B;  3UTB C;  5B0Z C;  5CPI B;  1U35 D;  3MGR D;  3AZF C;  3X1T C;  4KGC A;  3AYW B;  3AZJ D;  2ZY4 A;  5AV6 C;  4YS3 D;  4XZQ B;  3REL A;  4ZUX D;  1ZLA B;  4QLC D;  2L5A A;  3AFA D;  3AZG B;  3MNN B;  3MGP A;  1KX3 A;  3X1U B;  5B33 D;  2NZD B;  5JRG A;  4WU9 D;  3KXB B;  3W99 C;  2HIO B;  5B24 C;  3EPH A;  4HGA B;  3EPL A;  2DQN C;  3KFU G;  3REI D;  3AZE D;  5AY8 B;  3X1S C;  4ZBJ B;  5GXQ C;  3B0D B;  2ZM5 A;  5GT0 A;  4JJN B;  3LZ0 A;  2RVQ C;  1P3G A;  4X23 C;  1F66 A;  3WTP E;  5B31 A;  5DNN B;  5E5A B;  1S32 A;  3KWQ A;  5CPJ B;  1P3P D;  5GT3 D;  3MGP C;  3C1B D;  1KX3 C;  2ARO C;  5B0Z B;  3UTB B;  4H9R B;  3AZF B;  2BG1 A;  5JRG C;  3X1T B;  3X1V D;  3W97 B;  3F6T A;  3W98 D;  2FFF B;  2F2A C;  3AV1 D;  4DRA A;  1AOI D;  4DRB A;  3KUY C;  4UUZ A;  3W99 B;  5GT0 C;  2Y2H A;  1M19 A;  5B24 B;  1H3O A;  2XD5 A;  1P3G C;  2PYO A;  1KX4 D;  3O62 B;  2Y2L A;  4WV4 B;  2Y2J A;  3UTA B;  3X1S B;  5GXQ B;  1M18 D;  1F1E A;  3NQJ A;  1S32 C;  5B2J D;  5JA4 A;  3KWQ C;  3FDD A;  3LEL A;  3MGR A;  4LD9 B;  4WU8 D;  2F8N H;  3AZJ A;  2BYK B;  4ZUX A;  3AZM D;  4QLC A;  4Z5T B;  5AVC A;  3LZ1 D;  5B0Y A;  5B33 A;  2YFW A;  5BS7 A;  5CP6 C;  4WU9 A;  1KX5 B;  3MGP B;  2ARO B;  3AZL D;  2JSS A;  2Y2P A;  5JRG B;  3MVD D;  3AZK C;  4Z66 C;  1M19 C;  2PYO C;  3LJA D;  1P3F D;  1P3M B;  3W96 B;  2CV5 D;  3WTP D;  3KUY B;  4KGC D;  2BYM B;  5B1M D;  5AV5 A;  1U35 C;  3REL D;  3MGR C;  3IP4 C;  3AZJ C;  4YS3 C;  5DNM B;  4ZUX C;  4QLC C;  4J8U A;  3B6G D;  1P3P A;  5B0Y C;  5B33 C;  3KWQ B;  5BS7 C;  4J8X B;  4WU9 C;  3X1V A;  3NQU B;  3W98 A;  3REH B;  3AV1 A;  4M6B A;  3REI C;  1A7W A;  3AZE C;  3LZ0 D;  5CP6 B;  1AOI A;  4NE5 A;  1P3G D;  5G49 A;  5B32 D;  1F66 D;  5C3I B;  3AV2 D;  1P3O D;  5B31 D;  3AZN B;  3AZK B;  4Z66 B;  5AV5 C;  5KDM A;  1JFI B;  1M18 A;  3B6F D;  5B40 A;  5B2J A;  4WU8 A;  1P34 B;  1P3P C;  5GT3 C;  3C1B C;  5JA4 B;  3AZM A;  1U35 B;  3X1V C;  2Y2K A;  3LZ1 A;  4YS3 B;  3C1C D;  3W98 C;  4ZUX B;  3WA9 B;  3AFA B;  3AV1 C;  1P3L B;  4H9O A;  5B33 B;  1BH8 A;  1AOI C;  3AZL A;  3V9R B;  4WU9 B;  5BO0 A;  3MVD A;  1ID3 B;  2Y2M A;  1N1J B;  3LJA A;  1P3F A;  1KX4 C;  1T3U A;  3REI B;  4CAY B;  3AZE B;  4XUJ D;  3EG5 B;  2CV5 A;  3WTP A;  3LEL D;  1M18 C;  2F8N D;  5B1M A;  2Y2I A;  3WAA B;  5B2J C;  4WU8 C;  1B67 A;  5AVC D;  5B0Y D;  3AZM C;  3B6G A;  4EO5 C;  3LZ1 C;  5BNV B;  5B2I A;  4H9Q A;  1P3K D;  5AV8 D;  5BT1 D;  1M1A D;  1P3I D;  5GT3 B;  3AZI D;  5F99 A;  3C1B B;  4AWL C;  3AZL C;  5FUG A;  3MVD C;  3AL0 C;  3W98 B;  3LJA C;  1P3F C;  3TU4 D;  5B1L D;  5B32 A;  3REJ D;  1EQZ B;  5AV5 D;  1AOI B;  3AV2 A;  2CV5 C;  3WTP C;  1P3O A;  4R8P D;  1R4V A;  5AV9 A;  4KGC C;  1BH9 B;  5B1M C;  3REL C;  3AN2 B;  1KX4 B;  3B6F A;  4J8U D;  1HQ3 D;  1P3B D;  4CSR A;  5AVB A;  3B6G C;  4YM6 D;  2CWE A;  4H9S A;  4E44 A;  5AV6 B;  4UPK A;  2Y2O A;  3MGQ A;  3C1C A;  3AYW D;  5GSU D;  3H0R C;  2NQB A;  4XZQ D;  1ZLA D;  2JCH A;  4KHA A;  3AZG D;  3MNN D;  3LZ0 C;  3AZH A;  3X1U D;  3R45 A;  2NZD D;  2Y2N A;  5B32 C;  1F66 C;  2HIO D;  4AWL B;  3MGS A;  3AV2 C;  1P3O C;  5B31 C;  2DF4 C;  5AV9 C;  3MVD B;  4XUJ A;  5B40 D;  2VQR A;  3B6F C;  4X23 B;  2F8N A;  4JJN D;  5CPK A;  4KGC B;  5B1M B;  2FJ7 D;  3REL B;  3WKJ A;  5DNN D;  3C1C C;  1P3K A;  1KX3 B;  4H9P A;  5E5A D;  5AV8 A;  1M1A A;  1P3I A;  3AZI A;  4KUD D;  1TAF A;  3W97 D;  1P3A A;  5FUG B;  3TU4 A;  5B1L A;  4H9N A;  3REJ A;  5GT0 B;  3LZ0 B;  4XUJ C;  4J8V D;  3LEL C;  4R8P A;  1P3G B;  1F66 B;  5B31 B;  3UT9 A;  3P5J B;  1HQ3 A;  5AVC C;  1P3B A;  5B2I D;  1S32 B;  3UTA D;  3WKJ C;  4YM6 A;  4NFT A;  4G91 C;  1P3K C;  5F99 D;  3REK A;  5AV8 C;  2YFV A;  5BT1 C;  5CPI A;  1P3I C;  1M1A C;  4LD9 D;  4WZS B;  3AYW A;  5GSU A;  3AZI C;  4XZQ A;  1ZLA A;  4Z5T D;  3AZG A;  3MNN A;  3A6N D;  2Y2G A;  3H0L C;  2LY8 A;  4Z2M G;  3X1U A;  3B0B A;  4UUZ B;  2NZD A;  3TU4 C;  5AV9 D;  5B1L C;  3KXB A;  3REJ C;  1KX5 D;  2HIO A;  1M19 B;  1H3O B;  1Z2C B;  1TZY D;  3EPJ A;  4R8P C;  3R45 B;  2PYO B;  4WJ3 C;  2HUE C;  5AY8 A;  5AVB D;  3UT9 C;  4J8U C;  1HQ3 C;  1P3B C;  3NQJ B;  4JJN A;  1P3M D;  3W96 D;  5BNX A;  3LEL B;  3MGR B;  2F8N B;  2W8S A;  4YM6 C;  2G5I C;  3MGQ D;  3AZJ B;  2FJ7 A;  3REK C;  2NQB D;  4QLC B;  5AVC B;  5DNN A;  5B0Y B;  5GSU C;  3AYW C;  5E5A A;  2Y2Q A;  2YFW B;  3AZH D;  4XZQ C;  5DNM D;  1ZLA C;  3AZG C;  4G91 B;  3MNN C;  5AV8 B;  3MGS D;  3X1U C;  4KUD A;  3UTB A;  2NZD C;  4H9R A;  4J8X D;  3X1T A;  3W97 A;  2HIO C;  2RIQ A;  4G92 C;  3REH D;  5B40 C;  4J8V A;  5CPK D;  1HTA A;  3W99 A;  4JJN C;  2JE5 A;  2ZY5 A;  5AV5 B;  3WKJ D;  3O62 A;  2FJ7 C;  3UTA A;  3X1S A;  5GXQ A;  4J8U B;  1P3P B;  5DNN C;  5E5A C;  4J8W D;  3X1V B;  4LD9 A;  1P3A D;  4KUD C;  2BYK A;  3AV1 B;  4Z5T A;  5GSU B;  3A6N A;  3W97 C;  2XD1 A;  3WA9 D;  5G49 B;  1KX5 A;  1P3L D;  4J8V C;  1TZY A;  2ARO A;  3UT9 D;  2ZY2 A;  1ID3 D;  5KDM B; 
#chains in the Genus database with same CATH homology
 1M18 B;  4G92 B;  1PZR A;  3O62 C;  5B40 B;  5B2I C;  3W96 A;  5B2J B;  3REK D;  1P3M A;  3UTA C;  5B32 G;  4WU8 B;  3KUY A;  5CPI D;  2BYM A;  5F99 C;  5B31 G;  3WAA D;  5BNX B;  3AZM B;  4EO5 B;  3LZ1 B;  4LD9 C;  2FJ7 B;  5DNM A;  4Z5T C;  3KXB D;  3A6N C;  4H9O B;  1BH8 B;  3AZL B;  4J8X A;  5BO0 B;  1KX5 C;  3NQU A;  4KUD B;  1TZY C;  5AY8 D;  3LJA B;  1P3F B;  3REH A;  3A1K A;  3KSY A;  2CV5 B;  3WTP B;  5AVB C;  5CP6 A;  3VH6 A;  3VH5 A;  4H9S C;  4J8V B;  3W96 C;  1P3M C;  1EQZ D;  3MGQ C;  3AZN A;  3AZK A;  4Z66 A;  1JFI A;  2NQB C;  3B6G B;  3AN2 D;  5CPJ D;  5B2I B;  4H9Q B;  4J8W A;  3AZH C;  2F8N G;  5DNM C;  3UTB D;  5B0Z D;  3AZF D;  1P34 A;  3H0M C;  4E45 A;  3X1T D;  5F99 B;  5AV6 D;  3MGS C;  1U35 A;  4J8X C;  1W2E A;  4YS3 A;  3WA9 A;  2ZY3 A;  5B32 B;  3AFA A;  3REH C;  3W99 D;  3A6N B;  1P3L A;  3AV2 B;  5CPK C;  5B24 D;  1P3O B;  2IO5 C;  3V9R A;  5AV9 B;  3O62 D;  1ID3 A;  5C3I C;  1TZY B;  1N1J A;  3X1S D;  3B6F B;  5GXQ D;  1ULY A;  4CSR B;  3AZN C;  3REI A;  4CAY A;  3AZE A;  5AVB B;  4WNN A;  2RVQ D;  3VH6 W;  4X23 D;  3WAA A;  4J8W C;  3VH5 W;  1P34 C;  3MGQ B;  3C1C B;  1WWI A;  1KU5 A;  1P3A C;  2NQB B;  1Q9C A;  4KHA B;  4DQY B;  1B6W A;  2UWX A;  3A1I A;  5BNV A;  1WWS A;  4NE6 A;  3MGP D;  2ARO D;  3VH6 T;  4Z2M H;  3AZH B;  1KX3 D;  3AFA C;  5JRG D;  3WA9 C;  3VH5 T;  5GT3 A;  1P3L C;  3C1B A;  3MGS B;  4XUJ B;  1ID3 C;  3KUY D;  5GT0 D;  1EQZ A;  5CPK B;  2IO5 B;  5CPI C;  1BH9 A;  3WAA C;  3WKJ B;  3AN2 A;  1KX4 A;  5CPJ A;  1BFM A;  1P3K B;  3EPK A;  4H9P B;  1S32 D;  3KWQ D;  5B0Z A;  1P3I B;  5CHL B;  3AZF A;  1M1A B;  3KXB C;  3AZI B;  5AV6 A;  4J8W B;  1TAF B;  4HGA C;  1P3A B;  4NE3 A;  2F8N K;  5AY8 C;  5CP6 D;  3TU4 B;  3B0C W;  5B1L B;  4ZBJ C;  4H9N B;  3B0D C;  3REJ B;  2G5H C;  5B24 A;  4R8P B;  2HUE B;  3AZN D;  3AZK D;  1EQZ C;  4Z66 D;  1M19 D;  3UT9 B;  1HQ3 B;  2PYO D;  1P3B B;  2J8P A;  3B0C T;  3AN2 C;  4YM6 B;  5CPJ C;  4X23 A;  1P34 D;  3REK B;  2YFV B;  4WNN B;  3UTB C;  5B0Z C;  5CPI B;  1U35 D;  3MGR D;  3AZF C;  3X1T C;  4KGC A;  3AYW B;  3AZJ D;  2ZY4 A;  5AV6 C;  4YS3 D;  4XZQ B;  3REL A;  4ZUX D;  1ZLA B;  4QLC D;  2L5A A;  3AFA D;  3AZG B;  3MNN B;  3MGP A;  1KX3 A;  3X1U B;  5B33 D;  2NZD B;  5JRG A;  4WU9 D;  3KXB B;  3W99 C;  2HIO B;  5B24 C;  3EPH A;  4HGA B;  3EPL A;  2DQN C;  3KFU G;  3REI D;  3AZE D;  5AY8 B;  3X1S C;  4ZBJ B;  5GXQ C;  3B0D B;  2ZM5 A;  5GT0 A;  4JJN B;  3LZ0 A;  2RVQ C;  1P3G A;  4X23 C;  1F66 A;  3WTP E;  5B31 A;  5DNN B;  5E5A B;  1S32 A;  3KWQ A;  5CPJ B;  1P3P D;  5GT3 D;  3MGP C;  3C1B D;  1KX3 C;  2ARO C;  5B0Z B;  3UTB B;  4H9R B;  3AZF B;  2BG1 A;  5JRG C;  3X1T B;  3X1V D;  3W97 B;  3F6T A;  3W98 D;  2FFF B;  2F2A C;  3AV1 D;  4DRA A;  1AOI D;  4DRB A;  3KUY C;  4UUZ A;  3W99 B;  5GT0 C;  2Y2H A;  1M19 A;  5B24 B;  1H3O A;  2XD5 A;  1P3G C;  2PYO A;  1KX4 D;  3O62 B;  2Y2L A;  4WV4 B;  2Y2J A;  3UTA B;  3X1S B;  5GXQ B;  1M18 D;  1F1E A;  3NQJ A;  1S32 C;  5B2J D;  5JA4 A;  3KWQ C;  3FDD A;  3LEL A;  3MGR A;  4LD9 B;  4WU8 D;  2F8N H;  3AZJ A;  2BYK B;  4ZUX A;  3AZM D;  4QLC A;  4Z5T B;  5AVC A;  3LZ1 D;  5B0Y A;  5B33 A;  2YFW A;  5BS7 A;  5CP6 C;  4WU9 A;  1KX5 B;  3MGP B;  2ARO B;  3AZL D;  2JSS A;  2Y2P A;  5JRG B;  3MVD D;  3AZK C;  4Z66 C;  1M19 C;  2PYO C;  3LJA D;  1P3F D;  1P3M B;  3W96 B;  2CV5 D;  3WTP D;  3KUY B;  4KGC D;  2BYM B;  5B1M D;  5AV5 A;  1U35 C;  3REL D;  3MGR C;  3IP4 C;  3AZJ C;  4YS3 C;  5DNM B;  4ZUX C;  4QLC C;  4J8U A;  3B6G D;  1P3P A;  5B0Y C;  5B33 C;  3KWQ B;  5BS7 C;  4J8X B;  4WU9 C;  3X1V A;  3NQU B;  3W98 A;  3REH B;  3AV1 A;  4M6B A;  3REI C;  1A7W A;  3AZE C;  3LZ0 D;  5CP6 B;  1AOI A;  4NE5 A;  1P3G D;  5G49 A;  5B32 D;  1F66 D;  5C3I B;  3AV2 D;  1P3O D;  5B31 D;  3AZN B;  3AZK B;  4Z66 B;  5AV5 C;  5KDM A;  1JFI B;  1M18 A;  3B6F D;  5B40 A;  5B2J A;  4WU8 A;  1P34 B;  1P3P C;  5GT3 C;  3C1B C;  5JA4 B;  3AZM A;  1U35 B;  3X1V C;  2Y2K A;  3LZ1 A;  4YS3 B;  3C1C D;  3W98 C;  4ZUX B;  3WA9 B;  3AFA B;  3AV1 C;  1P3L B;  4H9O A;  5B33 B;  1BH8 A;  1AOI C;  3AZL A;  3V9R B;  4WU9 B;  5BO0 A;  3MVD A;  1ID3 B;  2Y2M A;  1N1J B;  3LJA A;  1P3F A;  1KX4 C;  1T3U A;  3REI B;  4CAY B;  3AZE B;  4XUJ D;  3EG5 B;  2CV5 A;  3WTP A;  3LEL D;  1M18 C;  2F8N D;  5B1M A;  2Y2I A;  3WAA B;  5B2J C;  4WU8 C;  1B67 A;  5AVC D;  5B0Y D;  3AZM C;  3B6G A;  4EO5 C;  3LZ1 C;  5BNV B;  5B2I A;  4H9Q A;  1P3K D;  5AV8 D;  5BT1 D;  1M1A D;  1P3I D;  5GT3 B;  3AZI D;  5F99 A;  3C1B B;  4AWL C;  3AZL C;  5FUG A;  3MVD C;  3AL0 C;  3W98 B;  3LJA C;  1P3F C;  3TU4 D;  5B1L D;  5B32 A;  3REJ D;  1EQZ B;  5AV5 D;  1AOI B;  3AV2 A;  2CV5 C;  3WTP C;  1P3O A;  4R8P D;  1R4V A;  5AV9 A;  4KGC C;  1BH9 B;  5B1M C;  3REL C;  3AN2 B;  1KX4 B;  3B6F A;  4J8U D;  1HQ3 D;  1P3B D;  4CSR A;  5AVB A;  3B6G C;  4YM6 D;  2CWE A;  4H9S A;  4E44 A;  5AV6 B;  4UPK A;  2Y2O A;  3MGQ A;  3C1C A;  3AYW D;  5GSU D;  3H0R C;  2NQB A;  4XZQ D;  1ZLA D;  2JCH A;  4KHA A;  3AZG D;  3MNN D;  3LZ0 C;  3AZH A;  3X1U D;  3R45 A;  2NZD D;  2Y2N A;  5B32 C;  1F66 C;  2HIO D;  4AWL B;  3MGS A;  3AV2 C;  1P3O C;  5B31 C;  2DF4 C;  5AV9 C;  3MVD B;  4XUJ A;  5B40 D;  2VQR A;  3B6F C;  4X23 B;  2F8N A;  4JJN D;  5CPK A;  4KGC B;  5B1M B;  2FJ7 D;  3REL B;  3WKJ A;  5DNN D;  3C1C C;  1P3K A;  1KX3 B;  4H9P A;  5E5A D;  5AV8 A;  1M1A A;  1P3I A;  3AZI A;  4KUD D;  1TAF A;  3W97 D;  1P3A A;  5FUG B;  3TU4 A;  5B1L A;  4H9N A;  3REJ A;  5GT0 B;  3LZ0 B;  4XUJ C;  4J8V D;  3LEL C;  4R8P A;  1P3G B;  1F66 B;  5B31 B;  3UT9 A;  3P5J B;  1HQ3 A;  5AVC C;  1P3B A;  5B2I D;  1S32 B;  3UTA D;  3WKJ C;  4YM6 A;  4NFT A;  4G91 C;  1P3K C;  5F99 D;  3REK A;  5AV8 C;  2YFV A;  5BT1 C;  5CPI A;  1P3I C;  1M1A C;  4LD9 D;  4WZS B;  3AYW A;  5GSU A;  3AZI C;  4XZQ A;  1ZLA A;  4Z5T D;  3AZG A;  3MNN A;  3A6N D;  2Y2G A;  3H0L C;  2LY8 A;  4Z2M G;  3X1U A;  3B0B A;  4UUZ B;  2NZD A;  3TU4 C;  5AV9 D;  5B1L C;  3KXB A;  3REJ C;  1KX5 D;  2HIO A;  1M19 B;  1H3O B;  1Z2C B;  1TZY D;  3EPJ A;  4R8P C;  3R45 B;  2PYO B;  4WJ3 C;  2HUE C;  5AY8 A;  5AVB D;  3UT9 C;  4J8U C;  1HQ3 C;  1P3B C;  3NQJ B;  4JJN A;  1P3M D;  3W96 D;  5BNX A;  3LEL B;  3MGR B;  2F8N B;  2W8S A;  4YM6 C;  2G5I C;  3MGQ D;  3AZJ B;  2FJ7 A;  3REK C;  2NQB D;  4QLC B;  5AVC B;  5DNN A;  5B0Y B;  5GSU C;  3AYW C;  5E5A A;  2Y2Q A;  2YFW B;  3AZH D;  4XZQ C;  5DNM D;  1ZLA C;  3AZG C;  4G91 B;  3MNN C;  5AV8 B;  3MGS D;  3X1U C;  4KUD A;  3UTB A;  2NZD C;  4H9R A;  4J8X D;  3X1T A;  3W97 A;  2HIO C;  2RIQ A;  4G92 C;  3REH D;  5B40 C;  4J8V A;  5CPK D;  1HTA A;  3W99 A;  4JJN C;  2JE5 A;  2ZY5 A;  5AV5 B;  3WKJ D;  3O62 A;  2FJ7 C;  3UTA A;  3X1S A;  5GXQ A;  4J8U B;  1P3P B;  5DNN C;  5E5A C;  4J8W D;  3X1V B;  4LD9 A;  1P3A D;  4KUD C;  2BYK A;  3AV1 B;  4Z5T A;  5GSU B;  3A6N A;  3W97 C;  2XD1 A;  3WA9 D;  5G49 B;  1KX5 A;  1P3L D;  4J8V C;  1TZY A;  2ARO A;  3UT9 D;  2ZY2 A;  1ID3 D;  5KDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...