4Z5TC

The nucleosome containing human h3.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tC00
4H9OA 5B24B 2HIOD 3UT9C 2NZDD 5BO0A 3VH6A 2HIOA 1P34D 1M19C 2NZDA 4CSRA 5JA4B 2PYOC 4WU8B 3TU4C 1P34A 4XUJB 1F1EA 3AV2D 5AV6D 1P3LD 2L5AA 3REHB 5GT3B 4WZSB 3AZGB 4H9SC 5AV6A 1P3LA 3W97D 5B1MB 1P3AB 4ZUXC 3AFAB 4AWLC 3AZFC 3W97A 1EQZC 3B0DC 3C1BB 3V9RB 2AROC 1KX5D 4J8UA 4Z66B 5B2IB 5GT0D 3KWQB 2YFVB 5B40D 4KGCA 1ID3A 4QLCA 1HQ3C 3WKJA 5B40A 4J8VB 4E44A 5F99C 1M19B 3MNNC 1P3BB 2PYOB 2F8NG 1AOIC 5AVBD 3AZED 5B32C 3AN2D 3MGSC 3AZID 5B1LA 5AVBA 1P3KD 4UUZA 3B6FC 3AZIA 5GXQC 3AZHD 1U35C 3KSYA 2BYMA 4ZUXB 4KUDC 1N1JB 4G92C 3AZNA 4AWLB 3AZHA 3AZFB 4H9PA 5CPKD 3WA9A 5FUGB 1EQZB 2AROB 5BS7A 2FJ7A 3VH6T 3AV1A 5BNVB 3R45A 5JRGD 3MGPD 4YS3D 3RELC 3MGQC 4LD9D 3UTBC 5CPJC 5KDMB 4NFTA 1HQ3B 1P3GC 5JRGA 3AZLA 1BH9B 1JFIB 3LJAC 5F99B 3VH6W 5AV5D 3REJD 3X1UC 5BNXA 5B33A 4Z2MH 3REID 1P3OB 5B32B 3MGSB 4ZBJC 3REKC 3LELD 3AZKA 1KX4D 3W99A 5AVCA 1P3PD 1S32C 1U35B 3LELA 3W98D 5B0YB 5GSUC 4KUDB 1P3PA 4G92B 5DNNA 2CV5C 3X1VC 3MGRB 4XZQC 5CP6B 5AY8B 3AZJD 3X1TA 1P3FC 3AYWD 1A7WA 2BYKB 3RELB 3MGQB 4X23A 3UTBB 5CPJB 1P3GB 3LJAB 2HIOC 3LZ1D 3X1UB 5G49A 1BH8B 2CWEA 4ZBJB 4XUJC 3REKB 1TZYD 1M18A 5DNMD 4KHAB 4JJND 1H3OB 1S32B 4WNNB 3AZGC 1ZLAA 3NQUB 5GSUB 5B2JD 4J8XA 3WTPE 4Z5TD 3AFAC 3X1VB 3MVDD 2CV5B 4XZQB 4R8PB 5B2JA 4J8UC 3C1BC 3WAAD 2YFWB 4Z5TA 3X1SD 3MVDA 3LZ0D 3KXBD 3UTAA 2NQBD 3AZMD 4KGCC 4H9OB 3WAAA 4YM6D 1ID3C 1WWIA 4H9RA 3X1SA 4QLCC 3WTPA 5BO0B 3WKJC 3O62D 5B40C 1B67A 2HIOB 3W96D 5B0ZD 4J8VC 4CSRB 3O62A 1F66D 1P3BC 1P34B 2F8ND 1F66A 5BT1D 5B1LC 5AVBC 4E45A 2F8NA 5AV6B 3AV2A 4J8WD 1P3LB 5AV8D 5B24D 1M1AD 3AZNC 4J8WA 5AV8A 3WA9C 3W97B 4WV4B 1M1AA 1B6WA 5BS7C 4J8UB 2FJ7C 3AV1C 1TAFA 3B6GD 4KGCB 1KX5A 1ID3B 4QLCB 1P3MD 5GT0A 3B6GA 3WKJB 3REHD 3AZLC 5GT3D 5B40B 1P3MA 5B1MD 4WU9D 5B33C 5B31G 1P3OC 4WU9A 3AZKC 5B1LB 3W99C 5B2ID 4Z66D 5AVBB 3KWQD 4UUZB 5AVCC 3AZEA 3AZIB 3AN2A 3LELC 3UT9D 2BYMB 5B0YC 3AZNB 1P3PC 5DNNC 1P3KA 3AZHB 4H9PB 4Z2MG 3WA9B 3MGRC 3UT9A 1M19D 2FJ7B 5CP6C 3X1TC 3AV1B 2PYOD 5AY8C 3TU4D 5CPKA 3R45B 3C1CC 1Q9CA 4X23C 3TU4A 5JRGB 3AZLB 2LY8A 3MGPA 3NQJA 4YS3A 4LD9A 4ZUXD 5BNXB 5B33B 4H9SA 3AZFD 1M18C 1EQZD 5AV5A 3AZKB 3W99B 3REJA 5AVCB 3REIA 3LELB 1P3ID 1ZLAC 1KX4A 1P3PB 5DNNB 4J8XC 1HQ3D 1P3IA 5F99D 3W98A 3MNND 4R8PC 3X1TB 1AOID 3A6ND 3UTAC 3MGSD 3C1CB 4EO5C 3MNNA 3WTPC 4X23B 3KUYD 4G91C 1AOIA 3AZJA 5CPID 3A6NA 4HGAC 4NE6A 3AYWA 3B6FD 5GXQD 5AV9D 3KUYA 1U35D 5CPIA 2NZDC 5G49B 3B6FA 5GXQA 5AV9A 1P34C 1M18B 3LZ1A 1BFMA 3AV2C 1TZYA 5DNMA 5AV6C 1ZLAB 3RELD 1P3LC 3UTBD 5CPJD 4JJNA 4J8XB 1P3GD 5E5AD 5AV8C 3LJAD 1M1AC 3W97C 5B2JB 4H9QA 5C3IC 4Z5TB 5E5AA 3MVDB 3X1UD 5B32G 3UTAB 3WAAB 4EO5B 1KX5C 3WTPB 4H9RB 3X1SB 4G91B 5GT0C 3LZ0A 4CAYA 4HGAB 3KXBA 2NQBA 3AZMA 4YM6A 2RVQD 2NZDB 4DRBA 1ULYA 2CV5D 3X1VD 3W96A 5B0ZA 5B31D 4XZQD 1KX3D 1F66B 4H9NA 1P3FD 2F8NB 3AZEC 5B31A 3AN2C 1KX3A 3AV2B 3AZIC 4M6BA 1P3FA 1P3KC 4J8WB 5AV8B 3AZHC 1M1AB 5B24A 5C3IB 1TAFB 5CPKC 4WU8D 4XUJD 1KX5B 5JA4A 5GT0B 3B6GB 4WU8A 4XUJA 5JRGC 3MGPC 4YS3C 3AZGD 1P3MB 4LD9C 3REHA 1P3AD 5GT3A 3AFAD 3AZGA 4WU9B 3VH5A 5AV5C 5B1MA 4J8UD 1P3AA 3C1BD 3REJC 3AFAA 3REIC 3AZEB 3AN2B 4KGCD 3C1BA 3V9RA 1KX4C 1ID3D 4QLCD 5B2IA 4Z66A 3KWQA 1P3KB 3WKJD 1P3IC 2YFVA 3UT9B 3W98C 4J8VD 1P3BD 5CPKB 4J8VA 1M19A 2JSSA 1P3BA 5B1LD 3TU4B 3AZJC 3A6NC 2PYOA 4DRAA 3AYWC 3MGPB 3NQJB 3KUYC 4YS3B 5CPIC 4LD9B 1KU5A 3AZND 5AV9C 3WA9D 5AV5B 2FJ7D 3LZ1C 3REJB 4ZUXA 2AROD 1N1JA 3REIB 3AV1D 3B0CT 3AZFA 3B0DB 1TZYC 5FUGA 5DNMC 1EQZA 2AROA 1KX4B 2F8NH 4JJNC 5BNVA 3AZLD 1P3IB 3W98B 3B0CW 5E5AC 5B2JC 5KDMA 1HQ3A 4Z5TC 5B33D 3MVDC 1BH9A 1JFIA 5F99A 1P3OD 3MNNB 5B32D 3WAAC 3AZKD 3AZJB 3W99D 1AOIB 3X1SC 3A6NB 3LZ0C 2IO5C 4NE5A 5AVCD 3KXBC 3AYWB 1P3OA 2NQBC 5B32A 3AZMC 3VH5T 3MGSA 3KUYB 4YM6C 5CPIB 5B0YD 3O62C 3B6FB 5DNND 5GXQB 5AV9B 4KUDD 3W96C 2RVQC 5B0ZC 1U35A 3B0BA 3MGRD 2F8NK 5B0YA 3LZ1B 1F66C 5CP6D 3X1TD 4KUDA 3VH5W 2HUEC 5AY8D 5B31C 3MGRA 1KX3C 1R4VA 1TZYB 4NE3A 3C1CD 5DNMB 5BT1C 5CP6A 4X23D 5AY8A 4JJNB 3MGQD 1WWSA 3C1CA 4J8WC 2BYKA 5B24C 3RELA 1HTAA 4H9QB 3MGQA 3UTBA 5E5AB 5CPJA 1P3GA 3LJAA 1M18D 3REKD 3LZ0B 2IO5B 4CAYB 3X1UA 3KXBB 4WU8C 1BH8A 3B6GC 2NQBB 3AZMB 3REKA 4YM6B 1ZLAD 1S32D 4KHAA 1P3MC 3O62B 3REHC 5GT3C 4J8XD 5GSUD 1H3OA 3W96B 5B0ZB 1S32A 4WNNA 4H9NB 5B1MC 5CHLB 4WU9C 1P3AC 3NQUA 5GSUA 4R8PD 2HUEB 5B31B 2CV5A 3X1VA 1KX3B 3UTAD 4XZQA 1P3FB 4R8PA 3WTPD 5B2IC 4Z66C 2YFWA 3KWQC
chains in the Genus database with same CATH superfamily
4H9OA 5B24B 2HIOD 3UT9C 2NZDD 5BO0A 3KFUG 3VH6A 2HIOA 1P34D 1M19C 2NZDA 4CSRA 5JA4B 2PYOC 4WU8B 3TU4C 1P34A 4XUJB 1F1EA 3AV2D 5AV6D 1P3LD 2L5AA 2Y2JA 3REHB 5GT3B 4WZSB 3AZGB 4H9SC 5AV6A 1P3LA 2ZM5A 3W97D 5B1MB 1P3AB 4ZUXC 3H0MC 3AFAB 4AWLC 3AZFC 2FFFB 3AL0C 3W97A 1EQZC 3B0DC 3C1BB 3V9RB 2AROC 1KX5D 4J8UA 4Z66B 5B2IB 5GT0D 3KWQB 2YFVB 5B40D 4KGCA 1ID3A 4QLCA 4DQYB 1HQ3C 3WKJA 5B40A 4J8VB 4E44A 5F99C 1M19B 3MNNC 1P3BB 3FDDA 2PYOB 2F8NG 1AOIC 5AVBD 3AZED 5B32C 3AN2D 3MGSC 3AZID 5B1LA 5AVBA 1P3KD 4UUZA 3B6FC 3AZIA 5GXQC 3AZHD 1U35C 3KSYA 2BYMA 4ZUXB 4KUDC 1N1JB 4G92C 3AZNA 4AWLB 3AZHA 3AZFB 4H9PA 5CPKD 3WA9A 5FUGB 1EQZB 2AROB 5BS7A 2FJ7A 3VH6T 3AV1A 5BNVB 3R45A 5JRGD 3MGPD 4YS3D 3RELC 3MGQC 4LD9D 3UTBC 5CPJC 5KDMB 4NFTA 1HQ3B 1P3GC 5JRGA 3AZLA 1BH9B 1JFIB 2W8SA 3LJAC 5F99B 3VH6W 5AV5D 3REJD 3X1UC 5BNXA 5B33A 4Z2MH 3REID 1P3OB 5B32B 3MGSB 4ZBJC 3REKC 3LELD 3AZKA 1KX4D 3W99A 5AVCA 1P3PD 1S32C 1U35B 3LELA 3W98D 4UPKA 5B0YB 5GSUC 4KUDB 1P3PA 4G92B 5DNNA 2CV5C 3X1VC 3MGRB 1PZRA 4XZQC 5CP6B 5AY8B 3AZJD 3X1TA 1P3FC 3AYWD 1A7WA 2BYKB 3RELB 3MGQB 4X23A 3UTBB 5CPJB 1P3GB 3LJAB 2HIOC 3LZ1D 3X1UB 5G49A 1BH8B 2CWEA 4ZBJB 4XUJC 3REKB 1TZYD 1M18A 5DNMD 4KHAB 4JJND 1H3OB 1S32B 4WNNB 3AZGC 1ZLAA 3NQUB 5GSUB 2G5HC 5B2JD 4J8XA 3WTPE 4Z5TD 3AFAC 3X1VB 3MVDD 2CV5B 4XZQB 4R8PB 5B2JA 4J8UC 3C1BC 3WAAD 2YFWB 4Z5TA 2Y2GA 3X1SD 3MVDA 3LZ0D 3KXBD 3UTAA 2NQBD 3AZMD 4KGCC 4H9OB 3WAAA 4YM6D 1ID3C 1WWIA 2XD5A 4H9RA 3X1SA 4QLCC 5BO0B 3WTPA 3WKJC 3O62D 5B40C 1B67A 2HIOB 3W96D 5B0ZD 4J8VC 4CSRB 3O62A 1F66D 1P3BC 1P34B 2F8ND 2Y2MA 1F66A 5BT1D 3EPJA 5B1LC 5AVBC 4E45A 2F8NA 5AV6B 3AV2A 4J8WD 1P3LB 5AV8D 5B24D 1M1AD 3AZNC 4J8WA 5AV8A 3WA9C 3W97B 4WV4B 1M1AA 1B6WA 5BS7C 4J8UB 2FJ7C 3AV1C 1TAFA 3B6GD 2BG1A 4KGCB 1KX5A 1ID3B 4QLCB 1P3MD 5GT0A 3B6GA 3A1KA 3REHD 3AZLC 5GT3D 5B40B 1W2EA 3WKJB 1P3MA 5B1MD 4WU9D 2Y2IA 5B33C 5B31G 1P3OC 2UWXA 4WU9A 3AZKC 5B1LB 3W99C 5B2ID 4Z66D 5AVBB 3KWQD 4UUZB 5AVCC 3AZEA 3AZIB 3AN2A 3LELC 1Z2CB 3UT9D 2BYMB 5B0YC 3AZNB 1P3PC 5DNNC 1P3KA 3AZHB 1T3UA 4H9PB 4WJ3C 4Z2MG 3WA9B 3MGRC 3UT9A 1M19D 2FJ7B 3EPHA 5CP6C 3X1TC 3AV1B 2PYOD 5AY8C 3TU4D 5CPKA 3R45B 3C1CC 1Q9CA 4X23C 3H0RC 3TU4A 5JRGB 3AZLB 2LY8A 3MGPA 3NQJA 4YS3A 4LD9A 4ZUXD 2G5IC 5BNXB 5B33B 4H9SA 3AZFD 3EPKA 1M18C 1EQZD 5AV5A 3AZKB 3W99B 3P5JB 3REJA 5AVCB 3REIA 3LELB 1P3ID 1ZLAC 1KX4A 1P3PB 5DNNB 2ZY4A 4J8XC 1HQ3D 1P3IA 5F99D 3W98A 3MNND 4R8PC 3X1TB 1AOID 3A6ND 3UTAC 3MGSD 3C1CB 4EO5C 3MNNA 3WTPC 4X23B 3KUYD 4G91C 1AOIA 3AZJA 2DQNC 2ZY3A 5CPID 3A6NA 4HGAC 4NE6A 3AYWA 3B6FD 5GXQD 5AV9D 3KUYA 1U35D 5CPIA 2NZDC 5G49B 3B6FA 5GXQA 5AV9A 1P34C 1M18B 3LZ1A 1BFMA 3AV2C 1TZYA 5DNMA 5AV6C 1ZLAB 3RELD 1P3LC 3UTBD 5CPJD 4JJNA 4J8XB 1P3GD 5E5AD 5AV8C 3LJAD 1M1AC 2Y2KA 3W97C 5B2JB 4H9QA 5C3IC 4Z5TB 5E5AA 2Y2NA 3MVDB 3X1UD 5B32G 3UTAB 3WAAB 4EO5B 1KX5C 3WTPB 4H9RB 3X1SB 4G91B 5GT0C 3LZ0A 4CAYA 2JE5A 4HGAB 3KXBA 2NQBA 3AZMA 4YM6A 2RVQD 2NZDB 4DRBA 1ULYA 2CV5D 3X1VD 3W96A 5B0ZA 5B31D 4XZQD 1KX3D 1F66B 4H9NA 1P3FD 2F8NB 3AZEC 5B31A 3AN2C 1KX3A 3AV2B 3AZIC 4M6BA 1P3FA 1P3KC 4J8WB 5AV8B 3AZHC 1M1AB 5B24A 5C3IB 1TAFB 5CPKC 4WU8D 4XUJD 1KX5B 5JA4A 5GT0B 3B6GB 4WU8A 4XUJA 5JRGC 3MGPC 4YS3C 3AZGD 1P3MB 4LD9C 3REHA 1P3AD 5GT3A 3AFAD 3AZGA 4WU9B 3VH5A 5AV5C 5B1MA 4J8UD 1P3AA 3C1BD 3REJC 3AFAA 3REIC 3F6TA 3AZEB 3AN2B 4KGCD 2DF4C 2JCHA 3C1BA 3V9RA 1KX4C 1ID3D 4QLCD 5B2IA 4Z66A 2F2AC 3KWQA 1P3KB 3WKJD 1P3IC 2YFVA 3UT9B 3W98C 4J8VD 1P3BD 5CPKB 4J8VA 1M19A 2JSSA 2Y2OA 5B1LD 3TU4B 3AZJC 1P3BA 3A6NC 2PYOA 4DRAA 3AYWC 3EPLA 3MGPB 3NQJB 3KUYC 4YS3B 5CPIC 4LD9B 1KU5A 3AZND 5AV9C 2J8PA 3WA9D 5AV5B 2FJ7D 3LZ1C 3REJB 4ZUXA 2AROD 1N1JA 2ZY2A 3REIB 3AV1D 3B0CT 2XD1A 3AZFA 3B0DB 1TZYC 5FUGA 5DNMC 1EQZA 2AROA 1KX4B 2F8NH 4JJNC 5BNVA 3AZLD 1P3IB 3W98B 3B0CW 5E5AC 5B2JC 5KDMA 1HQ3A 4Z5TC 5B33D 3MVDC 1BH9A 1JFIA 5F99A 1P3OD 3MNNB 2Y2QA 5B32D 3WAAC 3AZKD 3AZJB 3W99D 1AOIB 3X1SC 3A6NB 3LZ0C 2IO5C 4NE5A 5AVCD 3KXBC 3AYWB 1P3OA 2NQBC 5B32A 3AZMC 3VH5T 3MGSA 3KUYB 4YM6C 3A1IA 5CPIB 5B0YD 3O62C 3B6FB 5DNND 5GXQB 5AV9B 4KUDD 3W96C 2RVQC 5B0ZC 2Y2LA 1U35A 3B0BA 3MGRD 2F8NK 2Y2PA 5B0YA 3LZ1B 1F66C 5CP6D 3X1TD 4KUDA 3VH5W 2HUEC 5AY8D 5B31C 3MGRA 1KX3C 1R4VA 1TZYB 4NE3A 3C1CD 5DNMB 5BT1C 5CP6A 4X23D 5AY8A 4JJNB 3MGQD 2VQRA 1WWSA 3C1CA 4J8WC 2BYKA 5B24C 3RELA 1HTAA 4H9QB 3MGQA 3UTBA 5E5AB 5CPJA 1P3GA 3LJAA 1M18D 3EG5B 2Y2HA 3REKD 3LZ0B 2IO5B 4CAYB 3X1UA 3KXBB 4WU8C 1BH8A 3H0LC 3B6GC 2NQBB 2ZY5A 3AZMB 3REKA 4YM6B 1ZLAD 1S32D 4KHAA 1P3MC 3O62B 3REHC 5GT3C 4J8XD 5GSUD 1H3OA 3W96B 5B0ZB 1S32A 4WNNA 4H9NB 5B1MC 5CHLB 4WU9C 1P3AC 3NQUA 5GSUA 4R8PD 2HUEB 5B31B 2CV5A 3X1VA 1KX3B 2RIQA 3UTAD 4XZQA 3IP4C 1P3FB 4R8PA 3WTPD 5B2IC 4Z66C 2YFWA 3KWQC
chains in the Genus database with same CATH topology
4H9OA 5B24B 2HIOD 3UT9C 2NZDD 5BO0A 3KFUG 3VH6A 2HIOA 1P34D 1M19C 2NZDA 4CSRA 5JA4B 2PYOC 4WU8B 3TU4C 1P34A 4XUJB 1F1EA 3AV2D 5AV6D 1P3LD 2L5AA 2Y2JA 3REHB 5GT3B 4WZSB 3AZGB 4H9SC 5AV6A 1P3LA 2ZM5A 3W97D 5B1MB 1P3AB 4ZUXC 3H0MC 3AFAB 4AWLC 3AZFC 2FFFB 3AL0C 3W97A 1EQZC 3B0DC 3C1BB 3V9RB 2AROC 1KX5D 4J8UA 4Z66B 5B2IB 5GT0D 3KWQB 2YFVB 5B40D 4KGCA 1ID3A 4QLCA 4DQYB 1HQ3C 3WKJA 5B40A 4J8VB 4E44A 5F99C 1M19B 3MNNC 1P3BB 3FDDA 2PYOB 2F8NG 1AOIC 5AVBD 3AZED 5B32C 3AN2D 3MGSC 3AZID 5B1LA 5AVBA 1P3KD 4UUZA 3B6FC 3AZIA 5GXQC 3AZHD 1U35C 3KSYA 2BYMA 4ZUXB 4KUDC 1N1JB 4G92C 3AZNA 4AWLB 3AZHA 3AZFB 4H9PA 5CPKD 3WA9A 5FUGB 1EQZB 2AROB 5BS7A 2FJ7A 3VH6T 3AV1A 5BNVB 3R45A 5JRGD 3MGPD 4YS3D 3RELC 3MGQC 4LD9D 3UTBC 5CPJC 5KDMB 4NFTA 1HQ3B 1P3GC 5JRGA 3AZLA 1BH9B 1JFIB 2W8SA 3LJAC 5F99B 3VH6W 5AV5D 3REJD 3X1UC 5BNXA 5B33A 4Z2MH 3REID 1P3OB 5B32B 3MGSB 4ZBJC 3REKC 3LELD 3AZKA 1KX4D 3W99A 5AVCA 1P3PD 1S32C 1U35B 3LELA 3W98D 4UPKA 5B0YB 5GSUC 4KUDB 1P3PA 4G92B 5DNNA 2CV5C 3X1VC 3MGRB 1PZRA 4XZQC 5CP6B 5AY8B 3AZJD 3X1TA 1P3FC 3AYWD 1A7WA 2BYKB 3RELB 3MGQB 4X23A 3UTBB 5CPJB 1P3GB 3LJAB 2HIOC 3LZ1D 3X1UB 5G49A 1BH8B 2CWEA 4ZBJB 4XUJC 3REKB 1TZYD 1M18A 5DNMD 4KHAB 4JJND 1H3OB 1S32B 4WNNB 3AZGC 1ZLAA 3NQUB 5GSUB 2G5HC 5B2JD 4J8XA 3WTPE 4Z5TD 3AFAC 3X1VB 3MVDD 2CV5B 4XZQB 4R8PB 5B2JA 4J8UC 3C1BC 3WAAD 2YFWB 4Z5TA 2Y2GA 3X1SD 3MVDA 3LZ0D 3KXBD 3UTAA 2NQBD 3AZMD 4KGCC 4H9OB 3WAAA 4YM6D 1ID3C 1WWIA 2XD5A 4H9RA 3X1SA 4QLCC 5BO0B 3WTPA 3WKJC 3O62D 5B40C 1B67A 2HIOB 3W96D 5B0ZD 4J8VC 4CSRB 3O62A 1F66D 1P3BC 1P34B 2F8ND 2Y2MA 1F66A 5BT1D 3EPJA 5B1LC 5AVBC 4E45A 2F8NA 5AV6B 3AV2A 4J8WD 1P3LB 5AV8D 5B24D 1M1AD 3AZNC 4J8WA 5AV8A 3WA9C 3W97B 4WV4B 1M1AA 1B6WA 5BS7C 4J8UB 2FJ7C 3AV1C 1TAFA 3B6GD 2BG1A 4KGCB 1KX5A 1ID3B 4QLCB 1P3MD 5GT0A 3B6GA 3A1KA 3REHD 3AZLC 5GT3D 5B40B 1W2EA 3WKJB 1P3MA 5B1MD 4WU9D 2Y2IA 5B33C 5B31G 1P3OC 2UWXA 4WU9A 3AZKC 5B1LB 3W99C 5B2ID 4Z66D 5AVBB 3KWQD 4UUZB 5AVCC 3AZEA 3AZIB 3AN2A 3LELC 1Z2CB 3UT9D 2BYMB 5B0YC 3AZNB 1P3PC 5DNNC 1P3KA 3AZHB 1T3UA 4H9PB 4WJ3C 4Z2MG 3WA9B 3MGRC 3UT9A 1M19D 2FJ7B 3EPHA 5CP6C 3X1TC 3AV1B 2PYOD 5AY8C 3TU4D 5CPKA 3R45B 3C1CC 1Q9CA 4X23C 3H0RC 3TU4A 5JRGB 3AZLB 2LY8A 3MGPA 3NQJA 4YS3A 4LD9A 4ZUXD 2G5IC 5BNXB 5B33B 4H9SA 3AZFD 3EPKA 1M18C 1EQZD 5AV5A 3AZKB 3W99B 3P5JB 3REJA 5AVCB 3REIA 3LELB 1P3ID 1ZLAC 1KX4A 1P3PB 5DNNB 2ZY4A 4J8XC 1HQ3D 1P3IA 5F99D 3W98A 3MNND 4R8PC 3X1TB 1AOID 3A6ND 3UTAC 3MGSD 3C1CB 4EO5C 3MNNA 3WTPC 4X23B 3KUYD 4G91C 1AOIA 3AZJA 2DQNC 2ZY3A 5CPID 3A6NA 4HGAC 4NE6A 3AYWA 3B6FD 5GXQD 5AV9D 3KUYA 1U35D 5CPIA 2NZDC 5G49B 3B6FA 5GXQA 5AV9A 1P34C 1M18B 3LZ1A 1BFMA 3AV2C 1TZYA 5DNMA 5AV6C 1ZLAB 3RELD 1P3LC 3UTBD 5CPJD 4JJNA 4J8XB 1P3GD 5E5AD 5AV8C 3LJAD 1M1AC 2Y2KA 3W97C 5B2JB 4H9QA 5C3IC 4Z5TB 5E5AA 2Y2NA 3MVDB 3X1UD 5B32G 3UTAB 3WAAB 4EO5B 1KX5C 3WTPB 4H9RB 3X1SB 4G91B 5GT0C 3LZ0A 4CAYA 2JE5A 4HGAB 3KXBA 2NQBA 3AZMA 4YM6A 2RVQD 2NZDB 4DRBA 1ULYA 2CV5D 3X1VD 3W96A 5B0ZA 5B31D 4XZQD 1KX3D 1F66B 4H9NA 1P3FD 2F8NB 3AZEC 5B31A 3AN2C 1KX3A 3AV2B 3AZIC 4M6BA 1P3FA 1P3KC 4J8WB 5AV8B 3AZHC 1M1AB 5B24A 5C3IB 1TAFB 5CPKC 4WU8D 4XUJD 1KX5B 5JA4A 5GT0B 3B6GB 4WU8A 4XUJA 5JRGC 3MGPC 4YS3C 3AZGD 1P3MB 4LD9C 3REHA 1P3AD 5GT3A 3AFAD 3AZGA 4WU9B 3VH5A 5AV5C 5B1MA 4J8UD 1P3AA 3C1BD 3REJC 3AFAA 3REIC 3F6TA 3AZEB 3AN2B 4KGCD 2DF4C 2JCHA 3C1BA 3V9RA 1KX4C 1ID3D 4QLCD 5B2IA 4Z66A 2F2AC 3KWQA 1P3KB 3WKJD 1P3IC 2YFVA 3UT9B 3W98C 4J8VD 1P3BD 5CPKB 4J8VA 1M19A 2JSSA 2Y2OA 5B1LD 3TU4B 3AZJC 1P3BA 3A6NC 2PYOA 4DRAA 3AYWC 3EPLA 3MGPB 3NQJB 3KUYC 4YS3B 5CPIC 4LD9B 1KU5A 3AZND 5AV9C 2J8PA 3WA9D 5AV5B 2FJ7D 3LZ1C 3REJB 4ZUXA 2AROD 1N1JA 2ZY2A 3REIB 3AV1D 3B0CT 2XD1A 3AZFA 3B0DB 1TZYC 5FUGA 5DNMC 1EQZA 2AROA 1KX4B 2F8NH 4JJNC 5BNVA 3AZLD 1P3IB 3W98B 3B0CW 5E5AC 5B2JC 5KDMA 1HQ3A 4Z5TC 5B33D 3MVDC 1BH9A 1JFIA 5F99A 1P3OD 3MNNB 2Y2QA 5B32D 3WAAC 3AZKD 3AZJB 3W99D 1AOIB 3X1SC 3A6NB 3LZ0C 2IO5C 4NE5A 5AVCD 3KXBC 3AYWB 1P3OA 2NQBC 5B32A 3AZMC 3VH5T 3MGSA 3KUYB 4YM6C 3A1IA 5CPIB 5B0YD 3O62C 3B6FB 5DNND 5GXQB 5AV9B 4KUDD 3W96C 2RVQC 5B0ZC 2Y2LA 1U35A 3B0BA 3MGRD 2F8NK 2Y2PA 5B0YA 3LZ1B 1F66C 5CP6D 3X1TD 4KUDA 3VH5W 2HUEC 5AY8D 5B31C 3MGRA 1KX3C 1R4VA 1TZYB 4NE3A 3C1CD 5DNMB 5BT1C 5CP6A 4X23D 5AY8A 4JJNB 3MGQD 2VQRA 1WWSA 3C1CA 4J8WC 2BYKA 5B24C 3RELA 1HTAA 4H9QB 3MGQA 3UTBA 5E5AB 5CPJA 1P3GA 3LJAA 1M18D 3EG5B 2Y2HA 3REKD 3LZ0B 2IO5B 4CAYB 3X1UA 3KXBB 4WU8C 1BH8A 3H0LC 3B6GC 2NQBB 2ZY5A 3AZMB 3REKA 4YM6B 1ZLAD 1S32D 4KHAA 1P3MC 3O62B 3REHC 5GT3C 4J8XD 5GSUD 1H3OA 3W96B 5B0ZB 1S32A 4WNNA 4H9NB 5B1MC 5CHLB 4WU9C 1P3AC 3NQUA 5GSUA 4R8PD 2HUEB 5B31B 2CV5A 3X1VA 1KX3B 2RIQA 3UTAD 4XZQA 3IP4C 1P3FB 4R8PA 3WTPD 5B2IC 4Z66C 2YFWA 3KWQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O A;  5B24 B;  2HIO D;  3UT9 C;  2NZD D;  5BO0 A;  3VH6 A;  2HIO A;  1P34 D;  1M19 C;  2NZD A;  4CSR A;  5JA4 B;  2PYO C;  4WU8 B;  3TU4 C;  1P34 A;  4XUJ B;  1F1E A;  3AV2 D;  5AV6 D;  1P3L D;  2L5A A;  3REH B;  5GT3 B;  4WZS B;  3AZG B;  4H9S C;  5AV6 A;  1P3L A;  3W97 D;  5B1M B;  1P3A B;  4ZUX C;  3AFA B;  4AWL C;  3AZF C;  3W97 A;  1EQZ C;  3B0D C;  3C1B B;  3V9R B;  2ARO C;  1KX5 D;  4J8U A;  4Z66 B;  5B2I B;  5GT0 D;  3KWQ B;  2YFV B;  5B40 D;  4KGC A;  1ID3 A;  4QLC A;  1HQ3 C;  3WKJ A;  5B40 A;  4J8V B;  4E44 A;  5F99 C;  1M19 B;  3MNN C;  1P3B B;  2PYO B;  2F8N G;  1AOI C;  5AVB D;  3AZE D;  5B32 C;  3AN2 D;  3MGS C;  3AZI D;  5B1L A;  5AVB A;  1P3K D;  4UUZ A;  3B6F C;  3AZI A;  5GXQ C;  3AZH D;  1U35 C;  3KSY A;  2BYM A;  4ZUX B;  4KUD C;  1N1J B;  4G92 C;  3AZN A;  4AWL B;  3AZH A;  3AZF B;  4H9P A;  5CPK D;  3WA9 A;  5FUG B;  1EQZ B;  2ARO B;  5BS7 A;  2FJ7 A;  3VH6 T;  3AV1 A;  5BNV B;  3R45 A;  5JRG D;  3MGP D;  4YS3 D;  3REL C;  3MGQ C;  4LD9 D;  3UTB C;  5CPJ C;  5KDM B;  4NFT A;  1HQ3 B;  1P3G C;  5JRG A;  3AZL A;  1BH9 B;  1JFI B;  3LJA C;  5F99 B;  3VH6 W;  5AV5 D;  3REJ D;  3X1U C;  5BNX A;  5B33 A;  4Z2M H;  3REI D;  1P3O B;  5B32 B;  3MGS B;  4ZBJ C;  3REK C;  3LEL D;  3AZK A;  1KX4 D;  3W99 A;  5AVC A;  1P3P D;  1S32 C;  1U35 B;  3LEL A;  3W98 D;  5B0Y B;  5GSU C;  4KUD B;  1P3P A;  4G92 B;  5DNN A;  2CV5 C;  3X1V C;  3MGR B;  4XZQ C;  5CP6 B;  5AY8 B;  3AZJ D;  3X1T A;  1P3F C;  3AYW D;  1A7W A;  2BYK B;  3REL B;  3MGQ B;  4X23 A;  3UTB B;  5CPJ B;  1P3G B;  3LJA B;  2HIO C;  3LZ1 D;  3X1U B;  5G49 A;  1BH8 B;  2CWE A;  4ZBJ B;  4XUJ C;  3REK B;  1TZY D;  1M18 A;  5DNM D;  4KHA B;  4JJN D;  1H3O B;  1S32 B;  4WNN B;  3AZG C;  1ZLA A;  3NQU B;  5GSU B;  5B2J D;  4J8X A;  3WTP E;  4Z5T D;  3AFA C;  3X1V B;  3MVD D;  2CV5 B;  4XZQ B;  4R8P B;  5B2J A;  4J8U C;  3C1B C;  3WAA D;  2YFW B;  4Z5T A;  3X1S D;  3MVD A;  3LZ0 D;  3KXB D;  3UTA A;  2NQB D;  3AZM D;  4KGC C;  4H9O B;  3WAA A;  4YM6 D;  1ID3 C;  1WWI A;  4H9R A;  3X1S A;  4QLC C;  3WTP A;  5BO0 B;  3WKJ C;  3O62 D;  5B40 C;  1B67 A;  2HIO B;  3W96 D;  5B0Z D;  4J8V C;  4CSR B;  3O62 A;  1F66 D;  1P3B C;  1P34 B;  2F8N D;  1F66 A;  5BT1 D;  5B1L C;  5AVB C;  4E45 A;  2F8N A;  5AV6 B;  3AV2 A;  4J8W D;  1P3L B;  5AV8 D;  5B24 D;  1M1A D;  3AZN C;  4J8W A;  5AV8 A;  3WA9 C;  3W97 B;  4WV4 B;  1M1A A;  1B6W A;  5BS7 C;  4J8U B;  2FJ7 C;  3AV1 C;  1TAF A;  3B6G D;  4KGC B;  1KX5 A;  1ID3 B;  4QLC B;  1P3M D;  5GT0 A;  3B6G A;  3WKJ B;  3REH D;  3AZL C;  5GT3 D;  5B40 B;  1P3M A;  5B1M D;  4WU9 D;  5B33 C;  5B31 G;  1P3O C;  4WU9 A;  3AZK C;  5B1L B;  3W99 C;  5B2I D;  4Z66 D;  5AVB B;  3KWQ D;  4UUZ B;  5AVC C;  3AZE A;  3AZI B;  3AN2 A;  3LEL C;  3UT9 D;  2BYM B;  5B0Y C;  3AZN B;  1P3P C;  5DNN C;  1P3K A;  3AZH B;  4H9P B;  4Z2M G;  3WA9 B;  3MGR C;  3UT9 A;  1M19 D;  2FJ7 B;  5CP6 C;  3X1T C;  3AV1 B;  2PYO D;  5AY8 C;  3TU4 D;  5CPK A;  3R45 B;  3C1C C;  1Q9C A;  4X23 C;  3TU4 A;  5JRG B;  3AZL B;  2LY8 A;  3MGP A;  3NQJ A;  4YS3 A;  4LD9 A;  4ZUX D;  5BNX B;  5B33 B;  4H9S A;  3AZF D;  1M18 C;  1EQZ D;  5AV5 A;  3AZK B;  3W99 B;  3REJ A;  5AVC B;  3REI A;  3LEL B;  1P3I D;  1ZLA C;  1KX4 A;  1P3P B;  5DNN B;  4J8X C;  1HQ3 D;  1P3I A;  5F99 D;  3W98 A;  3MNN D;  4R8P C;  3X1T B;  1AOI D;  3A6N D;  3UTA C;  3MGS D;  3C1C B;  4EO5 C;  3MNN A;  3WTP C;  4X23 B;  3KUY D;  4G91 C;  1AOI A;  3AZJ A;  5CPI D;  3A6N A;  4HGA C;  4NE6 A;  3AYW A;  3B6F D;  5GXQ D;  5AV9 D;  3KUY A;  1U35 D;  5CPI A;  2NZD C;  5G49 B;  3B6F A;  5GXQ A;  5AV9 A;  1P34 C;  1M18 B;  3LZ1 A;  1BFM A;  3AV2 C;  1TZY A;  5DNM A;  5AV6 C;  1ZLA B;  3REL D;  1P3L C;  3UTB D;  5CPJ D;  4JJN A;  4J8X B;  1P3G D;  5E5A D;  5AV8 C;  3LJA D;  1M1A C;  3W97 C;  5B2J B;  4H9Q A;  5C3I C;  4Z5T B;  5E5A A;  3MVD B;  3X1U D;  5B32 G;  3UTA B;  3WAA B;  4EO5 B;  1KX5 C;  3WTP B;  4H9R B;  3X1S B;  4G91 B;  5GT0 C;  3LZ0 A;  4CAY A;  4HGA B;  3KXB A;  2NQB A;  3AZM A;  4YM6 A;  2RVQ D;  2NZD B;  4DRB A;  1ULY A;  2CV5 D;  3X1V D;  3W96 A;  5B0Z A;  5B31 D;  4XZQ D;  1KX3 D;  1F66 B;  4H9N A;  1P3F D;  2F8N B;  3AZE C;  5B31 A;  3AN2 C;  1KX3 A;  3AV2 B;  3AZI C;  4M6B A;  1P3F A;  1P3K C;  4J8W B;  5AV8 B;  3AZH C;  1M1A B;  5B24 A;  5C3I B;  1TAF B;  5CPK C;  4WU8 D;  4XUJ D;  1KX5 B;  5JA4 A;  5GT0 B;  3B6G B;  4WU8 A;  4XUJ A;  5JRG C;  3MGP C;  4YS3 C;  3AZG D;  1P3M B;  4LD9 C;  3REH A;  1P3A D;  5GT3 A;  3AFA D;  3AZG A;  4WU9 B;  3VH5 A;  5AV5 C;  5B1M A;  4J8U D;  1P3A A;  3C1B D;  3REJ C;  3AFA A;  3REI C;  3AZE B;  3AN2 B;  4KGC D;  3C1B A;  3V9R A;  1KX4 C;  1ID3 D;  4QLC D;  5B2I A;  4Z66 A;  3KWQ A;  1P3K B;  3WKJ D;  1P3I C;  2YFV A;  3UT9 B;  3W98 C;  4J8V D;  1P3B D;  5CPK B;  4J8V A;  1M19 A;  2JSS A;  1P3B A;  5B1L D;  3TU4 B;  3AZJ C;  3A6N C;  2PYO A;  4DRA A;  3AYW C;  3MGP B;  3NQJ B;  3KUY C;  4YS3 B;  5CPI C;  4LD9 B;  1KU5 A;  3AZN D;  5AV9 C;  3WA9 D;  5AV5 B;  2FJ7 D;  3LZ1 C;  3REJ B;  4ZUX A;  2ARO D;  1N1J A;  3REI B;  3AV1 D;  3B0C T;  3AZF A;  3B0D B;  1TZY C;  5FUG A;  5DNM C;  1EQZ A;  2ARO A;  1KX4 B;  2F8N H;  4JJN C;  5BNV A;  3AZL D;  1P3I B;  3W98 B;  3B0C W;  5E5A C;  5B2J C;  5KDM A;  1HQ3 A;  4Z5T C;  5B33 D;  3MVD C;  1BH9 A;  1JFI A;  5F99 A;  1P3O D;  3MNN B;  5B32 D;  3WAA C;  3AZK D;  3AZJ B;  3W99 D;  1AOI B;  3X1S C;  3A6N B;  3LZ0 C;  2IO5 C;  4NE5 A;  5AVC D;  3KXB C;  3AYW B;  1P3O A;  2NQB C;  5B32 A;  3AZM C;  3VH5 T;  3MGS A;  3KUY B;  4YM6 C;  5CPI B;  5B0Y D;  3O62 C;  3B6F B;  5DNN D;  5GXQ B;  5AV9 B;  4KUD D;  3W96 C;  2RVQ C;  5B0Z C;  1U35 A;  3B0B A;  3MGR D;  2F8N K;  5B0Y A;  3LZ1 B;  1F66 C;  5CP6 D;  3X1T D;  4KUD A;  3VH5 W;  2HUE C;  5AY8 D;  5B31 C;  3MGR A;  1KX3 C;  1R4V A;  1TZY B;  4NE3 A;  3C1C D;  5DNM B;  5BT1 C;  5CP6 A;  4X23 D;  5AY8 A;  4JJN B;  3MGQ D;  1WWS A;  3C1C A;  4J8W C;  2BYK A;  5B24 C;  3REL A;  1HTA A;  4H9Q B;  3MGQ A;  3UTB A;  5E5A B;  5CPJ A;  1P3G A;  3LJA A;  1M18 D;  3REK D;  3LZ0 B;  2IO5 B;  4CAY B;  3X1U A;  3KXB B;  4WU8 C;  1BH8 A;  3B6G C;  2NQB B;  3AZM B;  3REK A;  4YM6 B;  1ZLA D;  1S32 D;  4KHA A;  1P3M C;  3O62 B;  3REH C;  5GT3 C;  4J8X D;  5GSU D;  1H3O A;  3W96 B;  5B0Z B;  1S32 A;  4WNN A;  4H9N B;  5B1M C;  5CHL B;  4WU9 C;  1P3A C;  3NQU A;  5GSU A;  4R8P D;  2HUE B;  5B31 B;  2CV5 A;  3X1V A;  1KX3 B;  3UTA D;  4XZQ A;  1P3F B;  4R8P A;  3WTP D;  5B2I C;  4Z66 C;  2YFW A;  3KWQ C; 
#chains in the Genus database with same CATH topology
 4H9O A;  5B24 B;  2HIO D;  3UT9 C;  2NZD D;  5BO0 A;  3KFU G;  3VH6 A;  2HIO A;  1P34 D;  1M19 C;  2NZD A;  4CSR A;  5JA4 B;  2PYO C;  4WU8 B;  3TU4 C;  1P34 A;  4XUJ B;  1F1E A;  3AV2 D;  5AV6 D;  1P3L D;  2L5A A;  2Y2J A;  3REH B;  5GT3 B;  4WZS B;  3AZG B;  4H9S C;  5AV6 A;  1P3L A;  2ZM5 A;  3W97 D;  5B1M B;  1P3A B;  4ZUX C;  3H0M C;  3AFA B;  4AWL C;  3AZF C;  2FFF B;  3AL0 C;  3W97 A;  1EQZ C;  3B0D C;  3C1B B;  3V9R B;  2ARO C;  1KX5 D;  4J8U A;  4Z66 B;  5B2I B;  5GT0 D;  3KWQ B;  2YFV B;  5B40 D;  4KGC A;  1ID3 A;  4QLC A;  4DQY B;  1HQ3 C;  3WKJ A;  5B40 A;  4J8V B;  4E44 A;  5F99 C;  1M19 B;  3MNN C;  1P3B B;  3FDD A;  2PYO B;  2F8N G;  1AOI C;  5AVB D;  3AZE D;  5B32 C;  3AN2 D;  3MGS C;  3AZI D;  5B1L A;  5AVB A;  1P3K D;  4UUZ A;  3B6F C;  3AZI A;  5GXQ C;  3AZH D;  1U35 C;  3KSY A;  2BYM A;  4ZUX B;  4KUD C;  1N1J B;  4G92 C;  3AZN A;  4AWL B;  3AZH A;  3AZF B;  4H9P A;  5CPK D;  3WA9 A;  5FUG B;  1EQZ B;  2ARO B;  5BS7 A;  2FJ7 A;  3VH6 T;  3AV1 A;  5BNV B;  3R45 A;  5JRG D;  3MGP D;  4YS3 D;  3REL C;  3MGQ C;  4LD9 D;  3UTB C;  5CPJ C;  5KDM B;  4NFT A;  1HQ3 B;  1P3G C;  5JRG A;  3AZL A;  1BH9 B;  1JFI B;  2W8S A;  3LJA C;  5F99 B;  3VH6 W;  5AV5 D;  3REJ D;  3X1U C;  5BNX A;  5B33 A;  4Z2M H;  3REI D;  1P3O B;  5B32 B;  3MGS B;  4ZBJ C;  3REK C;  3LEL D;  3AZK A;  1KX4 D;  3W99 A;  5AVC A;  1P3P D;  1S32 C;  1U35 B;  3LEL A;  3W98 D;  4UPK A;  5B0Y B;  5GSU C;  4KUD B;  1P3P A;  4G92 B;  5DNN A;  2CV5 C;  3X1V C;  3MGR B;  1PZR A;  4XZQ C;  5CP6 B;  5AY8 B;  3AZJ D;  3X1T A;  1P3F C;  3AYW D;  1A7W A;  2BYK B;  3REL B;  3MGQ B;  4X23 A;  3UTB B;  5CPJ B;  1P3G B;  3LJA B;  2HIO C;  3LZ1 D;  3X1U B;  5G49 A;  1BH8 B;  2CWE A;  4ZBJ B;  4XUJ C;  3REK B;  1TZY D;  1M18 A;  5DNM D;  4KHA B;  4JJN D;  1H3O B;  1S32 B;  4WNN B;  3AZG C;  1ZLA A;  3NQU B;  5GSU B;  2G5H C;  5B2J D;  4J8X A;  3WTP E;  4Z5T D;  3AFA C;  3X1V B;  3MVD D;  2CV5 B;  4XZQ B;  4R8P B;  5B2J A;  4J8U C;  3C1B C;  3WAA D;  2YFW B;  4Z5T A;  2Y2G A;  3X1S D;  3MVD A;  3LZ0 D;  3KXB D;  3UTA A;  2NQB D;  3AZM D;  4KGC C;  4H9O B;  3WAA A;  4YM6 D;  1ID3 C;  1WWI A;  2XD5 A;  4H9R A;  3X1S A;  4QLC C;  5BO0 B;  3WTP A;  3WKJ C;  3O62 D;  5B40 C;  1B67 A;  2HIO B;  3W96 D;  5B0Z D;  4J8V C;  4CSR B;  3O62 A;  1F66 D;  1P3B C;  1P34 B;  2F8N D;  2Y2M A;  1F66 A;  5BT1 D;  3EPJ A;  5B1L C;  5AVB C;  4E45 A;  2F8N A;  5AV6 B;  3AV2 A;  4J8W D;  1P3L B;  5AV8 D;  5B24 D;  1M1A D;  3AZN C;  4J8W A;  5AV8 A;  3WA9 C;  3W97 B;  4WV4 B;  1M1A A;  1B6W A;  5BS7 C;  4J8U B;  2FJ7 C;  3AV1 C;  1TAF A;  3B6G D;  2BG1 A;  4KGC B;  1KX5 A;  1ID3 B;  4QLC B;  1P3M D;  5GT0 A;  3B6G A;  3A1K A;  3REH D;  3AZL C;  5GT3 D;  5B40 B;  1W2E A;  3WKJ B;  1P3M A;  5B1M D;  4WU9 D;  2Y2I A;  5B33 C;  5B31 G;  1P3O C;  2UWX A;  4WU9 A;  3AZK C;  5B1L B;  3W99 C;  5B2I D;  4Z66 D;  5AVB B;  3KWQ D;  4UUZ B;  5AVC C;  3AZE A;  3AZI B;  3AN2 A;  3LEL C;  1Z2C B;  3UT9 D;  2BYM B;  5B0Y C;  3AZN B;  1P3P C;  5DNN C;  1P3K A;  3AZH B;  1T3U A;  4H9P B;  4WJ3 C;  4Z2M G;  3WA9 B;  3MGR C;  3UT9 A;  1M19 D;  2FJ7 B;  3EPH A;  5CP6 C;  3X1T C;  3AV1 B;  2PYO D;  5AY8 C;  3TU4 D;  5CPK A;  3R45 B;  3C1C C;  1Q9C A;  4X23 C;  3H0R C;  3TU4 A;  5JRG B;  3AZL B;  2LY8 A;  3MGP A;  3NQJ A;  4YS3 A;  4LD9 A;  4ZUX D;  2G5I C;  5BNX B;  5B33 B;  4H9S A;  3AZF D;  3EPK A;  1M18 C;  1EQZ D;  5AV5 A;  3AZK B;  3W99 B;  3P5J B;  3REJ A;  5AVC B;  3REI A;  3LEL B;  1P3I D;  1ZLA C;  1KX4 A;  1P3P B;  5DNN B;  2ZY4 A;  4J8X C;  1HQ3 D;  1P3I A;  5F99 D;  3W98 A;  3MNN D;  4R8P C;  3X1T B;  1AOI D;  3A6N D;  3UTA C;  3MGS D;  3C1C B;  4EO5 C;  3MNN A;  3WTP C;  4X23 B;  3KUY D;  4G91 C;  1AOI A;  3AZJ A;  2DQN C;  2ZY3 A;  5CPI D;  3A6N A;  4HGA C;  4NE6 A;  3AYW A;  3B6F D;  5GXQ D;  5AV9 D;  3KUY A;  1U35 D;  5CPI A;  2NZD C;  5G49 B;  3B6F A;  5GXQ A;  5AV9 A;  1P34 C;  1M18 B;  3LZ1 A;  1BFM A;  3AV2 C;  1TZY A;  5DNM A;  5AV6 C;  1ZLA B;  3REL D;  1P3L C;  3UTB D;  5CPJ D;  4JJN A;  4J8X B;  1P3G D;  5E5A D;  5AV8 C;  3LJA D;  1M1A C;  2Y2K A;  3W97 C;  5B2J B;  4H9Q A;  5C3I C;  4Z5T B;  5E5A A;  2Y2N A;  3MVD B;  3X1U D;  5B32 G;  3UTA B;  3WAA B;  4EO5 B;  1KX5 C;  3WTP B;  4H9R B;  3X1S B;  4G91 B;  5GT0 C;  3LZ0 A;  4CAY A;  2JE5 A;  4HGA B;  3KXB A;  2NQB A;  3AZM A;  4YM6 A;  2RVQ D;  2NZD B;  4DRB A;  1ULY A;  2CV5 D;  3X1V D;  3W96 A;  5B0Z A;  5B31 D;  4XZQ D;  1KX3 D;  1F66 B;  4H9N A;  1P3F D;  2F8N B;  3AZE C;  5B31 A;  3AN2 C;  1KX3 A;  3AV2 B;  3AZI C;  4M6B A;  1P3F A;  1P3K C;  4J8W B;  5AV8 B;  3AZH C;  1M1A B;  5B24 A;  5C3I B;  1TAF B;  5CPK C;  4WU8 D;  4XUJ D;  1KX5 B;  5JA4 A;  5GT0 B;  3B6G B;  4WU8 A;  4XUJ A;  5JRG C;  3MGP C;  4YS3 C;  3AZG D;  1P3M B;  4LD9 C;  3REH A;  1P3A D;  5GT3 A;  3AFA D;  3AZG A;  4WU9 B;  3VH5 A;  5AV5 C;  5B1M A;  4J8U D;  1P3A A;  3C1B D;  3REJ C;  3AFA A;  3REI C;  3F6T A;  3AZE B;  3AN2 B;  4KGC D;  2DF4 C;  2JCH A;  3C1B A;  3V9R A;  1KX4 C;  1ID3 D;  4QLC D;  5B2I A;  4Z66 A;  2F2A C;  3KWQ A;  1P3K B;  3WKJ D;  1P3I C;  2YFV A;  3UT9 B;  3W98 C;  4J8V D;  1P3B D;  5CPK B;  4J8V A;  1M19 A;  2JSS A;  2Y2O A;  5B1L D;  3TU4 B;  3AZJ C;  1P3B A;  3A6N C;  2PYO A;  4DRA A;  3AYW C;  3EPL A;  3MGP B;  3NQJ B;  3KUY C;  4YS3 B;  5CPI C;  4LD9 B;  1KU5 A;  3AZN D;  5AV9 C;  2J8P A;  3WA9 D;  5AV5 B;  2FJ7 D;  3LZ1 C;  3REJ B;  4ZUX A;  2ARO D;  1N1J A;  2ZY2 A;  3REI B;  3AV1 D;  3B0C T;  2XD1 A;  3AZF A;  3B0D B;  1TZY C;  5FUG A;  5DNM C;  1EQZ A;  2ARO A;  1KX4 B;  2F8N H;  4JJN C;  5BNV A;  3AZL D;  1P3I B;  3W98 B;  3B0C W;  5E5A C;  5B2J C;  5KDM A;  1HQ3 A;  4Z5T C;  5B33 D;  3MVD C;  1BH9 A;  1JFI A;  5F99 A;  1P3O D;  3MNN B;  2Y2Q A;  5B32 D;  3WAA C;  3AZK D;  3AZJ B;  3W99 D;  1AOI B;  3X1S C;  3A6N B;  3LZ0 C;  2IO5 C;  4NE5 A;  5AVC D;  3KXB C;  3AYW B;  1P3O A;  2NQB C;  5B32 A;  3AZM C;  3VH5 T;  3MGS A;  3KUY B;  4YM6 C;  3A1I A;  5CPI B;  5B0Y D;  3O62 C;  3B6F B;  5DNN D;  5GXQ B;  5AV9 B;  4KUD D;  3W96 C;  2RVQ C;  5B0Z C;  2Y2L A;  1U35 A;  3B0B A;  3MGR D;  2F8N K;  2Y2P A;  5B0Y A;  3LZ1 B;  1F66 C;  5CP6 D;  3X1T D;  4KUD A;  3VH5 W;  2HUE C;  5AY8 D;  5B31 C;  3MGR A;  1KX3 C;  1R4V A;  1TZY B;  4NE3 A;  3C1C D;  5DNM B;  5BT1 C;  5CP6 A;  4X23 D;  5AY8 A;  4JJN B;  3MGQ D;  2VQR A;  1WWS A;  3C1C A;  4J8W C;  2BYK A;  5B24 C;  3REL A;  1HTA A;  4H9Q B;  3MGQ A;  3UTB A;  5E5A B;  5CPJ A;  1P3G A;  3LJA A;  1M18 D;  3EG5 B;  2Y2H A;  3REK D;  3LZ0 B;  2IO5 B;  4CAY B;  3X1U A;  3KXB B;  4WU8 C;  1BH8 A;  3H0L C;  3B6G C;  2NQB B;  2ZY5 A;  3AZM B;  3REK A;  4YM6 B;  1ZLA D;  1S32 D;  4KHA A;  1P3M C;  3O62 B;  3REH C;  5GT3 C;  4J8X D;  5GSU D;  1H3O A;  3W96 B;  5B0Z B;  1S32 A;  4WNN A;  4H9N B;  5B1M C;  5CHL B;  4WU9 C;  1P3A C;  3NQU A;  5GSU A;  4R8P D;  2HUE B;  5B31 B;  2CV5 A;  3X1V A;  1KX3 B;  2RIQ A;  3UTA D;  4XZQ A;  3IP4 C;  1P3F B;  4R8P A;  3WTP D;  5B2I C;  4Z66 C;  2YFW A;  3KWQ C; 
#chains in the Genus database with same CATH homology
 4H9O A;  5B24 B;  2HIO D;  3UT9 C;  2NZD D;  5BO0 A;  3KFU G;  3VH6 A;  2HIO A;  1P34 D;  1M19 C;  2NZD A;  4CSR A;  5JA4 B;  2PYO C;  4WU8 B;  3TU4 C;  1P34 A;  4XUJ B;  1F1E A;  3AV2 D;  5AV6 D;  1P3L D;  2L5A A;  2Y2J A;  3REH B;  5GT3 B;  4WZS B;  3AZG B;  4H9S C;  5AV6 A;  1P3L A;  2ZM5 A;  3W97 D;  5B1M B;  1P3A B;  4ZUX C;  3H0M C;  3AFA B;  4AWL C;  3AZF C;  2FFF B;  3AL0 C;  3W97 A;  1EQZ C;  3B0D C;  3C1B B;  3V9R B;  2ARO C;  1KX5 D;  4J8U A;  4Z66 B;  5B2I B;  5GT0 D;  3KWQ B;  2YFV B;  5B40 D;  4KGC A;  1ID3 A;  4QLC A;  4DQY B;  1HQ3 C;  3WKJ A;  5B40 A;  4J8V B;  4E44 A;  5F99 C;  1M19 B;  3MNN C;  1P3B B;  3FDD A;  2PYO B;  2F8N G;  1AOI C;  5AVB D;  3AZE D;  5B32 C;  3AN2 D;  3MGS C;  3AZI D;  5B1L A;  5AVB A;  1P3K D;  4UUZ A;  3B6F C;  3AZI A;  5GXQ C;  3AZH D;  1U35 C;  3KSY A;  2BYM A;  4ZUX B;  4KUD C;  1N1J B;  4G92 C;  3AZN A;  4AWL B;  3AZH A;  3AZF B;  4H9P A;  5CPK D;  3WA9 A;  5FUG B;  1EQZ B;  2ARO B;  5BS7 A;  2FJ7 A;  3VH6 T;  3AV1 A;  5BNV B;  3R45 A;  5JRG D;  3MGP D;  4YS3 D;  3REL C;  3MGQ C;  4LD9 D;  3UTB C;  5CPJ C;  5KDM B;  4NFT A;  1HQ3 B;  1P3G C;  5JRG A;  3AZL A;  1BH9 B;  1JFI B;  2W8S A;  3LJA C;  5F99 B;  3VH6 W;  5AV5 D;  3REJ D;  3X1U C;  5BNX A;  5B33 A;  4Z2M H;  3REI D;  1P3O B;  5B32 B;  3MGS B;  4ZBJ C;  3REK C;  3LEL D;  3AZK A;  1KX4 D;  3W99 A;  5AVC A;  1P3P D;  1S32 C;  1U35 B;  3LEL A;  3W98 D;  4UPK A;  5B0Y B;  5GSU C;  4KUD B;  1P3P A;  4G92 B;  5DNN A;  2CV5 C;  3X1V C;  3MGR B;  1PZR A;  4XZQ C;  5CP6 B;  5AY8 B;  3AZJ D;  3X1T A;  1P3F C;  3AYW D;  1A7W A;  2BYK B;  3REL B;  3MGQ B;  4X23 A;  3UTB B;  5CPJ B;  1P3G B;  3LJA B;  2HIO C;  3LZ1 D;  3X1U B;  5G49 A;  1BH8 B;  2CWE A;  4ZBJ B;  4XUJ C;  3REK B;  1TZY D;  1M18 A;  5DNM D;  4KHA B;  4JJN D;  1H3O B;  1S32 B;  4WNN B;  3AZG C;  1ZLA A;  3NQU B;  5GSU B;  2G5H C;  5B2J D;  4J8X A;  3WTP E;  4Z5T D;  3AFA C;  3X1V B;  3MVD D;  2CV5 B;  4XZQ B;  4R8P B;  5B2J A;  4J8U C;  3C1B C;  3WAA D;  2YFW B;  4Z5T A;  2Y2G A;  3X1S D;  3MVD A;  3LZ0 D;  3KXB D;  3UTA A;  2NQB D;  3AZM D;  4KGC C;  4H9O B;  3WAA A;  4YM6 D;  1ID3 C;  1WWI A;  2XD5 A;  4H9R A;  3X1S A;  4QLC C;  5BO0 B;  3WTP A;  3WKJ C;  3O62 D;  5B40 C;  1B67 A;  2HIO B;  3W96 D;  5B0Z D;  4J8V C;  4CSR B;  3O62 A;  1F66 D;  1P3B C;  1P34 B;  2F8N D;  2Y2M A;  1F66 A;  5BT1 D;  3EPJ A;  5B1L C;  5AVB C;  4E45 A;  2F8N A;  5AV6 B;  3AV2 A;  4J8W D;  1P3L B;  5AV8 D;  5B24 D;  1M1A D;  3AZN C;  4J8W A;  5AV8 A;  3WA9 C;  3W97 B;  4WV4 B;  1M1A A;  1B6W A;  5BS7 C;  4J8U B;  2FJ7 C;  3AV1 C;  1TAF A;  3B6G D;  2BG1 A;  4KGC B;  1KX5 A;  1ID3 B;  4QLC B;  1P3M D;  5GT0 A;  3B6G A;  3A1K A;  3REH D;  3AZL C;  5GT3 D;  5B40 B;  1W2E A;  3WKJ B;  1P3M A;  5B1M D;  4WU9 D;  2Y2I A;  5B33 C;  5B31 G;  1P3O C;  2UWX A;  4WU9 A;  3AZK C;  5B1L B;  3W99 C;  5B2I D;  4Z66 D;  5AVB B;  3KWQ D;  4UUZ B;  5AVC C;  3AZE A;  3AZI B;  3AN2 A;  3LEL C;  1Z2C B;  3UT9 D;  2BYM B;  5B0Y C;  3AZN B;  1P3P C;  5DNN C;  1P3K A;  3AZH B;  1T3U A;  4H9P B;  4WJ3 C;  4Z2M G;  3WA9 B;  3MGR C;  3UT9 A;  1M19 D;  2FJ7 B;  3EPH A;  5CP6 C;  3X1T C;  3AV1 B;  2PYO D;  5AY8 C;  3TU4 D;  5CPK A;  3R45 B;  3C1C C;  1Q9C A;  4X23 C;  3H0R C;  3TU4 A;  5JRG B;  3AZL B;  2LY8 A;  3MGP A;  3NQJ A;  4YS3 A;  4LD9 A;  4ZUX D;  2G5I C;  5BNX B;  5B33 B;  4H9S A;  3AZF D;  3EPK A;  1M18 C;  1EQZ D;  5AV5 A;  3AZK B;  3W99 B;  3P5J B;  3REJ A;  5AVC B;  3REI A;  3LEL B;  1P3I D;  1ZLA C;  1KX4 A;  1P3P B;  5DNN B;  2ZY4 A;  4J8X C;  1HQ3 D;  1P3I A;  5F99 D;  3W98 A;  3MNN D;  4R8P C;  3X1T B;  1AOI D;  3A6N D;  3UTA C;  3MGS D;  3C1C B;  4EO5 C;  3MNN A;  3WTP C;  4X23 B;  3KUY D;  4G91 C;  1AOI A;  3AZJ A;  2DQN C;  2ZY3 A;  5CPI D;  3A6N A;  4HGA C;  4NE6 A;  3AYW A;  3B6F D;  5GXQ D;  5AV9 D;  3KUY A;  1U35 D;  5CPI A;  2NZD C;  5G49 B;  3B6F A;  5GXQ A;  5AV9 A;  1P34 C;  1M18 B;  3LZ1 A;  1BFM A;  3AV2 C;  1TZY A;  5DNM A;  5AV6 C;  1ZLA B;  3REL D;  1P3L C;  3UTB D;  5CPJ D;  4JJN A;  4J8X B;  1P3G D;  5E5A D;  5AV8 C;  3LJA D;  1M1A C;  2Y2K A;  3W97 C;  5B2J B;  4H9Q A;  5C3I C;  4Z5T B;  5E5A A;  2Y2N A;  3MVD B;  3X1U D;  5B32 G;  3UTA B;  3WAA B;  4EO5 B;  1KX5 C;  3WTP B;  4H9R B;  3X1S B;  4G91 B;  5GT0 C;  3LZ0 A;  4CAY A;  2JE5 A;  4HGA B;  3KXB A;  2NQB A;  3AZM A;  4YM6 A;  2RVQ D;  2NZD B;  4DRB A;  1ULY A;  2CV5 D;  3X1V D;  3W96 A;  5B0Z A;  5B31 D;  4XZQ D;  1KX3 D;  1F66 B;  4H9N A;  1P3F D;  2F8N B;  3AZE C;  5B31 A;  3AN2 C;  1KX3 A;  3AV2 B;  3AZI C;  4M6B A;  1P3F A;  1P3K C;  4J8W B;  5AV8 B;  3AZH C;  1M1A B;  5B24 A;  5C3I B;  1TAF B;  5CPK C;  4WU8 D;  4XUJ D;  1KX5 B;  5JA4 A;  5GT0 B;  3B6G B;  4WU8 A;  4XUJ A;  5JRG C;  3MGP C;  4YS3 C;  3AZG D;  1P3M B;  4LD9 C;  3REH A;  1P3A D;  5GT3 A;  3AFA D;  3AZG A;  4WU9 B;  3VH5 A;  5AV5 C;  5B1M A;  4J8U D;  1P3A A;  3C1B D;  3REJ C;  3AFA A;  3REI C;  3F6T A;  3AZE B;  3AN2 B;  4KGC D;  2DF4 C;  2JCH A;  3C1B A;  3V9R A;  1KX4 C;  1ID3 D;  4QLC D;  5B2I A;  4Z66 A;  2F2A C;  3KWQ A;  1P3K B;  3WKJ D;  1P3I C;  2YFV A;  3UT9 B;  3W98 C;  4J8V D;  1P3B D;  5CPK B;  4J8V A;  1M19 A;  2JSS A;  2Y2O A;  5B1L D;  3TU4 B;  3AZJ C;  1P3B A;  3A6N C;  2PYO A;  4DRA A;  3AYW C;  3EPL A;  3MGP B;  3NQJ B;  3KUY C;  4YS3 B;  5CPI C;  4LD9 B;  1KU5 A;  3AZN D;  5AV9 C;  2J8P A;  3WA9 D;  5AV5 B;  2FJ7 D;  3LZ1 C;  3REJ B;  4ZUX A;  2ARO D;  1N1J A;  2ZY2 A;  3REI B;  3AV1 D;  3B0C T;  2XD1 A;  3AZF A;  3B0D B;  1TZY C;  5FUG A;  5DNM C;  1EQZ A;  2ARO A;  1KX4 B;  2F8N H;  4JJN C;  5BNV A;  3AZL D;  1P3I B;  3W98 B;  3B0C W;  5E5A C;  5B2J C;  5KDM A;  1HQ3 A;  4Z5T C;  5B33 D;  3MVD C;  1BH9 A;  1JFI A;  5F99 A;  1P3O D;  3MNN B;  2Y2Q A;  5B32 D;  3WAA C;  3AZK D;  3AZJ B;  3W99 D;  1AOI B;  3X1S C;  3A6N B;  3LZ0 C;  2IO5 C;  4NE5 A;  5AVC D;  3KXB C;  3AYW B;  1P3O A;  2NQB C;  5B32 A;  3AZM C;  3VH5 T;  3MGS A;  3KUY B;  4YM6 C;  3A1I A;  5CPI B;  5B0Y D;  3O62 C;  3B6F B;  5DNN D;  5GXQ B;  5AV9 B;  4KUD D;  3W96 C;  2RVQ C;  5B0Z C;  2Y2L A;  1U35 A;  3B0B A;  3MGR D;  2F8N K;  2Y2P A;  5B0Y A;  3LZ1 B;  1F66 C;  5CP6 D;  3X1T D;  4KUD A;  3VH5 W;  2HUE C;  5AY8 D;  5B31 C;  3MGR A;  1KX3 C;  1R4V A;  1TZY B;  4NE3 A;  3C1C D;  5DNM B;  5BT1 C;  5CP6 A;  4X23 D;  5AY8 A;  4JJN B;  3MGQ D;  2VQR A;  1WWS A;  3C1C A;  4J8W C;  2BYK A;  5B24 C;  3REL A;  1HTA A;  4H9Q B;  3MGQ A;  3UTB A;  5E5A B;  5CPJ A;  1P3G A;  3LJA A;  1M18 D;  3EG5 B;  2Y2H A;  3REK D;  3LZ0 B;  2IO5 B;  4CAY B;  3X1U A;  3KXB B;  4WU8 C;  1BH8 A;  3H0L C;  3B6G C;  2NQB B;  2ZY5 A;  3AZM B;  3REK A;  4YM6 B;  1ZLA D;  1S32 D;  4KHA A;  1P3M C;  3O62 B;  3REH C;  5GT3 C;  4J8X D;  5GSU D;  1H3O A;  3W96 B;  5B0Z B;  1S32 A;  4WNN A;  4H9N B;  5B1M C;  5CHL B;  4WU9 C;  1P3A C;  3NQU A;  5GSU A;  4R8P D;  2HUE B;  5B31 B;  2CV5 A;  3X1V A;  1KX3 B;  2RIQ A;  3UTA D;  4XZQ A;  3IP4 C;  1P3F B;  4R8P A;  3WTP D;  5B2I C;  4Z66 C;  2YFW A;  3KWQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...