4Z5TC

The nucleosome containing human h3.5
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3C
publication title Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z5tC00
4DRAA 2L5AA 4KUDA 4UUZA 3UT9C 5B24D 3X1VA 4R8PD 2CV5C 5BNXB 3RELB 3B6GB 3B6FA 3W98A 5B0ZD 4WU8D 3AZEC 2BYMB 3UTAA 5AV6D 4J8XC 2F8ND 1B67A 5BNVA 4EO5B 4NFTA 4ZUXC 3AZLB 3REKB 4KHAB 3MVDD 3WA9C 3W99C 4J8VB 5DNMC 3MGPC 5C3IC 2HIOB 5GT3B 5B33B 3REJA 2YFWA 1S32D 5GSUA 4NE3A 5FUGA 3AFAD 3VH5W 5F99D 4M6BA 3WTPA 1P3MB 5B40B 5GXQB 1EQZA 1P3FA 3RELD 3AN2B 4YS3A 3AZHA 1KX3D 4Z66C 2AROC 1M1AB 3X1UD 3AZJB 5B1MB 3KUYB 1P3OB 3C1BC 3AZIB 5GT0A 3R45B 4HGAC 3AZLD 1P3PB 1ID3A 4J8UB 3REKD 4UUZB 4J8VD 5AVBA 1R4VA 3X1TB 3X1VB 4Z2MG 1KX5C 3W98B 5AV8C 3UT9D 3UTAB 5B2JA 2HIOD 2CV5D 5GT3D 5B33D 1P3KA 1A7WA 1WWSA 5CPIC 3AZKA 3AZNC 3W96A 1P3GA 3A6NC 4J8XD 3UTBD 4X23A 1P3OA 1AOIC 3LJAC 4WV4B 5AV9A 1BH8B 5CPKB 3LELA 3MNNA 1U35A 5B1LD 1F66C 1P3MD 3AYWA 1P3IB 3AV1A 2F8NK 3AN2D 5CP6A 3O62A 2PYOC 3WAAD 3MGRC 4H9PA 5GSUB 3WKJA 5B1MD 3NQJA 3C1CA 1JFIA 3WTPB 4J8UD 3AZFA 2FJ7A 1EQZB 5B31C 3AZGB 3X1TD 5B32B 4YS3B 1P3BA 3X1SD 4Z66D 2AROD 5B2IB 4XZQA 5AV6A 5AY8A 5JA4A 5GT0B 4AWLB 1ID3B 1N1JB 5CPKD 3B0DC 5B0ZC 3LZ1B 1P3ID 5DNNA 2LY8A 5BS7A 1ZLAC 1KX5D 4G92B 3AZKB 4CSRB 1P3GB 5AVCB 4X23B 5CPID 5E5AC 3REHA 1F1EA 4H9OA 3LELB 3LJAD 1U35B 3TU4A 3LZ0A 1P3AC 5B32D 3AV1B 2IO5C 3O62B 1KX4B 2NZDC 5BT1C 3W97C 4LD9C 5F99C 3WKJB 3MGRD 4XUJA 3KXBA 3MGQB 3NQJB 3C1CB 1JFIB 3B6GC 3RELC 3AZFB 1P34A 4QLCB 3LZ1D 1HQ3A 3X1UC 2NQBA 4Z5TB 5CHLB 3AZLC 5JRGB 3REKC 5JA4B 4J8VC 3AZEA 4YM6B 3B0CT 2HIOC 5B0YA 1TZYA 5GT3C 5B33C 2F8NH 4ZUXA 4JJND 3UTBC 4H9NA 1ZLAD 3KSYA 3AZMD 1KX4D 3W99A 3WA9A 5DNMA 3MGPA 5B31G 5B1LC 1P3MC 5AV5A 5GXQC 5B40C 3REIA 3AV2B 4WU9B 4H9OB 1P3LA 5E5AD 3TU4B 3AN2C 4QLCD 1M1AC 3WAAC 1P3AD 4Z5TD 3AZJC 5B1MC 3KUYC 1P3OC 3AZIC 1P3PC 5JRGD 4J8UC 2NZDD 5BT1D 3W97D 2F8NG 4H9SA 4LD9D 3KXBB 3X1TC 3X1VC 4KGCA 1M19B 1KU5A 3W98C 1P34B 3X1SC 3UTAC 3B6GD 1HQ3B 2NQBB 3C1BA 2BYKA 2YFVB 2HUEB 1ULYA 3KWQB 5CPKC 5AV8A 3AV2D 1P3IC 4KUDB 4WU9D 4WNNA 3AZNA 5B0YB 1TZYB 3B6FB 3A6NA 1AOIA 3MGSA 5GSUC 5G49A 5BNVB 1F66A 1WWIA 4J8WA 1M18A 3WTPC 3NQUA 5AV5B 1P3LB 5BO0A 3REIB 4H9RA 3AZGC 2PYOA 5B32C 5B40D 5GXQD 1M19D 4YS3C 2RVQC 3REJB 2JSSA 2YFWB 1M1AD 5B2IC 5KDMA 5FUGB 5GT0C 4ZBJB 4AWLC 5B31A 3AZJD 3KWQD 3KUYD 1P3OD 3AZID 1P3PD 5CPJA 4CAYA 3LZ1C 4KGCB 4KUDD 1TAFA 1P3FB 3X1VD 3W98D 4G92C 3AZHB 3B0BA 3C1BB 3UTAD 3AZKC 1P3GC 5B24A 5AVCC 4R8PA 4X23C 5B0ZA 4WU8A 2F8NA 3LELC 1U35C 5AV8B 4H9QA 4WNNB 5AVBB 4JJNC 3AZNB 3AV1C 3A6NB 3MVDA 3AZMC 1KX4C 5B2JB 5E5AA 3MGSB 1P3KB 3REJD 3WKJC 3W96B 4J8WB 5GSUD 3MGQC 3C1CC 1P3AA 1M18B 5AV9B 3AZFC 3NQUB 1S32A 5BO0B 3AFAA 4H9RB 4QLCC 3MNNB 3WTPD 2PYOB 3AYWB 2NZDA 4Z5TC 1EQZD 4LD9A 2CWEA 5F99A 3AZGD 4YS3D 5CP6B 5JRGC 1HTAA 1BH9A 2RVQD 4H9PB 3RELA 3VH6A 2BYMA 1KX3A 5B2ID 4YM6C 3X1UA 5GT0D 1ID3D 5CPJB 2FJ7B 1TAFB 3AZLA 1H3OA 3REKA 4KHAA 1P3BB 5B2JD 4J8VA 5B24B 1P3KD 4R8PB 4EO5C 5B0ZB 4WU8B 3AZKD 5B32G 3UT9A 1P3GD 5AVCD 2HIOA 4XZQB 4X23D 5AV6B 5GT3A 5B33A 3AV2C 5AY8B 4WU9C 5AV9D 3TU4C 4J8XA 4G91B 3UTBA 3LELD 3MNND 1U35D 3WTPE 3AYWD 5DNNB 3MVDB 3AV1D 5B1LA 1P3MA 4E45A 3O62D 3KXBC 3AN2A 4E44A 4WZSB 3REHB 3WKJD 1S32B 1M19C 1M1AA 3MGQD 3C1CD 1P34C 3WAAA 3AFAB 3AZFD 1HQ3C 3LZ0B 2NQBC 5B1MA 3KUYA 3AZIA 4J8UA 1P3BD 2HUEC 3X1TA 3KWQC 1BH9B 3X1SA 1KX3B 4XZQD 4XUJB 4KUDC 3X1UB 5AY8D 4YM6D 4Z66A 5B0YC 1TZYC 2AROA 3B6FC 1H3OB 1BH8A 5DNND 5CPKA 1P3IA 3VH5A 3UT9B 2CV5B 5AV5C 1B6WA 1P3LC 3REIC 1KX5A 3AZEB 3REHD 4J8XB 3UTBB 4Z2MH 5CPIA 3TU4D 3LZ0D 3REJC 4ZUXB 3LJAA 5B1LB 3VH6T 4H9NB 4ZBJC 3WA9B 3W99B 3AZGA 5DNMB 5B32A 4H9SC 3MGPB 5C3IB 4KGCC 4XUJD 3KXBD 1P3PA 1EQZC 3WAAB 1P3FC 5B2IA 1P34D 3MGRA 3AZHC 1HQ3D 2NQBD 1N1JA 3LZ1A 1ID3C 3V9RA 3X1SB 3B0CW 5AVBC 3AZED 4Z66B 4CSRA 2AROB 5AVCA 4NE5A 5B2JC 5B0YD 1TZYD 3MGSC 1P3KC 3B6FD 2BYKB 4HGAB 3W96C 4ZUXD 1Q9CA 4J8WC 3WA9D 3W99D 1M18C 5DNMD 5AV9C 4JJNA 3MGPD 1KX5B 3W96D 3MNNC 1ZLAA 4NE6A 3AZMA 1KX4A 5AV5D 3AYWC 1P3LD 3REID 5CPIB 5CP6C 3O62C 1AOIB 3MGQA 3LJAB 5G49B 4QLCA 1F66B 4Z5TA 5CPJC 2FJ7C 5JRGA 4KGCD 3W97A 1P3BC 3MGRB 1P3FD 3VH5T 5B24C 4R8PC 4YM6A 3AZHD 3C1BD 4WU8C 3B6GA 4XZQC 5KDMB 5BNXA 5AV6C 5AY8C 5B31B 3V9RB 4DRBA 1BFMA 4G91C 5AV8D 4CAYB 5DNNC 5BS7C 3MVDC 5AVBD 3AZND 3VH6W 3A6ND 3AV2A 1AOID 4WU9A 3MGSD 3B0DB 3REHC 2CV5A 1F66D 4JJNB 4J8WD 1S32C 2F8NB 3AFAC 1M18D 1ZLAB 3AZMB 4H9QB 3LZ0C 2PYOD 5E5AB 5B40A 5CP6D 5GXQA 1M19A 1KX3C 4XUJC 1P3AB 5B31D 2YFVA 2IO5B 5CPJD 2FJ7D 3W97B 3AZJA 3KWQA 2NZDB 4LD9B 5F99B 3R45A
chains in the Genus database with same CATH superfamily
4DRAA 2L5AA 4KUDA 4UUZA 3UT9C 5B24D 3X1VA 4R8PD 2CV5C 5BNXB 3RELB 3B6GB 3B6FA 3W98A 5B0ZD 4WU8D 3AZEC 2BYMB 2G5HC 3UTAA 5AV6D 4J8XC 2F8ND 1B67A 5BNVA 4EO5B 4NFTA 4ZUXC 3AZLB 3REKB 4KHAB 3MVDD 3WA9C 3W99C 4J8VB 5DNMC 3MGPC 5C3IC 2HIOB 5GT3B 5B33B 3REJA 2YFWA 1S32D 1PZRA 5GSUA 4NE3A 5FUGA 3AFAD 3VH5W 2Y2IA 5F99D 4M6BA 3WTPA 1P3MB 5B40B 5GXQB 1EQZA 1P3FA 3H0MC 2Y2QA 2UWXA 2G5IC 3RELD 3AN2B 4YS3A 3AZHA 1KX3D 4Z66C 2AROC 1M1AB 3X1UD 3AZJB 5B1MB 3KUYB 1P3OB 3C1BC 3AZIB 5GT0A 3R45B 4HGAC 3AZLD 1P3PB 1ID3A 4J8UB 3REKD 4UUZB 4J8VD 5AVBA 1R4VA 3X1TB 3X1VB 4Z2MG 1KX5C 3W98B 5AV8C 3UT9D 3UTAB 5B2JA 2HIOD 2CV5D 5GT3D 5B33D 1P3KA 1A7WA 1WWSA 5CPIC 3AZKA 3AZNC 3W96A 1P3GA 3A6NC 4J8XD 3UTBD 4X23A 1P3OA 1AOIC 3LJAC 4WV4B 5AV9A 1BH8B 5CPKB 3LELA 3MNNA 1U35A 5B1LD 1F66C 1P3MD 3AYWA 1P3IB 3H0RC 3AV1A 2F8NK 3AN2D 5CP6A 3O62A 2PYOC 3WAAD 3MGRC 4H9PA 5GSUB 3WKJA 5B1MD 3NQJA 3C1CA 1JFIA 2Y2KA 3WTPB 4J8UD 3AZFA 2FJ7A 1EQZB 5B31C 3AZGB 3X1TD 5B32B 1W2EA 4YS3B 1P3BA 3X1SD 4Z66D 2AROD 5B2IB 4XZQA 5AV6A 5AY8A 5JA4A 5GT0B 1Z2CB 4AWLB 1ID3B 1N1JB 3H0LC 3B0DC 5B0ZC 5CPKD 3LZ1B 1P3ID 5DNNA 2LY8A 5BS7A 1ZLAC 1KX5D 4G92B 3AZKB 4CSRB 1P3GB 5AVCB 4X23B 5CPID 5E5AC 3REHA 2RIQA 1F1EA 4H9OA 3LELB 3LJAD 1U35B 3TU4A 3LZ0A 1P3AC 5B32D 3AV1B 2IO5C 3O62B 2VQRA 1KX4B 2NZDC 5BT1C 3W97C 4LD9C 5F99C 3WKJB 3MGRD 4XUJA 3KXBA 3MGQB 3NQJB 3C1CB 1JFIB 3B6GC 3RELC 3AZFB 1P34A 2Y2GA 4QLCB 3LZ1D 1HQ3A 3X1UC 3FDDA 4Z5TB 2NQBA 5CHLB 3AZLC 5JRGB 3REKC 3EPJA 5JA4B 4J8VC 3AZEA 4YM6B 3B0CT 2HIOC 5B0YA 1TZYA 5GT3C 5B33C 2F8NH 4ZUXA 4JJND 3UTBC 3A1IA 4H9NA 1ZLAD 3KSYA 3AZMD 1KX4D 3W99A 3WA9A 5DNMA 3AL0C 3MGPA 5B31G 5B1LC 1P3MC 5AV5A 5GXQC 5B40C 3REIA 3AV2B 4WU9B 4H9OB 1P3LA 5E5AD 3TU4B 3AN2C 3F6TA 4QLCD 1M1AC 3WAAC 1P3AD 4Z5TD 3AZJC 5B1MC 3KUYC 1P3OC 3AZIC 3EPLA 3A1KA 5JRGD 1P3PC 4J8UC 2NZDD 5BT1D 3W97D 2F8NG 4H9SA 4LD9D 3KXBB 2ZY5A 3X1TC 3X1VC 4KGCA 1M19B 1KU5A 3W98C 1P34B 2DF4C 3X1SC 3UTAC 3B6GD 1HQ3B 2NQBB 3IP4C 3C1BA 2BYKA 2JCHA 3P5JB 2YFVB 2HUEB 1ULYA 3KWQB 5CPKC 5AV8A 2ZY4A 3AV2D 1P3IC 4KUDB 4WU9D 4WNNA 3AZNA 5B0YB 1TZYB 3B6FB 3A6NA 1AOIA 3MGSA 5GSUC 2BG1A 4DQYB 5G49A 5BNVB 1F66A 1WWIA 4J8WA 1M18A 3WTPC 3NQUA 5AV5B 1P3LB 5BO0A 3REIB 4H9RA 3AZGC 2PYOA 5B32C 5B40D 5GXQD 1M19D 4YS3C 2RVQC 3REJB 2JSSA 2YFWB 1M1AD 5B2IC 5KDMA 5FUGB 5GT0C 4ZBJB 4AWLC 5B31A 3AZJD 3KWQD 3KUYD 1P3OD 3AZID 1P3PD 5CPJA 4CAYA 3LZ1C 4KGCB 4KUDD 1TAFA 4WJ3C 1P3FB 3X1VD 3W98D 4G92C 3AZHB 3B0BA 3C1BB 3UTAD 3AZKC 1P3GC 5B24A 5AVCC 4R8PA 4X23C 5B0ZA 4WU8A 4UPKA 2F8NA 3LELC 1U35C 5AV8B 4H9QA 4WNNB 5AVBB 4JJNC 3AZNB 3AV1C 3A6NB 3MVDA 3AZMC 1KX4C 5B2JB 5E5AA 3MGSB 1P3KB 3REJD 3WKJC 3W96B 2XD5A 4J8WB 5GSUD 3MGQC 3C1CC 1P3AA 1M18B 5AV9B 3AZFC 3NQUB 1S32A 5BO0B 3AFAA 4H9RB 4QLCC 3MNNB 3WTPD 2PYOB 3AYWB 2NZDA 4Z5TC 1EQZD 4LD9A 2CWEA 5F99A 3AZGD 4YS3D 5CP6B 5JRGC 1HTAA 1BH9A 2RVQD 4H9PB 3RELA 3VH6A 2BYMA 1KX3A 5B2ID 4YM6C 3X1UA 5GT0D 1ID3D 5CPJB 2FJ7B 1TAFB 3AZLA 1H3OA 3REKA 4KHAA 1P3BB 5B2JD 4J8VA 5B24B 1P3KD 4R8PB 4EO5C 5B0ZB 4WU8B 3AZKD 5B32G 3UT9A 1P3GD 5AVCD 2HIOA 4XZQB 4X23D 5AV6B 5GT3A 5B33A 3AV2C 5AY8B 4WU9C 5AV9D 3TU4C 4J8XA 4G91B 3UTBA 3LELD 2F2AC 3MNND 1U35D 2Y2MA 3EPKA 3WTPE 2Y2JA 3AYWD 5DNNB 3KFUG 3MVDB 3AV1D 5B1LA 1P3MA 4E45A 3O62D 2XD1A 3KXBC 3AN2A 4E44A 4WZSB 2ZY3A 3REHB 3WKJD 1S32B 1M19C 1M1AA 3MGQD 3C1CD 1P34C 3WAAA 3AFAB 3AZFD 1HQ3C 3LZ0B 3EPHA 5B1MA 3KUYA 2NQBC 3AZIA 4J8UA 1P3BD 2HUEC 3X1TA 3KWQC 1BH9B 2FFFB 2Y2OA 3X1SA 1KX3B 2Y2NA 4XZQD 4XUJB 4KUDC 3X1UB 5AY8D 4YM6D 4Z66A 5B0YC 1TZYC 2AROA 3B6FC 1H3OB 1BH8A 5DNND 5CPKA 1P3IA 3VH5A 3UT9B 2CV5B 5AV5C 1B6WA 1P3LC 3REIC 1KX5A 3AZEB 3REHD 4J8XB 3UTBB 4Z2MH 5CPIA 3TU4D 2W8SA 3LZ0D 3REJC 4ZUXB 3LJAA 5B1LB 3VH6T 4H9NB 4ZBJC 3WA9B 3W99B 3AZGA 5DNMB 2Y2LA 5B32A 4H9SC 3MGPB 5C3IB 4KGCC 4XUJD 3KXBD 1P3PA 2ZY2A 1EQZC 3WAAB 1P3FC 5B2IA 1P34D 3MGRA 3AZHC 1HQ3D 2NQBD 1N1JA 3LZ1A 1ID3C 3V9RA 3X1SB 3B0CW 5AVBC 3AZED 2Y2HA 4Z66B 4CSRA 2AROB 5AVCA 4NE5A 5B2JC 5B0YD 1TZYD 3MGSC 1P3KC 3B6FD 2BYKB 4HGAB 3W96C 4ZUXD 1Q9CA 4J8WC 2ZM5A 3WA9D 3W99D 1M18C 5DNMD 5AV9C 4JJNA 3MGPD 1KX5B 2Y2PA 3W96D 3MNNC 1ZLAA 4NE6A 3AZMA 1KX4A 5AV5D 3AYWC 1P3LD 3REID 5CPIB 5CP6C 3O62C 1AOIB 3MGQA 3LJAB 5G49B 4QLCA 1F66B 2DQNC 4Z5TA 5CPJC 2FJ7C 5JRGA 4KGCD 3W97A 1P3BC 3MGRB 1P3FD 3VH5T 5B24C 4R8PC 4YM6A 3AZHD 3C1BD 1T3UA 4WU8C 3B6GA 4XZQC 5KDMB 5BNXA 5AV6C 5AY8C 5B31B 3V9RB 4DRBA 1BFMA 4G91C 5AV8D 4CAYB 5DNNC 5BS7C 3MVDC 5AVBD 3AZND 3VH6W 3A6ND 3AV2A 1AOID 4WU9A 3MGSD 3B0DB 3REHC 2CV5A 1F66D 4JJNB 4J8WD 1S32C 2F8NB 3AFAC 1M18D 1ZLAB 3AZMB 4H9QB 3LZ0C 2PYOD 5E5AB 2JE5A 5B40A 5CP6D 5GXQA 1M19A 1KX3C 4XUJC 2J8PA 1P3AB 5B31D 2YFVA 2IO5B 5CPJD 3EG5B 2FJ7D 3W97B 3AZJA 3KWQA 2NZDB 4LD9B 5F99B 3R45A
chains in the Genus database with same CATH topology
4DRAA 2L5AA 4KUDA 4UUZA 3UT9C 5B24D 3X1VA 4R8PD 2CV5C 5BNXB 3RELB 3B6GB 3B6FA 3W98A 5B0ZD 4WU8D 3AZEC 2BYMB 2G5HC 3UTAA 5AV6D 4J8XC 2F8ND 1B67A 5BNVA 4EO5B 4NFTA 4ZUXC 3AZLB 3REKB 4KHAB 3MVDD 3WA9C 3W99C 4J8VB 5DNMC 3MGPC 5C3IC 2HIOB 5GT3B 5B33B 3REJA 2YFWA 1S32D 1PZRA 5GSUA 4NE3A 5FUGA 3AFAD 3VH5W 2Y2IA 5F99D 4M6BA 3WTPA 1P3MB 5B40B 5GXQB 1EQZA 1P3FA 3H0MC 2Y2QA 2UWXA 2G5IC 3RELD 3AN2B 4YS3A 3AZHA 1KX3D 4Z66C 2AROC 1M1AB 3X1UD 3AZJB 5B1MB 3KUYB 1P3OB 3C1BC 3AZIB 5GT0A 3R45B 4HGAC 3AZLD 1P3PB 1ID3A 4J8UB 3REKD 4UUZB 4J8VD 5AVBA 1R4VA 3X1TB 3X1VB 4Z2MG 1KX5C 3W98B 5AV8C 3UT9D 3UTAB 5B2JA 2HIOD 2CV5D 5GT3D 5B33D 1P3KA 1A7WA 1WWSA 5CPIC 3AZKA 3AZNC 3W96A 1P3GA 3A6NC 4J8XD 3UTBD 4X23A 1P3OA 1AOIC 3LJAC 4WV4B 5AV9A 1BH8B 5CPKB 3LELA 3MNNA 1U35A 5B1LD 1F66C 1P3MD 3AYWA 1P3IB 3H0RC 3AV1A 2F8NK 3AN2D 5CP6A 3O62A 2PYOC 3WAAD 3MGRC 4H9PA 5GSUB 3WKJA 5B1MD 3NQJA 3C1CA 1JFIA 2Y2KA 3WTPB 4J8UD 3AZFA 2FJ7A 1EQZB 5B31C 3AZGB 3X1TD 5B32B 1W2EA 4YS3B 1P3BA 3X1SD 4Z66D 2AROD 5B2IB 4XZQA 5AV6A 5AY8A 5JA4A 5GT0B 1Z2CB 4AWLB 1ID3B 1N1JB 3H0LC 3B0DC 5B0ZC 5CPKD 3LZ1B 1P3ID 5DNNA 2LY8A 5BS7A 1ZLAC 1KX5D 4G92B 3AZKB 4CSRB 1P3GB 5AVCB 4X23B 5CPID 5E5AC 3REHA 2RIQA 1F1EA 4H9OA 3LELB 3LJAD 1U35B 3TU4A 3LZ0A 1P3AC 5B32D 3AV1B 2IO5C 3O62B 2VQRA 1KX4B 2NZDC 5BT1C 3W97C 4LD9C 5F99C 3WKJB 3MGRD 4XUJA 3KXBA 3MGQB 3NQJB 3C1CB 1JFIB 3B6GC 3RELC 3AZFB 1P34A 2Y2GA 4QLCB 3LZ1D 1HQ3A 3X1UC 3FDDA 4Z5TB 2NQBA 5CHLB 3AZLC 5JRGB 3REKC 3EPJA 5JA4B 4J8VC 3AZEA 4YM6B 3B0CT 2HIOC 5B0YA 1TZYA 5GT3C 5B33C 2F8NH 4ZUXA 4JJND 3UTBC 3A1IA 4H9NA 1ZLAD 3KSYA 3AZMD 1KX4D 3W99A 3WA9A 5DNMA 3AL0C 3MGPA 5B31G 5B1LC 1P3MC 5AV5A 5GXQC 5B40C 3REIA 3AV2B 4WU9B 4H9OB 1P3LA 5E5AD 3TU4B 3AN2C 3F6TA 4QLCD 1M1AC 3WAAC 1P3AD 4Z5TD 3AZJC 5B1MC 3KUYC 1P3OC 3AZIC 3EPLA 3A1KA 5JRGD 1P3PC 4J8UC 2NZDD 5BT1D 3W97D 2F8NG 4H9SA 4LD9D 3KXBB 2ZY5A 3X1TC 3X1VC 4KGCA 1M19B 1KU5A 3W98C 1P34B 2DF4C 3X1SC 3UTAC 3B6GD 1HQ3B 2NQBB 3IP4C 3C1BA 2BYKA 2JCHA 3P5JB 2YFVB 2HUEB 1ULYA 3KWQB 5CPKC 5AV8A 2ZY4A 3AV2D 1P3IC 4KUDB 4WU9D 4WNNA 3AZNA 5B0YB 1TZYB 3B6FB 3A6NA 1AOIA 3MGSA 5GSUC 2BG1A 4DQYB 5G49A 5BNVB 1F66A 1WWIA 4J8WA 1M18A 3WTPC 3NQUA 5AV5B 1P3LB 5BO0A 3REIB 4H9RA 3AZGC 2PYOA 5B32C 5B40D 5GXQD 1M19D 4YS3C 2RVQC 3REJB 2JSSA 2YFWB 1M1AD 5B2IC 5KDMA 5FUGB 5GT0C 4ZBJB 4AWLC 5B31A 3AZJD 3KWQD 3KUYD 1P3OD 3AZID 1P3PD 5CPJA 4CAYA 3LZ1C 4KGCB 4KUDD 1TAFA 4WJ3C 1P3FB 3X1VD 3W98D 4G92C 3AZHB 3B0BA 3C1BB 3UTAD 3AZKC 1P3GC 5B24A 5AVCC 4R8PA 4X23C 5B0ZA 4WU8A 4UPKA 2F8NA 3LELC 1U35C 5AV8B 4H9QA 4WNNB 5AVBB 4JJNC 3AZNB 3AV1C 3A6NB 3MVDA 3AZMC 1KX4C 5B2JB 5E5AA 3MGSB 1P3KB 3REJD 3WKJC 3W96B 2XD5A 4J8WB 5GSUD 3MGQC 3C1CC 1P3AA 1M18B 5AV9B 3AZFC 3NQUB 1S32A 5BO0B 3AFAA 4H9RB 4QLCC 3MNNB 3WTPD 2PYOB 3AYWB 2NZDA 4Z5TC 1EQZD 4LD9A 2CWEA 5F99A 3AZGD 4YS3D 5CP6B 5JRGC 1HTAA 1BH9A 2RVQD 4H9PB 3RELA 3VH6A 2BYMA 1KX3A 5B2ID 4YM6C 3X1UA 5GT0D 1ID3D 5CPJB 2FJ7B 1TAFB 3AZLA 1H3OA 3REKA 4KHAA 1P3BB 5B2JD 4J8VA 5B24B 1P3KD 4R8PB 4EO5C 5B0ZB 4WU8B 3AZKD 5B32G 3UT9A 1P3GD 5AVCD 2HIOA 4XZQB 4X23D 5AV6B 5GT3A 5B33A 3AV2C 5AY8B 4WU9C 5AV9D 3TU4C 4J8XA 4G91B 3UTBA 3LELD 2F2AC 3MNND 1U35D 2Y2MA 3EPKA 3WTPE 2Y2JA 3AYWD 5DNNB 3KFUG 3MVDB 3AV1D 5B1LA 1P3MA 4E45A 3O62D 2XD1A 3KXBC 3AN2A 4E44A 4WZSB 2ZY3A 3REHB 3WKJD 1S32B 1M19C 1M1AA 3MGQD 3C1CD 1P34C 3WAAA 3AFAB 3AZFD 1HQ3C 3LZ0B 3EPHA 5B1MA 3KUYA 2NQBC 3AZIA 4J8UA 1P3BD 2HUEC 3X1TA 3KWQC 1BH9B 2FFFB 2Y2OA 3X1SA 1KX3B 2Y2NA 4XZQD 4XUJB 4KUDC 3X1UB 5AY8D 4YM6D 4Z66A 5B0YC 1TZYC 2AROA 3B6FC 1H3OB 1BH8A 5DNND 5CPKA 1P3IA 3VH5A 3UT9B 2CV5B 5AV5C 1B6WA 1P3LC 3REIC 1KX5A 3AZEB 3REHD 4J8XB 3UTBB 4Z2MH 5CPIA 3TU4D 2W8SA 3LZ0D 3REJC 4ZUXB 3LJAA 5B1LB 3VH6T 4H9NB 4ZBJC 3WA9B 3W99B 3AZGA 5DNMB 2Y2LA 5B32A 4H9SC 3MGPB 5C3IB 4KGCC 4XUJD 3KXBD 1P3PA 2ZY2A 1EQZC 3WAAB 1P3FC 5B2IA 1P34D 3MGRA 3AZHC 1HQ3D 2NQBD 1N1JA 3LZ1A 1ID3C 3V9RA 3X1SB 3B0CW 5AVBC 3AZED 2Y2HA 4Z66B 4CSRA 2AROB 5AVCA 4NE5A 5B2JC 5B0YD 1TZYD 3MGSC 1P3KC 3B6FD 2BYKB 4HGAB 3W96C 4ZUXD 1Q9CA 4J8WC 2ZM5A 3WA9D 3W99D 1M18C 5DNMD 5AV9C 4JJNA 3MGPD 1KX5B 2Y2PA 3W96D 3MNNC 1ZLAA 4NE6A 3AZMA 1KX4A 5AV5D 3AYWC 1P3LD 3REID 5CPIB 5CP6C 3O62C 1AOIB 3MGQA 3LJAB 5G49B 4QLCA 1F66B 2DQNC 4Z5TA 5CPJC 2FJ7C 5JRGA 4KGCD 3W97A 1P3BC 3MGRB 1P3FD 3VH5T 5B24C 4R8PC 4YM6A 3AZHD 3C1BD 1T3UA 4WU8C 3B6GA 4XZQC 5KDMB 5BNXA 5AV6C 5AY8C 5B31B 3V9RB 4DRBA 1BFMA 4G91C 5AV8D 4CAYB 5DNNC 5BS7C 3MVDC 5AVBD 3AZND 3VH6W 3A6ND 3AV2A 1AOID 4WU9A 3MGSD 3B0DB 3REHC 2CV5A 1F66D 4JJNB 4J8WD 1S32C 2F8NB 3AFAC 1M18D 1ZLAB 3AZMB 4H9QB 3LZ0C 2PYOD 5E5AB 2JE5A 5B40A 5CP6D 5GXQA 1M19A 1KX3C 4XUJC 2J8PA 1P3AB 5B31D 2YFVA 2IO5B 5CPJD 3EG5B 2FJ7D 3W97B 3AZJA 3KWQA 2NZDB 4LD9B 5F99B 3R45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRA A;  2L5A A;  4KUD A;  4UUZ A;  3UT9 C;  5B24 D;  3X1V A;  4R8P D;  2CV5 C;  5BNX B;  3REL B;  3B6G B;  3B6F A;  3W98 A;  5B0Z D;  4WU8 D;  3AZE C;  2BYM B;  3UTA A;  5AV6 D;  4J8X C;  2F8N D;  1B67 A;  5BNV A;  4EO5 B;  4NFT A;  4ZUX C;  3AZL B;  3REK B;  4KHA B;  3MVD D;  3WA9 C;  3W99 C;  4J8V B;  5DNM C;  3MGP C;  5C3I C;  2HIO B;  5GT3 B;  5B33 B;  3REJ A;  2YFW A;  1S32 D;  5GSU A;  4NE3 A;  5FUG A;  3AFA D;  3VH5 W;  5F99 D;  4M6B A;  3WTP A;  1P3M B;  5B40 B;  5GXQ B;  1EQZ A;  1P3F A;  3REL D;  3AN2 B;  4YS3 A;  3AZH A;  1KX3 D;  4Z66 C;  2ARO C;  1M1A B;  3X1U D;  3AZJ B;  5B1M B;  3KUY B;  1P3O B;  3C1B C;  3AZI B;  5GT0 A;  3R45 B;  4HGA C;  3AZL D;  1P3P B;  1ID3 A;  4J8U B;  3REK D;  4UUZ B;  4J8V D;  5AVB A;  1R4V A;  3X1T B;  3X1V B;  4Z2M G;  1KX5 C;  3W98 B;  5AV8 C;  3UT9 D;  3UTA B;  5B2J A;  2HIO D;  2CV5 D;  5GT3 D;  5B33 D;  1P3K A;  1A7W A;  1WWS A;  5CPI C;  3AZK A;  3AZN C;  3W96 A;  1P3G A;  3A6N C;  4J8X D;  3UTB D;  4X23 A;  1P3O A;  1AOI C;  3LJA C;  4WV4 B;  5AV9 A;  1BH8 B;  5CPK B;  3LEL A;  3MNN A;  1U35 A;  5B1L D;  1F66 C;  1P3M D;  3AYW A;  1P3I B;  3AV1 A;  2F8N K;  3AN2 D;  5CP6 A;  3O62 A;  2PYO C;  3WAA D;  3MGR C;  4H9P A;  5GSU B;  3WKJ A;  5B1M D;  3NQJ A;  3C1C A;  1JFI A;  3WTP B;  4J8U D;  3AZF A;  2FJ7 A;  1EQZ B;  5B31 C;  3AZG B;  3X1T D;  5B32 B;  4YS3 B;  1P3B A;  3X1S D;  4Z66 D;  2ARO D;  5B2I B;  4XZQ A;  5AV6 A;  5AY8 A;  5JA4 A;  5GT0 B;  4AWL B;  1ID3 B;  1N1J B;  5CPK D;  3B0D C;  5B0Z C;  3LZ1 B;  1P3I D;  5DNN A;  2LY8 A;  5BS7 A;  1ZLA C;  1KX5 D;  4G92 B;  3AZK B;  4CSR B;  1P3G B;  5AVC B;  4X23 B;  5CPI D;  5E5A C;  3REH A;  1F1E A;  4H9O A;  3LEL B;  3LJA D;  1U35 B;  3TU4 A;  3LZ0 A;  1P3A C;  5B32 D;  3AV1 B;  2IO5 C;  3O62 B;  1KX4 B;  2NZD C;  5BT1 C;  3W97 C;  4LD9 C;  5F99 C;  3WKJ B;  3MGR D;  4XUJ A;  3KXB A;  3MGQ B;  3NQJ B;  3C1C B;  1JFI B;  3B6G C;  3REL C;  3AZF B;  1P34 A;  4QLC B;  3LZ1 D;  1HQ3 A;  3X1U C;  2NQB A;  4Z5T B;  5CHL B;  3AZL C;  5JRG B;  3REK C;  5JA4 B;  4J8V C;  3AZE A;  4YM6 B;  3B0C T;  2HIO C;  5B0Y A;  1TZY A;  5GT3 C;  5B33 C;  2F8N H;  4ZUX A;  4JJN D;  3UTB C;  4H9N A;  1ZLA D;  3KSY A;  3AZM D;  1KX4 D;  3W99 A;  3WA9 A;  5DNM A;  3MGP A;  5B31 G;  5B1L C;  1P3M C;  5AV5 A;  5GXQ C;  5B40 C;  3REI A;  3AV2 B;  4WU9 B;  4H9O B;  1P3L A;  5E5A D;  3TU4 B;  3AN2 C;  4QLC D;  1M1A C;  3WAA C;  1P3A D;  4Z5T D;  3AZJ C;  5B1M C;  3KUY C;  1P3O C;  3AZI C;  1P3P C;  5JRG D;  4J8U C;  2NZD D;  5BT1 D;  3W97 D;  2F8N G;  4H9S A;  4LD9 D;  3KXB B;  3X1T C;  3X1V C;  4KGC A;  1M19 B;  1KU5 A;  3W98 C;  1P34 B;  3X1S C;  3UTA C;  3B6G D;  1HQ3 B;  2NQB B;  3C1B A;  2BYK A;  2YFV B;  2HUE B;  1ULY A;  3KWQ B;  5CPK C;  5AV8 A;  3AV2 D;  1P3I C;  4KUD B;  4WU9 D;  4WNN A;  3AZN A;  5B0Y B;  1TZY B;  3B6F B;  3A6N A;  1AOI A;  3MGS A;  5GSU C;  5G49 A;  5BNV B;  1F66 A;  1WWI A;  4J8W A;  1M18 A;  3WTP C;  3NQU A;  5AV5 B;  1P3L B;  5BO0 A;  3REI B;  4H9R A;  3AZG C;  2PYO A;  5B32 C;  5B40 D;  5GXQ D;  1M19 D;  4YS3 C;  2RVQ C;  3REJ B;  2JSS A;  2YFW B;  1M1A D;  5B2I C;  5KDM A;  5FUG B;  5GT0 C;  4ZBJ B;  4AWL C;  5B31 A;  3AZJ D;  3KWQ D;  3KUY D;  1P3O D;  3AZI D;  1P3P D;  5CPJ A;  4CAY A;  3LZ1 C;  4KGC B;  4KUD D;  1TAF A;  1P3F B;  3X1V D;  3W98 D;  4G92 C;  3AZH B;  3B0B A;  3C1B B;  3UTA D;  3AZK C;  1P3G C;  5B24 A;  5AVC C;  4R8P A;  4X23 C;  5B0Z A;  4WU8 A;  2F8N A;  3LEL C;  1U35 C;  5AV8 B;  4H9Q A;  4WNN B;  5AVB B;  4JJN C;  3AZN B;  3AV1 C;  3A6N B;  3MVD A;  3AZM C;  1KX4 C;  5B2J B;  5E5A A;  3MGS B;  1P3K B;  3REJ D;  3WKJ C;  3W96 B;  4J8W B;  5GSU D;  3MGQ C;  3C1C C;  1P3A A;  1M18 B;  5AV9 B;  3AZF C;  3NQU B;  1S32 A;  5BO0 B;  3AFA A;  4H9R B;  4QLC C;  3MNN B;  3WTP D;  2PYO B;  3AYW B;  2NZD A;  4Z5T C;  1EQZ D;  4LD9 A;  2CWE A;  5F99 A;  3AZG D;  4YS3 D;  5CP6 B;  5JRG C;  1HTA A;  1BH9 A;  2RVQ D;  4H9P B;  3REL A;  3VH6 A;  2BYM A;  1KX3 A;  5B2I D;  4YM6 C;  3X1U A;  5GT0 D;  1ID3 D;  5CPJ B;  2FJ7 B;  1TAF B;  3AZL A;  1H3O A;  3REK A;  4KHA A;  1P3B B;  5B2J D;  4J8V A;  5B24 B;  1P3K D;  4R8P B;  4EO5 C;  5B0Z B;  4WU8 B;  3AZK D;  5B32 G;  3UT9 A;  1P3G D;  5AVC D;  2HIO A;  4XZQ B;  4X23 D;  5AV6 B;  5GT3 A;  5B33 A;  3AV2 C;  5AY8 B;  4WU9 C;  5AV9 D;  3TU4 C;  4J8X A;  4G91 B;  3UTB A;  3LEL D;  3MNN D;  1U35 D;  3WTP E;  3AYW D;  5DNN B;  3MVD B;  3AV1 D;  5B1L A;  1P3M A;  4E45 A;  3O62 D;  3KXB C;  3AN2 A;  4E44 A;  4WZS B;  3REH B;  3WKJ D;  1S32 B;  1M19 C;  1M1A A;  3MGQ D;  3C1C D;  1P34 C;  3WAA A;  3AFA B;  3AZF D;  1HQ3 C;  3LZ0 B;  2NQB C;  5B1M A;  3KUY A;  3AZI A;  4J8U A;  1P3B D;  2HUE C;  3X1T A;  3KWQ C;  1BH9 B;  3X1S A;  1KX3 B;  4XZQ D;  4XUJ B;  4KUD C;  3X1U B;  5AY8 D;  4YM6 D;  4Z66 A;  5B0Y C;  1TZY C;  2ARO A;  3B6F C;  1H3O B;  1BH8 A;  5DNN D;  5CPK A;  1P3I A;  3VH5 A;  3UT9 B;  2CV5 B;  5AV5 C;  1B6W A;  1P3L C;  3REI C;  1KX5 A;  3AZE B;  3REH D;  4J8X B;  3UTB B;  4Z2M H;  5CPI A;  3TU4 D;  3LZ0 D;  3REJ C;  4ZUX B;  3LJA A;  5B1L B;  3VH6 T;  4H9N B;  4ZBJ C;  3WA9 B;  3W99 B;  3AZG A;  5DNM B;  5B32 A;  4H9S C;  3MGP B;  5C3I B;  4KGC C;  4XUJ D;  3KXB D;  1P3P A;  1EQZ C;  3WAA B;  1P3F C;  5B2I A;  1P34 D;  3MGR A;  3AZH C;  1HQ3 D;  2NQB D;  1N1J A;  3LZ1 A;  1ID3 C;  3V9R A;  3X1S B;  3B0C W;  5AVB C;  3AZE D;  4Z66 B;  4CSR A;  2ARO B;  5AVC A;  4NE5 A;  5B2J C;  5B0Y D;  1TZY D;  3MGS C;  1P3K C;  3B6F D;  2BYK B;  4HGA B;  3W96 C;  4ZUX D;  1Q9C A;  4J8W C;  3WA9 D;  3W99 D;  1M18 C;  5DNM D;  5AV9 C;  4JJN A;  3MGP D;  1KX5 B;  3W96 D;  3MNN C;  1ZLA A;  4NE6 A;  3AZM A;  1KX4 A;  5AV5 D;  3AYW C;  1P3L D;  3REI D;  5CPI B;  5CP6 C;  3O62 C;  1AOI B;  3MGQ A;  3LJA B;  5G49 B;  4QLC A;  1F66 B;  4Z5T A;  5CPJ C;  2FJ7 C;  5JRG A;  4KGC D;  3W97 A;  1P3B C;  3MGR B;  1P3F D;  3VH5 T;  5B24 C;  4R8P C;  4YM6 A;  3AZH D;  3C1B D;  4WU8 C;  3B6G A;  4XZQ C;  5KDM B;  5BNX A;  5AV6 C;  5AY8 C;  5B31 B;  3V9R B;  4DRB A;  1BFM A;  4G91 C;  5AV8 D;  4CAY B;  5DNN C;  5BS7 C;  3MVD C;  5AVB D;  3AZN D;  3VH6 W;  3A6N D;  3AV2 A;  1AOI D;  4WU9 A;  3MGS D;  3B0D B;  3REH C;  2CV5 A;  1F66 D;  4JJN B;  4J8W D;  1S32 C;  2F8N B;  3AFA C;  1M18 D;  1ZLA B;  3AZM B;  4H9Q B;  3LZ0 C;  2PYO D;  5E5A B;  5B40 A;  5CP6 D;  5GXQ A;  1M19 A;  1KX3 C;  4XUJ C;  1P3A B;  5B31 D;  2YFV A;  2IO5 B;  5CPJ D;  2FJ7 D;  3W97 B;  3AZJ A;  3KWQ A;  2NZD B;  4LD9 B;  5F99 B;  3R45 A; 
#chains in the Genus database with same CATH topology
 4DRA A;  2L5A A;  4KUD A;  4UUZ A;  3UT9 C;  5B24 D;  3X1V A;  4R8P D;  2CV5 C;  5BNX B;  3REL B;  3B6G B;  3B6F A;  3W98 A;  5B0Z D;  4WU8 D;  3AZE C;  2BYM B;  2G5H C;  3UTA A;  5AV6 D;  4J8X C;  2F8N D;  1B67 A;  5BNV A;  4EO5 B;  4NFT A;  4ZUX C;  3AZL B;  3REK B;  4KHA B;  3MVD D;  3WA9 C;  3W99 C;  4J8V B;  5DNM C;  3MGP C;  5C3I C;  2HIO B;  5GT3 B;  5B33 B;  3REJ A;  2YFW A;  1S32 D;  1PZR A;  5GSU A;  4NE3 A;  5FUG A;  3AFA D;  3VH5 W;  2Y2I A;  5F99 D;  4M6B A;  3WTP A;  1P3M B;  5B40 B;  5GXQ B;  1EQZ A;  1P3F A;  3H0M C;  2Y2Q A;  2UWX A;  2G5I C;  3REL D;  3AN2 B;  4YS3 A;  3AZH A;  1KX3 D;  4Z66 C;  2ARO C;  1M1A B;  3X1U D;  3AZJ B;  5B1M B;  3KUY B;  1P3O B;  3C1B C;  3AZI B;  5GT0 A;  3R45 B;  4HGA C;  3AZL D;  1P3P B;  1ID3 A;  4J8U B;  3REK D;  4UUZ B;  4J8V D;  5AVB A;  1R4V A;  3X1T B;  3X1V B;  4Z2M G;  1KX5 C;  3W98 B;  5AV8 C;  3UT9 D;  3UTA B;  5B2J A;  2HIO D;  2CV5 D;  5GT3 D;  5B33 D;  1P3K A;  1A7W A;  1WWS A;  5CPI C;  3AZK A;  3AZN C;  3W96 A;  1P3G A;  3A6N C;  4J8X D;  3UTB D;  4X23 A;  1P3O A;  1AOI C;  3LJA C;  4WV4 B;  5AV9 A;  1BH8 B;  5CPK B;  3LEL A;  3MNN A;  1U35 A;  5B1L D;  1F66 C;  1P3M D;  3AYW A;  1P3I B;  3H0R C;  3AV1 A;  2F8N K;  3AN2 D;  5CP6 A;  3O62 A;  2PYO C;  3WAA D;  3MGR C;  4H9P A;  5GSU B;  3WKJ A;  5B1M D;  3NQJ A;  3C1C A;  1JFI A;  2Y2K A;  3WTP B;  4J8U D;  3AZF A;  2FJ7 A;  1EQZ B;  5B31 C;  3AZG B;  3X1T D;  5B32 B;  1W2E A;  4YS3 B;  1P3B A;  3X1S D;  4Z66 D;  2ARO D;  5B2I B;  4XZQ A;  5AV6 A;  5AY8 A;  5JA4 A;  5GT0 B;  1Z2C B;  4AWL B;  1ID3 B;  1N1J B;  3H0L C;  3B0D C;  5B0Z C;  5CPK D;  3LZ1 B;  1P3I D;  5DNN A;  2LY8 A;  5BS7 A;  1ZLA C;  1KX5 D;  4G92 B;  3AZK B;  4CSR B;  1P3G B;  5AVC B;  4X23 B;  5CPI D;  5E5A C;  3REH A;  2RIQ A;  1F1E A;  4H9O A;  3LEL B;  3LJA D;  1U35 B;  3TU4 A;  3LZ0 A;  1P3A C;  5B32 D;  3AV1 B;  2IO5 C;  3O62 B;  2VQR A;  1KX4 B;  2NZD C;  5BT1 C;  3W97 C;  4LD9 C;  5F99 C;  3WKJ B;  3MGR D;  4XUJ A;  3KXB A;  3MGQ B;  3NQJ B;  3C1C B;  1JFI B;  3B6G C;  3REL C;  3AZF B;  1P34 A;  2Y2G A;  4QLC B;  3LZ1 D;  1HQ3 A;  3X1U C;  3FDD A;  4Z5T B;  2NQB A;  5CHL B;  3AZL C;  5JRG B;  3REK C;  3EPJ A;  5JA4 B;  4J8V C;  3AZE A;  4YM6 B;  3B0C T;  2HIO C;  5B0Y A;  1TZY A;  5GT3 C;  5B33 C;  2F8N H;  4ZUX A;  4JJN D;  3UTB C;  3A1I A;  4H9N A;  1ZLA D;  3KSY A;  3AZM D;  1KX4 D;  3W99 A;  3WA9 A;  5DNM A;  3AL0 C;  3MGP A;  5B31 G;  5B1L C;  1P3M C;  5AV5 A;  5GXQ C;  5B40 C;  3REI A;  3AV2 B;  4WU9 B;  4H9O B;  1P3L A;  5E5A D;  3TU4 B;  3AN2 C;  3F6T A;  4QLC D;  1M1A C;  3WAA C;  1P3A D;  4Z5T D;  3AZJ C;  5B1M C;  3KUY C;  1P3O C;  3AZI C;  3EPL A;  3A1K A;  5JRG D;  1P3P C;  4J8U C;  2NZD D;  5BT1 D;  3W97 D;  2F8N G;  4H9S A;  4LD9 D;  3KXB B;  2ZY5 A;  3X1T C;  3X1V C;  4KGC A;  1M19 B;  1KU5 A;  3W98 C;  1P34 B;  2DF4 C;  3X1S C;  3UTA C;  3B6G D;  1HQ3 B;  2NQB B;  3IP4 C;  3C1B A;  2BYK A;  2JCH A;  3P5J B;  2YFV B;  2HUE B;  1ULY A;  3KWQ B;  5CPK C;  5AV8 A;  2ZY4 A;  3AV2 D;  1P3I C;  4KUD B;  4WU9 D;  4WNN A;  3AZN A;  5B0Y B;  1TZY B;  3B6F B;  3A6N A;  1AOI A;  3MGS A;  5GSU C;  2BG1 A;  4DQY B;  5G49 A;  5BNV B;  1F66 A;  1WWI A;  4J8W A;  1M18 A;  3WTP C;  3NQU A;  5AV5 B;  1P3L B;  5BO0 A;  3REI B;  4H9R A;  3AZG C;  2PYO A;  5B32 C;  5B40 D;  5GXQ D;  1M19 D;  4YS3 C;  2RVQ C;  3REJ B;  2JSS A;  2YFW B;  1M1A D;  5B2I C;  5KDM A;  5FUG B;  5GT0 C;  4ZBJ B;  4AWL C;  5B31 A;  3AZJ D;  3KWQ D;  3KUY D;  1P3O D;  3AZI D;  1P3P D;  5CPJ A;  4CAY A;  3LZ1 C;  4KGC B;  4KUD D;  1TAF A;  4WJ3 C;  1P3F B;  3X1V D;  3W98 D;  4G92 C;  3AZH B;  3B0B A;  3C1B B;  3UTA D;  3AZK C;  1P3G C;  5B24 A;  5AVC C;  4R8P A;  4X23 C;  5B0Z A;  4WU8 A;  4UPK A;  2F8N A;  3LEL C;  1U35 C;  5AV8 B;  4H9Q A;  4WNN B;  5AVB B;  4JJN C;  3AZN B;  3AV1 C;  3A6N B;  3MVD A;  3AZM C;  1KX4 C;  5B2J B;  5E5A A;  3MGS B;  1P3K B;  3REJ D;  3WKJ C;  3W96 B;  2XD5 A;  4J8W B;  5GSU D;  3MGQ C;  3C1C C;  1P3A A;  1M18 B;  5AV9 B;  3AZF C;  3NQU B;  1S32 A;  5BO0 B;  3AFA A;  4H9R B;  4QLC C;  3MNN B;  3WTP D;  2PYO B;  3AYW B;  2NZD A;  4Z5T C;  1EQZ D;  4LD9 A;  2CWE A;  5F99 A;  3AZG D;  4YS3 D;  5CP6 B;  5JRG C;  1HTA A;  1BH9 A;  2RVQ D;  4H9P B;  3REL A;  3VH6 A;  2BYM A;  1KX3 A;  5B2I D;  4YM6 C;  3X1U A;  5GT0 D;  1ID3 D;  5CPJ B;  2FJ7 B;  1TAF B;  3AZL A;  1H3O A;  3REK A;  4KHA A;  1P3B B;  5B2J D;  4J8V A;  5B24 B;  1P3K D;  4R8P B;  4EO5 C;  5B0Z B;  4WU8 B;  3AZK D;  5B32 G;  3UT9 A;  1P3G D;  5AVC D;  2HIO A;  4XZQ B;  4X23 D;  5AV6 B;  5GT3 A;  5B33 A;  3AV2 C;  5AY8 B;  4WU9 C;  5AV9 D;  3TU4 C;  4J8X A;  4G91 B;  3UTB A;  3LEL D;  2F2A C;  3MNN D;  1U35 D;  2Y2M A;  3EPK A;  3WTP E;  2Y2J A;  3AYW D;  5DNN B;  3KFU G;  3MVD B;  3AV1 D;  5B1L A;  1P3M A;  4E45 A;  3O62 D;  2XD1 A;  3KXB C;  3AN2 A;  4E44 A;  4WZS B;  2ZY3 A;  3REH B;  3WKJ D;  1S32 B;  1M19 C;  1M1A A;  3MGQ D;  3C1C D;  1P34 C;  3WAA A;  3AFA B;  3AZF D;  1HQ3 C;  3LZ0 B;  3EPH A;  5B1M A;  3KUY A;  2NQB C;  3AZI A;  4J8U A;  1P3B D;  2HUE C;  3X1T A;  3KWQ C;  1BH9 B;  2FFF B;  2Y2O A;  3X1S A;  1KX3 B;  2Y2N A;  4XZQ D;  4XUJ B;  4KUD C;  3X1U B;  5AY8 D;  4YM6 D;  4Z66 A;  5B0Y C;  1TZY C;  2ARO A;  3B6F C;  1H3O B;  1BH8 A;  5DNN D;  5CPK A;  1P3I A;  3VH5 A;  3UT9 B;  2CV5 B;  5AV5 C;  1B6W A;  1P3L C;  3REI C;  1KX5 A;  3AZE B;  3REH D;  4J8X B;  3UTB B;  4Z2M H;  5CPI A;  3TU4 D;  2W8S A;  3LZ0 D;  3REJ C;  4ZUX B;  3LJA A;  5B1L B;  3VH6 T;  4H9N B;  4ZBJ C;  3WA9 B;  3W99 B;  3AZG A;  5DNM B;  2Y2L A;  5B32 A;  4H9S C;  3MGP B;  5C3I B;  4KGC C;  4XUJ D;  3KXB D;  1P3P A;  2ZY2 A;  1EQZ C;  3WAA B;  1P3F C;  5B2I A;  1P34 D;  3MGR A;  3AZH C;  1HQ3 D;  2NQB D;  1N1J A;  3LZ1 A;  1ID3 C;  3V9R A;  3X1S B;  3B0C W;  5AVB C;  3AZE D;  2Y2H A;  4Z66 B;  4CSR A;  2ARO B;  5AVC A;  4NE5 A;  5B2J C;  5B0Y D;  1TZY D;  3MGS C;  1P3K C;  3B6F D;  2BYK B;  4HGA B;  3W96 C;  4ZUX D;  1Q9C A;  4J8W C;  2ZM5 A;  3WA9 D;  3W99 D;  1M18 C;  5DNM D;  5AV9 C;  4JJN A;  3MGP D;  1KX5 B;  2Y2P A;  3W96 D;  3MNN C;  1ZLA A;  4NE6 A;  3AZM A;  1KX4 A;  5AV5 D;  3AYW C;  1P3L D;  3REI D;  5CPI B;  5CP6 C;  3O62 C;  1AOI B;  3MGQ A;  3LJA B;  5G49 B;  4QLC A;  1F66 B;  2DQN C;  4Z5T A;  5CPJ C;  2FJ7 C;  5JRG A;  4KGC D;  3W97 A;  1P3B C;  3MGR B;  1P3F D;  3VH5 T;  5B24 C;  4R8P C;  4YM6 A;  3AZH D;  3C1B D;  1T3U A;  4WU8 C;  3B6G A;  4XZQ C;  5KDM B;  5BNX A;  5AV6 C;  5AY8 C;  5B31 B;  3V9R B;  4DRB A;  1BFM A;  4G91 C;  5AV8 D;  4CAY B;  5DNN C;  5BS7 C;  3MVD C;  5AVB D;  3AZN D;  3VH6 W;  3A6N D;  3AV2 A;  1AOI D;  4WU9 A;  3MGS D;  3B0D B;  3REH C;  2CV5 A;  1F66 D;  4JJN B;  4J8W D;  1S32 C;  2F8N B;  3AFA C;  1M18 D;  1ZLA B;  3AZM B;  4H9Q B;  3LZ0 C;  2PYO D;  5E5A B;  2JE5 A;  5B40 A;  5CP6 D;  5GXQ A;  1M19 A;  1KX3 C;  4XUJ C;  2J8P A;  1P3A B;  5B31 D;  2YFV A;  2IO5 B;  5CPJ D;  3EG5 B;  2FJ7 D;  3W97 B;  3AZJ A;  3KWQ A;  2NZD B;  4LD9 B;  5F99 B;  3R45 A; 
#chains in the Genus database with same CATH homology
 4DRA A;  2L5A A;  4KUD A;  4UUZ A;  3UT9 C;  5B24 D;  3X1V A;  4R8P D;  2CV5 C;  5BNX B;  3REL B;  3B6G B;  3B6F A;  3W98 A;  5B0Z D;  4WU8 D;  3AZE C;  2BYM B;  2G5H C;  3UTA A;  5AV6 D;  4J8X C;  2F8N D;  1B67 A;  5BNV A;  4EO5 B;  4NFT A;  4ZUX C;  3AZL B;  3REK B;  4KHA B;  3MVD D;  3WA9 C;  3W99 C;  4J8V B;  5DNM C;  3MGP C;  5C3I C;  2HIO B;  5GT3 B;  5B33 B;  3REJ A;  2YFW A;  1S32 D;  1PZR A;  5GSU A;  4NE3 A;  5FUG A;  3AFA D;  3VH5 W;  2Y2I A;  5F99 D;  4M6B A;  3WTP A;  1P3M B;  5B40 B;  5GXQ B;  1EQZ A;  1P3F A;  3H0M C;  2Y2Q A;  2UWX A;  2G5I C;  3REL D;  3AN2 B;  4YS3 A;  3AZH A;  1KX3 D;  4Z66 C;  2ARO C;  1M1A B;  3X1U D;  3AZJ B;  5B1M B;  3KUY B;  1P3O B;  3C1B C;  3AZI B;  5GT0 A;  3R45 B;  4HGA C;  3AZL D;  1P3P B;  1ID3 A;  4J8U B;  3REK D;  4UUZ B;  4J8V D;  5AVB A;  1R4V A;  3X1T B;  3X1V B;  4Z2M G;  1KX5 C;  3W98 B;  5AV8 C;  3UT9 D;  3UTA B;  5B2J A;  2HIO D;  2CV5 D;  5GT3 D;  5B33 D;  1P3K A;  1A7W A;  1WWS A;  5CPI C;  3AZK A;  3AZN C;  3W96 A;  1P3G A;  3A6N C;  4J8X D;  3UTB D;  4X23 A;  1P3O A;  1AOI C;  3LJA C;  4WV4 B;  5AV9 A;  1BH8 B;  5CPK B;  3LEL A;  3MNN A;  1U35 A;  5B1L D;  1F66 C;  1P3M D;  3AYW A;  1P3I B;  3H0R C;  3AV1 A;  2F8N K;  3AN2 D;  5CP6 A;  3O62 A;  2PYO C;  3WAA D;  3MGR C;  4H9P A;  5GSU B;  3WKJ A;  5B1M D;  3NQJ A;  3C1C A;  1JFI A;  2Y2K A;  3WTP B;  4J8U D;  3AZF A;  2FJ7 A;  1EQZ B;  5B31 C;  3AZG B;  3X1T D;  5B32 B;  1W2E A;  4YS3 B;  1P3B A;  3X1S D;  4Z66 D;  2ARO D;  5B2I B;  4XZQ A;  5AV6 A;  5AY8 A;  5JA4 A;  5GT0 B;  1Z2C B;  4AWL B;  1ID3 B;  1N1J B;  3H0L C;  3B0D C;  5B0Z C;  5CPK D;  3LZ1 B;  1P3I D;  5DNN A;  2LY8 A;  5BS7 A;  1ZLA C;  1KX5 D;  4G92 B;  3AZK B;  4CSR B;  1P3G B;  5AVC B;  4X23 B;  5CPI D;  5E5A C;  3REH A;  2RIQ A;  1F1E A;  4H9O A;  3LEL B;  3LJA D;  1U35 B;  3TU4 A;  3LZ0 A;  1P3A C;  5B32 D;  3AV1 B;  2IO5 C;  3O62 B;  2VQR A;  1KX4 B;  2NZD C;  5BT1 C;  3W97 C;  4LD9 C;  5F99 C;  3WKJ B;  3MGR D;  4XUJ A;  3KXB A;  3MGQ B;  3NQJ B;  3C1C B;  1JFI B;  3B6G C;  3REL C;  3AZF B;  1P34 A;  2Y2G A;  4QLC B;  3LZ1 D;  1HQ3 A;  3X1U C;  3FDD A;  4Z5T B;  2NQB A;  5CHL B;  3AZL C;  5JRG B;  3REK C;  3EPJ A;  5JA4 B;  4J8V C;  3AZE A;  4YM6 B;  3B0C T;  2HIO C;  5B0Y A;  1TZY A;  5GT3 C;  5B33 C;  2F8N H;  4ZUX A;  4JJN D;  3UTB C;  3A1I A;  4H9N A;  1ZLA D;  3KSY A;  3AZM D;  1KX4 D;  3W99 A;  3WA9 A;  5DNM A;  3AL0 C;  3MGP A;  5B31 G;  5B1L C;  1P3M C;  5AV5 A;  5GXQ C;  5B40 C;  3REI A;  3AV2 B;  4WU9 B;  4H9O B;  1P3L A;  5E5A D;  3TU4 B;  3AN2 C;  3F6T A;  4QLC D;  1M1A C;  3WAA C;  1P3A D;  4Z5T D;  3AZJ C;  5B1M C;  3KUY C;  1P3O C;  3AZI C;  3EPL A;  3A1K A;  5JRG D;  1P3P C;  4J8U C;  2NZD D;  5BT1 D;  3W97 D;  2F8N G;  4H9S A;  4LD9 D;  3KXB B;  2ZY5 A;  3X1T C;  3X1V C;  4KGC A;  1M19 B;  1KU5 A;  3W98 C;  1P34 B;  2DF4 C;  3X1S C;  3UTA C;  3B6G D;  1HQ3 B;  2NQB B;  3IP4 C;  3C1B A;  2BYK A;  2JCH A;  3P5J B;  2YFV B;  2HUE B;  1ULY A;  3KWQ B;  5CPK C;  5AV8 A;  2ZY4 A;  3AV2 D;  1P3I C;  4KUD B;  4WU9 D;  4WNN A;  3AZN A;  5B0Y B;  1TZY B;  3B6F B;  3A6N A;  1AOI A;  3MGS A;  5GSU C;  2BG1 A;  4DQY B;  5G49 A;  5BNV B;  1F66 A;  1WWI A;  4J8W A;  1M18 A;  3WTP C;  3NQU A;  5AV5 B;  1P3L B;  5BO0 A;  3REI B;  4H9R A;  3AZG C;  2PYO A;  5B32 C;  5B40 D;  5GXQ D;  1M19 D;  4YS3 C;  2RVQ C;  3REJ B;  2JSS A;  2YFW B;  1M1A D;  5B2I C;  5KDM A;  5FUG B;  5GT0 C;  4ZBJ B;  4AWL C;  5B31 A;  3AZJ D;  3KWQ D;  3KUY D;  1P3O D;  3AZI D;  1P3P D;  5CPJ A;  4CAY A;  3LZ1 C;  4KGC B;  4KUD D;  1TAF A;  4WJ3 C;  1P3F B;  3X1V D;  3W98 D;  4G92 C;  3AZH B;  3B0B A;  3C1B B;  3UTA D;  3AZK C;  1P3G C;  5B24 A;  5AVC C;  4R8P A;  4X23 C;  5B0Z A;  4WU8 A;  4UPK A;  2F8N A;  3LEL C;  1U35 C;  5AV8 B;  4H9Q A;  4WNN B;  5AVB B;  4JJN C;  3AZN B;  3AV1 C;  3A6N B;  3MVD A;  3AZM C;  1KX4 C;  5B2J B;  5E5A A;  3MGS B;  1P3K B;  3REJ D;  3WKJ C;  3W96 B;  2XD5 A;  4J8W B;  5GSU D;  3MGQ C;  3C1C C;  1P3A A;  1M18 B;  5AV9 B;  3AZF C;  3NQU B;  1S32 A;  5BO0 B;  3AFA A;  4H9R B;  4QLC C;  3MNN B;  3WTP D;  2PYO B;  3AYW B;  2NZD A;  4Z5T C;  1EQZ D;  4LD9 A;  2CWE A;  5F99 A;  3AZG D;  4YS3 D;  5CP6 B;  5JRG C;  1HTA A;  1BH9 A;  2RVQ D;  4H9P B;  3REL A;  3VH6 A;  2BYM A;  1KX3 A;  5B2I D;  4YM6 C;  3X1U A;  5GT0 D;  1ID3 D;  5CPJ B;  2FJ7 B;  1TAF B;  3AZL A;  1H3O A;  3REK A;  4KHA A;  1P3B B;  5B2J D;  4J8V A;  5B24 B;  1P3K D;  4R8P B;  4EO5 C;  5B0Z B;  4WU8 B;  3AZK D;  5B32 G;  3UT9 A;  1P3G D;  5AVC D;  2HIO A;  4XZQ B;  4X23 D;  5AV6 B;  5GT3 A;  5B33 A;  3AV2 C;  5AY8 B;  4WU9 C;  5AV9 D;  3TU4 C;  4J8X A;  4G91 B;  3UTB A;  3LEL D;  2F2A C;  3MNN D;  1U35 D;  2Y2M A;  3EPK A;  3WTP E;  2Y2J A;  3AYW D;  5DNN B;  3KFU G;  3MVD B;  3AV1 D;  5B1L A;  1P3M A;  4E45 A;  3O62 D;  2XD1 A;  3KXB C;  3AN2 A;  4E44 A;  4WZS B;  2ZY3 A;  3REH B;  3WKJ D;  1S32 B;  1M19 C;  1M1A A;  3MGQ D;  3C1C D;  1P34 C;  3WAA A;  3AFA B;  3AZF D;  1HQ3 C;  3LZ0 B;  3EPH A;  5B1M A;  3KUY A;  2NQB C;  3AZI A;  4J8U A;  1P3B D;  2HUE C;  3X1T A;  3KWQ C;  1BH9 B;  2FFF B;  2Y2O A;  3X1S A;  1KX3 B;  2Y2N A;  4XZQ D;  4XUJ B;  4KUD C;  3X1U B;  5AY8 D;  4YM6 D;  4Z66 A;  5B0Y C;  1TZY C;  2ARO A;  3B6F C;  1H3O B;  1BH8 A;  5DNN D;  5CPK A;  1P3I A;  3VH5 A;  3UT9 B;  2CV5 B;  5AV5 C;  1B6W A;  1P3L C;  3REI C;  1KX5 A;  3AZE B;  3REH D;  4J8X B;  3UTB B;  4Z2M H;  5CPI A;  3TU4 D;  2W8S A;  3LZ0 D;  3REJ C;  4ZUX B;  3LJA A;  5B1L B;  3VH6 T;  4H9N B;  4ZBJ C;  3WA9 B;  3W99 B;  3AZG A;  5DNM B;  2Y2L A;  5B32 A;  4H9S C;  3MGP B;  5C3I B;  4KGC C;  4XUJ D;  3KXB D;  1P3P A;  2ZY2 A;  1EQZ C;  3WAA B;  1P3F C;  5B2I A;  1P34 D;  3MGR A;  3AZH C;  1HQ3 D;  2NQB D;  1N1J A;  3LZ1 A;  1ID3 C;  3V9R A;  3X1S B;  3B0C W;  5AVB C;  3AZE D;  2Y2H A;  4Z66 B;  4CSR A;  2ARO B;  5AVC A;  4NE5 A;  5B2J C;  5B0Y D;  1TZY D;  3MGS C;  1P3K C;  3B6F D;  2BYK B;  4HGA B;  3W96 C;  4ZUX D;  1Q9C A;  4J8W C;  2ZM5 A;  3WA9 D;  3W99 D;  1M18 C;  5DNM D;  5AV9 C;  4JJN A;  3MGP D;  1KX5 B;  2Y2P A;  3W96 D;  3MNN C;  1ZLA A;  4NE6 A;  3AZM A;  1KX4 A;  5AV5 D;  3AYW C;  1P3L D;  3REI D;  5CPI B;  5CP6 C;  3O62 C;  1AOI B;  3MGQ A;  3LJA B;  5G49 B;  4QLC A;  1F66 B;  2DQN C;  4Z5T A;  5CPJ C;  2FJ7 C;  5JRG A;  4KGC D;  3W97 A;  1P3B C;  3MGR B;  1P3F D;  3VH5 T;  5B24 C;  4R8P C;  4YM6 A;  3AZH D;  3C1B D;  1T3U A;  4WU8 C;  3B6G A;  4XZQ C;  5KDM B;  5BNX A;  5AV6 C;  5AY8 C;  5B31 B;  3V9R B;  4DRB A;  1BFM A;  4G91 C;  5AV8 D;  4CAY B;  5DNN C;  5BS7 C;  3MVD C;  5AVB D;  3AZN D;  3VH6 W;  3A6N D;  3AV2 A;  1AOI D;  4WU9 A;  3MGS D;  3B0D B;  3REH C;  2CV5 A;  1F66 D;  4JJN B;  4J8W D;  1S32 C;  2F8N B;  3AFA C;  1M18 D;  1ZLA B;  3AZM B;  4H9Q B;  3LZ0 C;  2PYO D;  5E5A B;  2JE5 A;  5B40 A;  5CP6 D;  5GXQ A;  1M19 A;  1KX3 C;  4XUJ C;  2J8P A;  1P3A B;  5B31 D;  2YFV A;  2IO5 B;  5CPJ D;  3EG5 B;  2FJ7 D;  3W97 B;  3AZJ A;  3KWQ A;  2NZD B;  4LD9 B;  5F99 B;  3R45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...