3W99A

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99A00
5JA4A 1P3MD 5DNNC 2LY8A 5E5AB 4ZBJB 4R8PA 1F66B 4WU8A 3REHC 3KWQA 4X23A 1WWIA 5E5AC 4CAYB 5FUGA 3MGQC 3UTBC 2BYMB 3AZGB 4XZQD 3MGPB 5AV5D 3AZMB 2YFVB 4WZSB 3O62D 3MGSA 2RVQD 3VH5T 4Z66D 1KX4D 1H3OB 5BNVB 3AZMC 1EQZC 5GT0A 3REKB 3AZFB 2FJ7B 3KXBD 3NQUB 3WTPB 2AROD 4KGCB 4KUDD 5AY8D 2NZDB 5CPKB 5DNND 3X1UA 1M1AC 2F8ND 3R45A 3WTPC 3REJB 3C1CA 1TZYA 3X1TA 3W99A 4KHAA 5KDMA 3UTAA 5BS7A 1B67A 3MGQD 3REJC 3UTBD 3LZ1D 1N1JB 1P3AA 3MVDB 5GSUA 2F8NG 3W96A 3AFAA 4DRAA 3RELA 2HIOD 3X1SB 3MVDC 1EQZD 1P3GD 1P3ID 4LD9B 5JRGC 5B2IB 3AZHA 5B31A 4YS3D 3B6GB 5BO0B 1M1AD 3X1SC 4H9NA 4J8UC 5AV6C 4UUZA 5B2IC 5F99B 5AVCC 4YM6C 3V9RB 3B6GC 4H9RB 4E45A 4WU9D 3C1BD 3W97D 4J8WC 4J8VB 5BNXA 3MNNB 5CP6A 4Z2MH 4QLCD 5GXQD 3AV2A 4J8VC 1P34B 2BYMA 3UT9B 3MGPA 5B40B 5JRGD 3AZIA 3MGRD 4WNNB 4J8XB 2BYKA 3AZKD 1P34C 1P3PD 1P3LA 1BH8B 1H3OA 3VH5W 1P3FA 5B40C 4J8UD 5GT3B 5DNMC 5AV6D 3AZFA 5B1LC 5AVCD 3AZLA 4J8XC 4YM6D 3AN2A 5CPJD 2FJ7A 3B6GD 4KGCA 1S32D 5CPKA 4JJND 4J8WD 5GT3C 1TAFA 4ZUXA 3KUYB 1AOIB 3X1VA 1P3OC 4AWLB 2NQBB 1AOIC 1ZLAD 5B2JC 3AZEA 1U35B 4AWLC 1P3MB 5AV9D 2CV5C 5AV8C 3REIA 5DNMD 1U35C 5B1LD 4WU8C 1P3KC 3KWQC 1P3MC 1ID3D 1M18A 1WWSA 3LJAD 1KX5A 3B6FA 4Z5TA 4XZQB 3B0BA 5AV5B 3O62B 5G49B 1P3OD 5B0YA 3AZJA 4Z66B 3WKJD 4XUJA 1KX4B 1KX3B 5AV5C 5B2JD 3KXBB 2RVQC 2AROB 4KUDB 5AY8B 1M19D 4Z66C 3AYWA 1P3BA 1KX3C 2CV5D 2F8NB 5AV8D 5B1MA 1HQ3A 1B6WA 3UT9A 5CPIB 4R8PD 2AROC 5AY8C 4WU8D 1P3KD 3KWQD 3NQJB 3W98A 1HTAA 3AV1A 4X23D 1BFMA 1JFIB 1BH8A 5CPIC 3MGQB 3UTBB 3LZ1B 1P3AC 5B33A 5BT1C 3MGSD 4H9QA 3WA9C 2HIOB 3LZ1C 1EQZB 5B0ZA 1P3GB 1P3IB 3TU4C 5GT0D 5CHLB 3KSYA 4H9OB 4YS3B 2HIOC 1BH9B 1KX3D 1M1AB 2NQBA 3WAAA 4H9PB 3VH6A 3X1UD 1P3GC 1P3IC 3A6NA 4YS3C 3C1CD 1TZYD 3C1BB 3X1TD 5B32A 4WU9B 3W97B 5B24A 3W99D 5CPID 4H9SC 4M6BA 3UTAD 1P3AD 5AVBC 4WU9C 3C1BC 3W97C 5BT1D 5GSUD 5GXQB 4QLCB 3WA9D 3AFAD 3RELD 4DRBA 3AZNC 3AV2C 4CSRA 5JRGB 3O62A 4QLCC 5GXQC 3MGRB 3TU4D 3AZHD 5B31D 3AZKB 1P3PB 3VH6T 2PYOA 5C3IC 3LELA 1P3LC 4J8UB 5AV6B 1P3FC 5AVCB 3MGRC 4NE3A 4NE5A 4YM6B 3KXBA 3AZLC 5CPJB 1S32B 3AZKC 1P3PC 4G91C 5DNNA 4Z2MG 4JJNB 4J8WB 2JSSA 3REHA 4HGAB 5CPJC 5B31G 1S32C 5AVBD 3NQJA 5CP6D 3X1VC 4JJNC 5E5AA 1JFIA 1F66A 3AZND 4HGAC 3MGQA 3AV2D 1ZLAB 3AZEC 4CAYA 5AV9B 3AZID 3AZGA 1ZLAC 1P3LD 3AZMA 1EQZA 2YFVA 5DNMB 3REIC 1P3FD 5B1LB 3AZLD 3AN2D 3LZ0B 5AV9C 1ID3B 5BNVA 3LJAB 3REKA 2HUEB 3NQUA 3WTPA 3LZ0C 4ZUXD 1ID3C 4Z5TC 2NZDA 1P3OB 3X1VD 5B0YC 3LJAC 3WKJB 2HUEC 3AZJC 3REJA 5B2JB 1M19B 3AZED 3WKJC 1R4VA 2CV5B 5JA4B 5AV8B 3AYWC 1N1JA 3MVDA 4WV4B 4R8PB 3B0CT 3REID 1M19C 4WU8B 1P3KB 3KWQB 4X23B 2F8NK 1M18D 3X1SA 4R8PC 5FUGB 3VH6W 4LD9A 1KX5D 5B2IA 3LZ0D 3B6FD 4YM6A 4Z5TD 4X23C 3B6GA 5BO0A 3MGSB 5B0YD 3AZJD 4XUJD 5F99A 3V9RA 5B0ZC 5GT0B 4H9RA 3MGSC 2YFWB 3AYWD 4J8VA 1P3BD 3X1UB 3WAAC 4EO5B 3MNNA 5B1MD 1HQ3D 5GT0C 3A6NC 1ULYA 3C1CB 1TZYB 3X1TB 1P34A 3X1UC 3AV1D 3W98D 4NFTA 4EO5C 3W99B 5B32C 5KDMB 3UTAB 5B40A 5DNMA 5B1LA 4WNNA 4J8XA 3C1CC 1P3AB 1TZYC 3X1TC 1KU5A 5GSUB 5B33D 3W99C 4G92C 3WA9B 3UTAC 3AFAB 5BS7C 3RELB 5GT3A 4E44A 3TU4B 5B0ZD 5GSUC 3W96C 3AZHB 3AFAC 5B31B 3RELC 3KUYA 3WAAD 1AOIA 4H9NB 5B2JA 3A6ND 4UUZB 3AZHC 5B31C 2CV5A 5AV8A 5B32D 5B24D 1U35A 5BNXB 1P3KA 3B0CW 5AVBB 1P3MA 5CP6B 3AZNB 4ZBJC 3AV2B 1F66C 5CP6C 5B32G 3W96D 2CWEA 1F1EA 3AZIB 2BYKB 4XZQA 5C3IB 3AZGC 5AV5A 1P3LB 2PYOD 1P3FB 5G49A 3MGPC 3LELD 3AZLB 3AN2B 3AZIC 4Z66A 4G91B 1KX4A 1KX3A 2YFWA 3AN2C 2AROA 3REKC 3AZFC 5AY8A 1TAFB 4ZUXB 3REHD 2FJ7C 4KGCC 4KUDA 2NZDC 3X1VB 5CPKC 2F8NA 5CPIA 5E5AD 1F66D 4ZUXC 1Q9CA 4NE6A 3AZEB 2IO5B 3WA9A 3UTBA 3LZ1A 3AZGD 3REIB 3MGPD 3AZMD 3TU4A 2IO5C 2HIOA 1M18B 1P3IA 1P3GA 2F8NH 3AZFD 3REKD 1KX5B 3B6FB 4LD9C 2FJ7D 4Z5TB 4H9OA 3WTPD 4YS3A 4KGCD 2NZDD 1BH9A 5CPKD 1M1AA 1M18C 5B0YB 4H9PA 3AZJB 4H9SA 1KX5C 4XUJB 3B6FC 3REJD 5F99C 5AVBA 4WU9A 3W97A 3C1BA 3AYWB 4XUJC 1P3BB 3AZNA 5B1MB 1HQ3B 3MNNC 3MVDD 4QLCA 5GXQA 1P3BC 3W98B 3AV1B 5B1MC 1HQ3C 3X1SD 3UT9C 5JRGA 3MGRA 4LD9D 5B2ID 3AZKA 3W98C 3AV1C 1P3PA 5B33B 1A7WA 4H9QB 4J8UA 5AV6A 5AVCA 5CPJA 1S32A 5F99D 5B0ZB 5B33C 4JJNA 4J8WA 3WAAB 4J8VD 3KUYC 3MNND 3A6NB 2NQBC 5B32B 1P34D 5B24B 1ZLAA 3UT9D 3R45B 5B40D 5AV9A 4J8XD 3B0DB 4G92B 4KHAB 5B24C 2L5AA 5GT3D 3LZ0A 1ID3A 3B0DC 3W96B 4CSRB 3LJAA 2PYOB 3KUYD 4XZQC 1P3OA 3LELB 1AOID 3O62C 3WKJA 3WTPE 3VH5A 1KX4C 5DNNB 2NQBD 2PYOC 3LELC 1M19A 3REHB 3KXBC 1U35D 4KUDC
chains in the Genus database with same CATH superfamily
5JA4A 2UWXA 5DNNC 2LY8A 1P3MD 5E5AB 4ZBJB 4R8PA 1F66B 4WU8A 3REHC 3KWQA 4X23A 1WWIA 5E5AC 4CAYB 5FUGA 3KFUG 3EG5B 3MGQC 3UTBC 2BYMB 3AZGB 4XZQD 3MGPB 5AV5D 3AZMB 2YFVB 4WZSB 3O62D 3MGSA 2RVQD 3VH5T 2Y2JA 4Z66D 1KX4D 3AL0C 1H3OB 5BNVB 3AZMC 1EQZC 5GT0A 3REKB 3AZFB 2FJ7B 3KXBD 3NQUB 3WTPB 2AROD 4KGCB 4KUDD 5AY8D 2NZDB 4WJ3C 5CPKB 5DNND 2DF4C 3X1UA 1M1AC 2F8ND 3R45A 3WTPC 3REJB 3EPHA 3C1CA 1TZYA 3X1TA 3W99A 4KHAA 5KDMA 3UTAA 5BS7A 1B67A 3MGQD 3REJC 3UTBD 3LZ1D 1N1JB 1P3AA 3MVDB 5GSUA 2F8NG 3W96A 3AFAA 4DRAA 3RELA 2HIOD 2ZY5A 3X1SB 3MVDC 1EQZD 1P3GD 1P3ID 4LD9B 5JRGC 5B2IB 3AZHA 5B31A 4YS3D 3B6GB 5BO0B 1M1AD 3X1SC 4UPKA 4H9NA 4J8UC 5AV6C 4UUZA 5B2IC 5AVCC 5F99B 4YM6C 3V9RB 3B6GC 4H9RB 4E45A 4WU9D 3C1BD 3W97D 4J8WC 4J8VB 5BNXA 3MNNB 5CP6A 4Z2MH 4QLCD 5GXQD 3EPJA 3AV2A 4J8VC 1P34B 2BYMA 3UT9B 3MGPA 5B40B 5JRGD 3AZIA 3MGRD 4WNNB 4J8XB 2BYKA 3AZKD 1P34C 1P3PD 1P3LA 1BH8B 1H3OA 3VH5W 1P3FA 5B40C 4J8UD 5GT3B 5DNMC 5AV6D 3AZFA 5B1LC 5AVCD 3AZLA 4J8XC 4YM6D 3AN2A 5CPJD 2FJ7A 3B6GD 4KGCA 1S32D 5CPKA 4JJND 4J8WD 5GT3C 1TAFA 4ZUXA 3KUYB 3EPKA 1AOIB 3X1VA 1P3OC 4AWLB 1W2EA 2NQBB 2ZM5A 1AOIC 1ZLAD 5B2JC 3AZEA 1U35B 4AWLC 1P3MB 5AV9D 2CV5C 5AV8C 3REIA 5DNMD 1U35C 5B1LD 4WU8C 1P3KC 3KWQC 1P3MC 1ID3D 1M18A 1WWSA 1T3UA 3LJAD 1KX5A 3B6FA 4Z5TA 4XZQB 3B0BA 5AV5B 3O62B 5G49B 1P3OD 5B0YA 3AZJA 4Z66B 3WKJD 2Y2LA 4XUJA 1KX4B 2ZY3A 1KX3B 5AV5C 5B2JD 3KXBB 2RVQC 2AROB 4KUDB 5AY8B 1M19D 4Z66C 3AYWA 1P3BA 1KX3C 2Y2QA 2CV5D 2F8NB 5AV8D 5B1MA 1HQ3A 1B6WA 3UT9A 5CPIB 4R8PD 2AROC 5AY8C 4WU8D 1P3KD 3KWQD 2F2AC 3NQJB 1HTAA 3AV1A 4X23D 3W98A 1BFMA 3P5JB 1JFIB 1BH8A 5CPIC 3MGQB 3UTBB 3LZ1B 1P3AC 5B33A 2Y2HA 5BT1C 3MGSD 4H9QA 3WA9C 2HIOB 2XD5A 3LZ1C 1EQZB 5B0ZA 1P3GB 2JCHA 1P3IB 3TU4C 5GT0D 5CHLB 3KSYA 4H9OB 4YS3B 2HIOC 1BH9B 1KX3D 1M1AB 2NQBA 3WAAA 4H9PB 3VH6A 3X1UD 1P3GC 1P3IC 3A6NA 4YS3C 3C1CD 1TZYD 3C1BB 5B32A 3X1TD 4WU9B 3W97B 5B24A 3W99D 5CPID 4H9SC 4M6BA 3UTAD 2Y2NA 1P3AD 5AVBC 4WU9C 3C1BC 3W97C 5BT1D 5GSUD 5GXQB 4QLCB 3WA9D 3AFAD 3RELD 4DRBA 3AZNC 3AV2C 3A1IA 4CSRA 5JRGB 3O62A 4QLCC 5GXQC 3MGRB 3TU4D 3AZHD 5B31D 3AZKB 1P3PB 3VH6T 2PYOA 5C3IC 3LELA 1P3LC 4J8UB 3A1KA 5AV6B 1P3FC 5AVCB 3MGRC 4NE3A 4NE5A 4YM6B 3KXBA 2J8PA 3AZLC 5CPJB 3AZKC 1S32B 1P3PC 4G91C 5DNNA 4Z2MG 4JJNB 4J8WB 2JSSA 1Z2CB 3REHA 4HGAB 5CPJC 5B31G 1S32C 5AVBD 3NQJA 5CP6D 3X1VC 4JJNC 2BG1A 5E5AA 1JFIA 1F66A 3AZND 4HGAC 3MGQA 2Y2IA 3AV2D 2G5IC 1ZLAB 3AZEC 4CAYA 5AV9B 3AZID 3AZGA 1ZLAC 3F6TA 3AZMA 1P3LD 2YFVA 5DNMB 3REIC 1P3FD 5B1LB 1EQZA 3AZLD 3AN2D 3LZ0B 5AV9C 2DQNC 1ID3B 5BNVA 3LJAB 3REKA 2HUEB 2Y2PA 3NQUA 3WTPA 3LZ0C 4ZUXD 1ID3C 4Z5TC 2NZDA 1P3OB 3X1VD 5B0YC 3LJAC 3WKJB 2HUEC 3AZJC 3REJA 5B2JB 1M19B 3AZED 3WKJC 1R4VA 2CV5B 5JA4B 5AV8B 3AYWC 1N1JA 3MVDA 4WV4B 4R8PB 3B0CT 3REID 1M19C 4WU8B 1P3KB 3KWQB 4X23B 2F8NK 1M18D 3X1SA 4R8PC 5FUGB 3VH6W 4LD9A 1KX5D 5B2IA 3LZ0D 3B6FD 4YM6A 4Z5TD 4X23C 3B6GA 5BO0A 3MGSB 2ZY2A 5B0YD 3AZJD 3H0MC 4XUJD 5F99A 3V9RA 5B0ZC 5GT0B 4H9RA 3MGSC 2YFWB 3AYWD 4J8VA 1P3BD 3X1UB 3WAAC 4EO5B 3MNNA 5B1MD 1HQ3D 5GT0C 3A6NC 1ULYA 3C1CB 1TZYB 3X1TB 1P34A 3X1UC 3AV1D 3W98D 4NFTA 4EO5C 3W99B 5B32C 5KDMB 3UTAB 5B40A 5DNMA 5B1LA 4WNNA 4J8XA 3C1CC 1P3AB 1TZYC 3X1TC 1KU5A 5GSUB 5B33D 3W99C 4G92C 3WA9B 3UTAC 3AFAB 5BS7C 3RELB 5GT3A 4E44A 3TU4B 5B0ZD 5GSUC 3W96C 3AZHB 3AFAC 5B31B 3RELC 2FFFB 3KUYA 3WAAD 1AOIA 4H9NB 5B2JA 4DQYB 3A6ND 4UUZB 2Y2KA 5B31C 3AZHC 2Y2MA 2CV5A 5AV8A 5B32D 5B24D 1U35A 5BNXB 1P3KA 3B0CW 5AVBB 1P3MA 5CP6B 3AZNB 2RIQA 4ZBJC 3AV2B 2Y2OA 1F66C 5CP6C 5B32G 3W96D 2CWEA 1F1EA 3AZIB 2BYKB 4XZQA 5C3IB 3AZGC 5AV5A 1P3LB 2PYOD 1P3FB 5G49A 3MGPC 3LELD 3AZLB 3AN2B 3AZIC 4Z66A 4G91B 1KX4A 1KX3A 2YFWA 3H0RC 3AN2C 2AROA 3REKC 3AZFC 5AY8A 1TAFB 4ZUXB 3REHD 2FJ7C 4KGCC 4KUDA 2NZDC 3X1VB 5CPKC 2F8NA 2JE5A 5CPIA 5E5AD 1F66D 4ZUXC 1Q9CA 4NE6A 3AZEB 2IO5B 3WA9A 3UTBA 3LZ1A 3AZGD 3REIB 3MGPD 3AZMD 3TU4A 2IO5C 2HIOA 1M18B 1P3IA 1P3GA 2F8NH 3AZFD 3REKD 1KX5B 3B6FB 4LD9C 2FJ7D 4Z5TB 4H9OA 3WTPD 4YS3A 4KGCD 2NZDD 1BH9A 5CPKD 1M1AA 1M18C 5B0YB 4H9PA 3AZJB 4H9SA 1KX5C 4XUJB 3B6FC 3REJD 5F99C 5AVBA 4WU9A 3W97A 3C1BA 2VQRA 3AYWB 4XUJC 1P3BB 3AZNA 5B1MB 1HQ3B 3MNNC 3MVDD 4QLCA 2Y2GA 5GXQA 1P3BC 3W98B 3AV1B 5B1MC 1HQ3C 2XD1A 3IP4C 3X1SD 3UT9C 5JRGA 3MGRA 4LD9D 5B2ID 3AZKA 3W98C 3FDDA 3AV1C 1P3PA 5B33B 1A7WA 4H9QB 4J8UA 5AV6A 5AVCA 2W8SA 5CPJA 1S32A 5F99D 5B0ZB 5B33C 4JJNA 4J8WA 3WAAB 4J8VD 3KUYC 3MNND 3A6NB 2NQBC 5B32B 1P34D 5B24B 1ZLAA 3UT9D 3EPLA 3R45B 2G5HC 3H0LC 5B40D 5AV9A 1PZRA 4J8XD 3B0DB 4G92B 4KHAB 5B24C 2L5AA 5GT3D 3LZ0A 1ID3A 3B0DC 3W96B 4CSRB 3LJAA 2PYOB 2ZY4A 3KUYD 4XZQC 1P3OA 3LELB 1AOID 3O62C 3WKJA 3WTPE 3VH5A 1KX4C 5DNNB 2NQBD 2PYOC 3LELC 1M19A 3REHB 3KXBC 1U35D 4KUDC
chains in the Genus database with same CATH topology
5JA4A 2UWXA 5DNNC 2LY8A 1P3MD 5E5AB 4ZBJB 4R8PA 1F66B 4WU8A 3REHC 3KWQA 4X23A 1WWIA 5E5AC 4CAYB 5FUGA 3KFUG 3EG5B 3MGQC 3UTBC 2BYMB 3AZGB 4XZQD 3MGPB 5AV5D 3AZMB 2YFVB 4WZSB 3O62D 3MGSA 2RVQD 3VH5T 2Y2JA 4Z66D 1KX4D 3AL0C 1H3OB 5BNVB 3AZMC 1EQZC 5GT0A 3REKB 3AZFB 2FJ7B 3KXBD 3NQUB 3WTPB 2AROD 4KGCB 4KUDD 5AY8D 2NZDB 4WJ3C 5CPKB 5DNND 2DF4C 3X1UA 1M1AC 2F8ND 3R45A 3WTPC 3REJB 3EPHA 3C1CA 1TZYA 3X1TA 3W99A 4KHAA 5KDMA 3UTAA 5BS7A 1B67A 3MGQD 3REJC 3UTBD 3LZ1D 1N1JB 1P3AA 3MVDB 5GSUA 2F8NG 3W96A 3AFAA 4DRAA 3RELA 2HIOD 2ZY5A 3X1SB 3MVDC 1EQZD 1P3GD 1P3ID 4LD9B 5JRGC 5B2IB 3AZHA 5B31A 4YS3D 3B6GB 5BO0B 1M1AD 3X1SC 4UPKA 4H9NA 4J8UC 5AV6C 4UUZA 5B2IC 5AVCC 5F99B 4YM6C 3V9RB 3B6GC 4H9RB 4E45A 4WU9D 3C1BD 3W97D 4J8WC 4J8VB 5BNXA 3MNNB 5CP6A 4Z2MH 4QLCD 5GXQD 3EPJA 3AV2A 4J8VC 1P34B 2BYMA 3UT9B 3MGPA 5B40B 5JRGD 3AZIA 3MGRD 4WNNB 4J8XB 2BYKA 3AZKD 1P34C 1P3PD 1P3LA 1BH8B 1H3OA 3VH5W 1P3FA 5B40C 4J8UD 5GT3B 5DNMC 5AV6D 3AZFA 5B1LC 5AVCD 3AZLA 4J8XC 4YM6D 3AN2A 5CPJD 2FJ7A 3B6GD 4KGCA 1S32D 5CPKA 4JJND 4J8WD 5GT3C 1TAFA 4ZUXA 3KUYB 3EPKA 1AOIB 3X1VA 1P3OC 4AWLB 1W2EA 2NQBB 2ZM5A 1AOIC 1ZLAD 5B2JC 3AZEA 1U35B 4AWLC 1P3MB 5AV9D 2CV5C 5AV8C 3REIA 5DNMD 1U35C 5B1LD 4WU8C 1P3KC 3KWQC 1P3MC 1ID3D 1M18A 1WWSA 1T3UA 3LJAD 1KX5A 3B6FA 4Z5TA 4XZQB 3B0BA 5AV5B 3O62B 5G49B 1P3OD 5B0YA 3AZJA 4Z66B 3WKJD 2Y2LA 4XUJA 1KX4B 2ZY3A 1KX3B 5AV5C 5B2JD 3KXBB 2RVQC 2AROB 4KUDB 5AY8B 1M19D 4Z66C 3AYWA 1P3BA 1KX3C 2Y2QA 2CV5D 2F8NB 5AV8D 5B1MA 1HQ3A 1B6WA 3UT9A 5CPIB 4R8PD 2AROC 5AY8C 4WU8D 1P3KD 3KWQD 2F2AC 3NQJB 1HTAA 3AV1A 4X23D 3W98A 1BFMA 3P5JB 1JFIB 1BH8A 5CPIC 3MGQB 3UTBB 3LZ1B 1P3AC 5B33A 2Y2HA 5BT1C 3MGSD 4H9QA 3WA9C 2HIOB 2XD5A 3LZ1C 1EQZB 5B0ZA 1P3GB 2JCHA 1P3IB 3TU4C 5GT0D 5CHLB 3KSYA 4H9OB 4YS3B 2HIOC 1BH9B 1KX3D 1M1AB 2NQBA 3WAAA 4H9PB 3VH6A 3X1UD 1P3GC 1P3IC 3A6NA 4YS3C 3C1CD 1TZYD 3C1BB 5B32A 3X1TD 4WU9B 3W97B 5B24A 3W99D 5CPID 4H9SC 4M6BA 3UTAD 2Y2NA 1P3AD 5AVBC 4WU9C 3C1BC 3W97C 5BT1D 5GSUD 5GXQB 4QLCB 3WA9D 3AFAD 3RELD 4DRBA 3AZNC 3AV2C 3A1IA 4CSRA 5JRGB 3O62A 4QLCC 5GXQC 3MGRB 3TU4D 3AZHD 5B31D 3AZKB 1P3PB 3VH6T 2PYOA 5C3IC 3LELA 1P3LC 4J8UB 3A1KA 5AV6B 1P3FC 5AVCB 3MGRC 4NE3A 4NE5A 4YM6B 3KXBA 2J8PA 3AZLC 5CPJB 3AZKC 1S32B 1P3PC 4G91C 5DNNA 4Z2MG 4JJNB 4J8WB 2JSSA 1Z2CB 3REHA 4HGAB 5CPJC 5B31G 1S32C 5AVBD 3NQJA 5CP6D 3X1VC 4JJNC 2BG1A 5E5AA 1JFIA 1F66A 3AZND 4HGAC 3MGQA 2Y2IA 3AV2D 2G5IC 1ZLAB 3AZEC 4CAYA 5AV9B 3AZID 3AZGA 1ZLAC 3F6TA 3AZMA 1P3LD 2YFVA 5DNMB 3REIC 1P3FD 5B1LB 1EQZA 3AZLD 3AN2D 3LZ0B 5AV9C 2DQNC 1ID3B 5BNVA 3LJAB 3REKA 2HUEB 2Y2PA 3NQUA 3WTPA 3LZ0C 4ZUXD 1ID3C 4Z5TC 2NZDA 1P3OB 3X1VD 5B0YC 3LJAC 3WKJB 2HUEC 3AZJC 3REJA 5B2JB 1M19B 3AZED 3WKJC 1R4VA 2CV5B 5JA4B 5AV8B 3AYWC 1N1JA 3MVDA 4WV4B 4R8PB 3B0CT 3REID 1M19C 4WU8B 1P3KB 3KWQB 4X23B 2F8NK 1M18D 3X1SA 4R8PC 5FUGB 3VH6W 4LD9A 1KX5D 5B2IA 3LZ0D 3B6FD 4YM6A 4Z5TD 4X23C 3B6GA 5BO0A 3MGSB 2ZY2A 5B0YD 3AZJD 3H0MC 4XUJD 5F99A 3V9RA 5B0ZC 5GT0B 4H9RA 3MGSC 2YFWB 3AYWD 4J8VA 1P3BD 3X1UB 3WAAC 4EO5B 3MNNA 5B1MD 1HQ3D 5GT0C 3A6NC 1ULYA 3C1CB 1TZYB 3X1TB 1P34A 3X1UC 3AV1D 3W98D 4NFTA 4EO5C 3W99B 5B32C 5KDMB 3UTAB 5B40A 5DNMA 5B1LA 4WNNA 4J8XA 3C1CC 1P3AB 1TZYC 3X1TC 1KU5A 5GSUB 5B33D 3W99C 4G92C 3WA9B 3UTAC 3AFAB 5BS7C 3RELB 5GT3A 4E44A 3TU4B 5B0ZD 5GSUC 3W96C 3AZHB 3AFAC 5B31B 3RELC 2FFFB 3KUYA 3WAAD 1AOIA 4H9NB 5B2JA 4DQYB 3A6ND 4UUZB 2Y2KA 5B31C 3AZHC 2Y2MA 2CV5A 5AV8A 5B32D 5B24D 1U35A 5BNXB 1P3KA 3B0CW 5AVBB 1P3MA 5CP6B 3AZNB 2RIQA 4ZBJC 3AV2B 2Y2OA 1F66C 5CP6C 5B32G 3W96D 2CWEA 1F1EA 3AZIB 2BYKB 4XZQA 5C3IB 3AZGC 5AV5A 1P3LB 2PYOD 1P3FB 5G49A 3MGPC 3LELD 3AZLB 3AN2B 3AZIC 4Z66A 4G91B 1KX4A 1KX3A 2YFWA 3H0RC 3AN2C 2AROA 3REKC 3AZFC 5AY8A 1TAFB 4ZUXB 3REHD 2FJ7C 4KGCC 4KUDA 2NZDC 3X1VB 5CPKC 2F8NA 2JE5A 5CPIA 5E5AD 1F66D 4ZUXC 1Q9CA 4NE6A 3AZEB 2IO5B 3WA9A 3UTBA 3LZ1A 3AZGD 3REIB 3MGPD 3AZMD 3TU4A 2IO5C 2HIOA 1M18B 1P3IA 1P3GA 2F8NH 3AZFD 3REKD 1KX5B 3B6FB 4LD9C 2FJ7D 4Z5TB 4H9OA 3WTPD 4YS3A 4KGCD 2NZDD 1BH9A 5CPKD 1M1AA 1M18C 5B0YB 4H9PA 3AZJB 4H9SA 1KX5C 4XUJB 3B6FC 3REJD 5F99C 5AVBA 4WU9A 3W97A 3C1BA 2VQRA 3AYWB 4XUJC 1P3BB 3AZNA 5B1MB 1HQ3B 3MNNC 3MVDD 4QLCA 2Y2GA 5GXQA 1P3BC 3W98B 3AV1B 5B1MC 1HQ3C 2XD1A 3IP4C 3X1SD 3UT9C 5JRGA 3MGRA 4LD9D 5B2ID 3AZKA 3W98C 3FDDA 3AV1C 1P3PA 5B33B 1A7WA 4H9QB 4J8UA 5AV6A 5AVCA 2W8SA 5CPJA 1S32A 5F99D 5B0ZB 5B33C 4JJNA 4J8WA 3WAAB 4J8VD 3KUYC 3MNND 3A6NB 2NQBC 5B32B 1P34D 5B24B 1ZLAA 3UT9D 3EPLA 3R45B 2G5HC 3H0LC 5B40D 5AV9A 1PZRA 4J8XD 3B0DB 4G92B 4KHAB 5B24C 2L5AA 5GT3D 3LZ0A 1ID3A 3B0DC 3W96B 4CSRB 3LJAA 2PYOB 2ZY4A 3KUYD 4XZQC 1P3OA 3LELB 1AOID 3O62C 3WKJA 3WTPE 3VH5A 1KX4C 5DNNB 2NQBD 2PYOC 3LELC 1M19A 3REHB 3KXBC 1U35D 4KUDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 A;  1P3M D;  5DNN C;  2LY8 A;  5E5A B;  4ZBJ B;  4R8P A;  1F66 B;  4WU8 A;  3REH C;  3KWQ A;  4X23 A;  1WWI A;  5E5A C;  4CAY B;  5FUG A;  3MGQ C;  3UTB C;  2BYM B;  3AZG B;  4XZQ D;  3MGP B;  5AV5 D;  3AZM B;  2YFV B;  4WZS B;  3O62 D;  3MGS A;  2RVQ D;  3VH5 T;  4Z66 D;  1KX4 D;  1H3O B;  5BNV B;  3AZM C;  1EQZ C;  5GT0 A;  3REK B;  3AZF B;  2FJ7 B;  3KXB D;  3NQU B;  3WTP B;  2ARO D;  4KGC B;  4KUD D;  5AY8 D;  2NZD B;  5CPK B;  5DNN D;  3X1U A;  1M1A C;  2F8N D;  3R45 A;  3WTP C;  3REJ B;  3C1C A;  1TZY A;  3X1T A;  3W99 A;  4KHA A;  5KDM A;  3UTA A;  5BS7 A;  1B67 A;  3MGQ D;  3REJ C;  3UTB D;  3LZ1 D;  1N1J B;  1P3A A;  3MVD B;  5GSU A;  2F8N G;  3W96 A;  3AFA A;  4DRA A;  3REL A;  2HIO D;  3X1S B;  3MVD C;  1EQZ D;  1P3G D;  1P3I D;  4LD9 B;  5JRG C;  5B2I B;  3AZH A;  5B31 A;  4YS3 D;  3B6G B;  5BO0 B;  1M1A D;  3X1S C;  4H9N A;  4J8U C;  5AV6 C;  4UUZ A;  5B2I C;  5F99 B;  5AVC C;  4YM6 C;  3V9R B;  3B6G C;  4H9R B;  4E45 A;  4WU9 D;  3C1B D;  3W97 D;  4J8W C;  4J8V B;  5BNX A;  3MNN B;  5CP6 A;  4Z2M H;  4QLC D;  5GXQ D;  3AV2 A;  4J8V C;  1P34 B;  2BYM A;  3UT9 B;  3MGP A;  5B40 B;  5JRG D;  3AZI A;  3MGR D;  4WNN B;  4J8X B;  2BYK A;  3AZK D;  1P34 C;  1P3P D;  1P3L A;  1BH8 B;  1H3O A;  3VH5 W;  1P3F A;  5B40 C;  4J8U D;  5GT3 B;  5DNM C;  5AV6 D;  3AZF A;  5B1L C;  5AVC D;  3AZL A;  4J8X C;  4YM6 D;  3AN2 A;  5CPJ D;  2FJ7 A;  3B6G D;  4KGC A;  1S32 D;  5CPK A;  4JJN D;  4J8W D;  5GT3 C;  1TAF A;  4ZUX A;  3KUY B;  1AOI B;  3X1V A;  1P3O C;  4AWL B;  2NQB B;  1AOI C;  1ZLA D;  5B2J C;  3AZE A;  1U35 B;  4AWL C;  1P3M B;  5AV9 D;  2CV5 C;  5AV8 C;  3REI A;  5DNM D;  1U35 C;  5B1L D;  4WU8 C;  1P3K C;  3KWQ C;  1P3M C;  1ID3 D;  1M18 A;  1WWS A;  3LJA D;  1KX5 A;  3B6F A;  4Z5T A;  4XZQ B;  3B0B A;  5AV5 B;  3O62 B;  5G49 B;  1P3O D;  5B0Y A;  3AZJ A;  4Z66 B;  3WKJ D;  4XUJ A;  1KX4 B;  1KX3 B;  5AV5 C;  5B2J D;  3KXB B;  2RVQ C;  2ARO B;  4KUD B;  5AY8 B;  1M19 D;  4Z66 C;  3AYW A;  1P3B A;  1KX3 C;  2CV5 D;  2F8N B;  5AV8 D;  5B1M A;  1HQ3 A;  1B6W A;  3UT9 A;  5CPI B;  4R8P D;  2ARO C;  5AY8 C;  4WU8 D;  1P3K D;  3KWQ D;  3NQJ B;  3W98 A;  1HTA A;  3AV1 A;  4X23 D;  1BFM A;  1JFI B;  1BH8 A;  5CPI C;  3MGQ B;  3UTB B;  3LZ1 B;  1P3A C;  5B33 A;  5BT1 C;  3MGS D;  4H9Q A;  3WA9 C;  2HIO B;  3LZ1 C;  1EQZ B;  5B0Z A;  1P3G B;  1P3I B;  3TU4 C;  5GT0 D;  5CHL B;  3KSY A;  4H9O B;  4YS3 B;  2HIO C;  1BH9 B;  1KX3 D;  1M1A B;  2NQB A;  3WAA A;  4H9P B;  3VH6 A;  3X1U D;  1P3G C;  1P3I C;  3A6N A;  4YS3 C;  3C1C D;  1TZY D;  3C1B B;  3X1T D;  5B32 A;  4WU9 B;  3W97 B;  5B24 A;  3W99 D;  5CPI D;  4H9S C;  4M6B A;  3UTA D;  1P3A D;  5AVB C;  4WU9 C;  3C1B C;  3W97 C;  5BT1 D;  5GSU D;  5GXQ B;  4QLC B;  3WA9 D;  3AFA D;  3REL D;  4DRB A;  3AZN C;  3AV2 C;  4CSR A;  5JRG B;  3O62 A;  4QLC C;  5GXQ C;  3MGR B;  3TU4 D;  3AZH D;  5B31 D;  3AZK B;  1P3P B;  3VH6 T;  2PYO A;  5C3I C;  3LEL A;  1P3L C;  4J8U B;  5AV6 B;  1P3F C;  5AVC B;  3MGR C;  4NE3 A;  4NE5 A;  4YM6 B;  3KXB A;  3AZL C;  5CPJ B;  1S32 B;  3AZK C;  1P3P C;  4G91 C;  5DNN A;  4Z2M G;  4JJN B;  4J8W B;  2JSS A;  3REH A;  4HGA B;  5CPJ C;  5B31 G;  1S32 C;  5AVB D;  3NQJ A;  5CP6 D;  3X1V C;  4JJN C;  5E5A A;  1JFI A;  1F66 A;  3AZN D;  4HGA C;  3MGQ A;  3AV2 D;  1ZLA B;  3AZE C;  4CAY A;  5AV9 B;  3AZI D;  3AZG A;  1ZLA C;  1P3L D;  3AZM A;  1EQZ A;  2YFV A;  5DNM B;  3REI C;  1P3F D;  5B1L B;  3AZL D;  3AN2 D;  3LZ0 B;  5AV9 C;  1ID3 B;  5BNV A;  3LJA B;  3REK A;  2HUE B;  3NQU A;  3WTP A;  3LZ0 C;  4ZUX D;  1ID3 C;  4Z5T C;  2NZD A;  1P3O B;  3X1V D;  5B0Y C;  3LJA C;  3WKJ B;  2HUE C;  3AZJ C;  3REJ A;  5B2J B;  1M19 B;  3AZE D;  3WKJ C;  1R4V A;  2CV5 B;  5JA4 B;  5AV8 B;  3AYW C;  1N1J A;  3MVD A;  4WV4 B;  4R8P B;  3B0C T;  3REI D;  1M19 C;  4WU8 B;  1P3K B;  3KWQ B;  4X23 B;  2F8N K;  1M18 D;  3X1S A;  4R8P C;  5FUG B;  3VH6 W;  4LD9 A;  1KX5 D;  5B2I A;  3LZ0 D;  3B6F D;  4YM6 A;  4Z5T D;  4X23 C;  3B6G A;  5BO0 A;  3MGS B;  5B0Y D;  3AZJ D;  4XUJ D;  5F99 A;  3V9R A;  5B0Z C;  5GT0 B;  4H9R A;  3MGS C;  2YFW B;  3AYW D;  4J8V A;  1P3B D;  3X1U B;  3WAA C;  4EO5 B;  3MNN A;  5B1M D;  1HQ3 D;  5GT0 C;  3A6N C;  1ULY A;  3C1C B;  1TZY B;  3X1T B;  1P34 A;  3X1U C;  3AV1 D;  3W98 D;  4NFT A;  4EO5 C;  3W99 B;  5B32 C;  5KDM B;  3UTA B;  5B40 A;  5DNM A;  5B1L A;  4WNN A;  4J8X A;  3C1C C;  1P3A B;  1TZY C;  3X1T C;  1KU5 A;  5GSU B;  5B33 D;  3W99 C;  4G92 C;  3WA9 B;  3UTA C;  3AFA B;  5BS7 C;  3REL B;  5GT3 A;  4E44 A;  3TU4 B;  5B0Z D;  5GSU C;  3W96 C;  3AZH B;  3AFA C;  5B31 B;  3REL C;  3KUY A;  3WAA D;  1AOI A;  4H9N B;  5B2J A;  3A6N D;  4UUZ B;  3AZH C;  5B31 C;  2CV5 A;  5AV8 A;  5B32 D;  5B24 D;  1U35 A;  5BNX B;  1P3K A;  3B0C W;  5AVB B;  1P3M A;  5CP6 B;  3AZN B;  4ZBJ C;  3AV2 B;  1F66 C;  5CP6 C;  5B32 G;  3W96 D;  2CWE A;  1F1E A;  3AZI B;  2BYK B;  4XZQ A;  5C3I B;  3AZG C;  5AV5 A;  1P3L B;  2PYO D;  1P3F B;  5G49 A;  3MGP C;  3LEL D;  3AZL B;  3AN2 B;  3AZI C;  4Z66 A;  4G91 B;  1KX4 A;  1KX3 A;  2YFW A;  3AN2 C;  2ARO A;  3REK C;  3AZF C;  5AY8 A;  1TAF B;  4ZUX B;  3REH D;  2FJ7 C;  4KGC C;  4KUD A;  2NZD C;  3X1V B;  5CPK C;  2F8N A;  5CPI A;  5E5A D;  1F66 D;  4ZUX C;  1Q9C A;  4NE6 A;  3AZE B;  2IO5 B;  3WA9 A;  3UTB A;  3LZ1 A;  3AZG D;  3REI B;  3MGP D;  3AZM D;  3TU4 A;  2IO5 C;  2HIO A;  1M18 B;  1P3I A;  1P3G A;  2F8N H;  3AZF D;  3REK D;  1KX5 B;  3B6F B;  4LD9 C;  2FJ7 D;  4Z5T B;  4H9O A;  3WTP D;  4YS3 A;  4KGC D;  2NZD D;  1BH9 A;  5CPK D;  1M1A A;  1M18 C;  5B0Y B;  4H9P A;  3AZJ B;  4H9S A;  1KX5 C;  4XUJ B;  3B6F C;  3REJ D;  5F99 C;  5AVB A;  4WU9 A;  3W97 A;  3C1B A;  3AYW B;  4XUJ C;  1P3B B;  3AZN A;  5B1M B;  1HQ3 B;  3MNN C;  3MVD D;  4QLC A;  5GXQ A;  1P3B C;  3W98 B;  3AV1 B;  5B1M C;  1HQ3 C;  3X1S D;  3UT9 C;  5JRG A;  3MGR A;  4LD9 D;  5B2I D;  3AZK A;  3W98 C;  3AV1 C;  1P3P A;  5B33 B;  1A7W A;  4H9Q B;  4J8U A;  5AV6 A;  5AVC A;  5CPJ A;  1S32 A;  5F99 D;  5B0Z B;  5B33 C;  4JJN A;  4J8W A;  3WAA B;  4J8V D;  3KUY C;  3MNN D;  3A6N B;  2NQB C;  5B32 B;  1P34 D;  5B24 B;  1ZLA A;  3UT9 D;  3R45 B;  5B40 D;  5AV9 A;  4J8X D;  3B0D B;  4G92 B;  4KHA B;  5B24 C;  2L5A A;  5GT3 D;  3LZ0 A;  1ID3 A;  3B0D C;  3W96 B;  4CSR B;  3LJA A;  2PYO B;  3KUY D;  4XZQ C;  1P3O A;  3LEL B;  1AOI D;  3O62 C;  3WKJ A;  3WTP E;  3VH5 A;  1KX4 C;  5DNN B;  2NQB D;  2PYO C;  3LEL C;  1M19 A;  3REH B;  3KXB C;  1U35 D;  4KUD C; 
#chains in the Genus database with same CATH topology
 5JA4 A;  2UWX A;  5DNN C;  2LY8 A;  1P3M D;  5E5A B;  4ZBJ B;  4R8P A;  1F66 B;  4WU8 A;  3REH C;  3KWQ A;  4X23 A;  1WWI A;  5E5A C;  4CAY B;  5FUG A;  3KFU G;  3EG5 B;  3MGQ C;  3UTB C;  2BYM B;  3AZG B;  4XZQ D;  3MGP B;  5AV5 D;  3AZM B;  2YFV B;  4WZS B;  3O62 D;  3MGS A;  2RVQ D;  3VH5 T;  2Y2J A;  4Z66 D;  1KX4 D;  3AL0 C;  1H3O B;  5BNV B;  3AZM C;  1EQZ C;  5GT0 A;  3REK B;  3AZF B;  2FJ7 B;  3KXB D;  3NQU B;  3WTP B;  2ARO D;  4KGC B;  4KUD D;  5AY8 D;  2NZD B;  4WJ3 C;  5CPK B;  5DNN D;  2DF4 C;  3X1U A;  1M1A C;  2F8N D;  3R45 A;  3WTP C;  3REJ B;  3EPH A;  3C1C A;  1TZY A;  3X1T A;  3W99 A;  4KHA A;  5KDM A;  3UTA A;  5BS7 A;  1B67 A;  3MGQ D;  3REJ C;  3UTB D;  3LZ1 D;  1N1J B;  1P3A A;  3MVD B;  5GSU A;  2F8N G;  3W96 A;  3AFA A;  4DRA A;  3REL A;  2HIO D;  2ZY5 A;  3X1S B;  3MVD C;  1EQZ D;  1P3G D;  1P3I D;  4LD9 B;  5JRG C;  5B2I B;  3AZH A;  5B31 A;  4YS3 D;  3B6G B;  5BO0 B;  1M1A D;  3X1S C;  4UPK A;  4H9N A;  4J8U C;  5AV6 C;  4UUZ A;  5B2I C;  5AVC C;  5F99 B;  4YM6 C;  3V9R B;  3B6G C;  4H9R B;  4E45 A;  4WU9 D;  3C1B D;  3W97 D;  4J8W C;  4J8V B;  5BNX A;  3MNN B;  5CP6 A;  4Z2M H;  4QLC D;  5GXQ D;  3EPJ A;  3AV2 A;  4J8V C;  1P34 B;  2BYM A;  3UT9 B;  3MGP A;  5B40 B;  5JRG D;  3AZI A;  3MGR D;  4WNN B;  4J8X B;  2BYK A;  3AZK D;  1P34 C;  1P3P D;  1P3L A;  1BH8 B;  1H3O A;  3VH5 W;  1P3F A;  5B40 C;  4J8U D;  5GT3 B;  5DNM C;  5AV6 D;  3AZF A;  5B1L C;  5AVC D;  3AZL A;  4J8X C;  4YM6 D;  3AN2 A;  5CPJ D;  2FJ7 A;  3B6G D;  4KGC A;  1S32 D;  5CPK A;  4JJN D;  4J8W D;  5GT3 C;  1TAF A;  4ZUX A;  3KUY B;  3EPK A;  1AOI B;  3X1V A;  1P3O C;  4AWL B;  1W2E A;  2NQB B;  2ZM5 A;  1AOI C;  1ZLA D;  5B2J C;  3AZE A;  1U35 B;  4AWL C;  1P3M B;  5AV9 D;  2CV5 C;  5AV8 C;  3REI A;  5DNM D;  1U35 C;  5B1L D;  4WU8 C;  1P3K C;  3KWQ C;  1P3M C;  1ID3 D;  1M18 A;  1WWS A;  1T3U A;  3LJA D;  1KX5 A;  3B6F A;  4Z5T A;  4XZQ B;  3B0B A;  5AV5 B;  3O62 B;  5G49 B;  1P3O D;  5B0Y A;  3AZJ A;  4Z66 B;  3WKJ D;  2Y2L A;  4XUJ A;  1KX4 B;  2ZY3 A;  1KX3 B;  5AV5 C;  5B2J D;  3KXB B;  2RVQ C;  2ARO B;  4KUD B;  5AY8 B;  1M19 D;  4Z66 C;  3AYW A;  1P3B A;  1KX3 C;  2Y2Q A;  2CV5 D;  2F8N B;  5AV8 D;  5B1M A;  1HQ3 A;  1B6W A;  3UT9 A;  5CPI B;  4R8P D;  2ARO C;  5AY8 C;  4WU8 D;  1P3K D;  3KWQ D;  2F2A C;  3NQJ B;  1HTA A;  3AV1 A;  4X23 D;  3W98 A;  1BFM A;  3P5J B;  1JFI B;  1BH8 A;  5CPI C;  3MGQ B;  3UTB B;  3LZ1 B;  1P3A C;  5B33 A;  2Y2H A;  5BT1 C;  3MGS D;  4H9Q A;  3WA9 C;  2HIO B;  2XD5 A;  3LZ1 C;  1EQZ B;  5B0Z A;  1P3G B;  2JCH A;  1P3I B;  3TU4 C;  5GT0 D;  5CHL B;  3KSY A;  4H9O B;  4YS3 B;  2HIO C;  1BH9 B;  1KX3 D;  1M1A B;  2NQB A;  3WAA A;  4H9P B;  3VH6 A;  3X1U D;  1P3G C;  1P3I C;  3A6N A;  4YS3 C;  3C1C D;  1TZY D;  3C1B B;  5B32 A;  3X1T D;  4WU9 B;  3W97 B;  5B24 A;  3W99 D;  5CPI D;  4H9S C;  4M6B A;  3UTA D;  2Y2N A;  1P3A D;  5AVB C;  4WU9 C;  3C1B C;  3W97 C;  5BT1 D;  5GSU D;  5GXQ B;  4QLC B;  3WA9 D;  3AFA D;  3REL D;  4DRB A;  3AZN C;  3AV2 C;  3A1I A;  4CSR A;  5JRG B;  3O62 A;  4QLC C;  5GXQ C;  3MGR B;  3TU4 D;  3AZH D;  5B31 D;  3AZK B;  1P3P B;  3VH6 T;  2PYO A;  5C3I C;  3LEL A;  1P3L C;  4J8U B;  3A1K A;  5AV6 B;  1P3F C;  5AVC B;  3MGR C;  4NE3 A;  4NE5 A;  4YM6 B;  3KXB A;  2J8P A;  3AZL C;  5CPJ B;  3AZK C;  1S32 B;  1P3P C;  4G91 C;  5DNN A;  4Z2M G;  4JJN B;  4J8W B;  2JSS A;  1Z2C B;  3REH A;  4HGA B;  5CPJ C;  5B31 G;  1S32 C;  5AVB D;  3NQJ A;  5CP6 D;  3X1V C;  4JJN C;  2BG1 A;  5E5A A;  1JFI A;  1F66 A;  3AZN D;  4HGA C;  3MGQ A;  2Y2I A;  3AV2 D;  2G5I C;  1ZLA B;  3AZE C;  4CAY A;  5AV9 B;  3AZI D;  3AZG A;  1ZLA C;  3F6T A;  3AZM A;  1P3L D;  2YFV A;  5DNM B;  3REI C;  1P3F D;  5B1L B;  1EQZ A;  3AZL D;  3AN2 D;  3LZ0 B;  5AV9 C;  2DQN C;  1ID3 B;  5BNV A;  3LJA B;  3REK A;  2HUE B;  2Y2P A;  3NQU A;  3WTP A;  3LZ0 C;  4ZUX D;  1ID3 C;  4Z5T C;  2NZD A;  1P3O B;  3X1V D;  5B0Y C;  3LJA C;  3WKJ B;  2HUE C;  3AZJ C;  3REJ A;  5B2J B;  1M19 B;  3AZE D;  3WKJ C;  1R4V A;  2CV5 B;  5JA4 B;  5AV8 B;  3AYW C;  1N1J A;  3MVD A;  4WV4 B;  4R8P B;  3B0C T;  3REI D;  1M19 C;  4WU8 B;  1P3K B;  3KWQ B;  4X23 B;  2F8N K;  1M18 D;  3X1S A;  4R8P C;  5FUG B;  3VH6 W;  4LD9 A;  1KX5 D;  5B2I A;  3LZ0 D;  3B6F D;  4YM6 A;  4Z5T D;  4X23 C;  3B6G A;  5BO0 A;  3MGS B;  2ZY2 A;  5B0Y D;  3AZJ D;  3H0M C;  4XUJ D;  5F99 A;  3V9R A;  5B0Z C;  5GT0 B;  4H9R A;  3MGS C;  2YFW B;  3AYW D;  4J8V A;  1P3B D;  3X1U B;  3WAA C;  4EO5 B;  3MNN A;  5B1M D;  1HQ3 D;  5GT0 C;  3A6N C;  1ULY A;  3C1C B;  1TZY B;  3X1T B;  1P34 A;  3X1U C;  3AV1 D;  3W98 D;  4NFT A;  4EO5 C;  3W99 B;  5B32 C;  5KDM B;  3UTA B;  5B40 A;  5DNM A;  5B1L A;  4WNN A;  4J8X A;  3C1C C;  1P3A B;  1TZY C;  3X1T C;  1KU5 A;  5GSU B;  5B33 D;  3W99 C;  4G92 C;  3WA9 B;  3UTA C;  3AFA B;  5BS7 C;  3REL B;  5GT3 A;  4E44 A;  3TU4 B;  5B0Z D;  5GSU C;  3W96 C;  3AZH B;  3AFA C;  5B31 B;  3REL C;  2FFF B;  3KUY A;  3WAA D;  1AOI A;  4H9N B;  5B2J A;  4DQY B;  3A6N D;  4UUZ B;  2Y2K A;  5B31 C;  3AZH C;  2Y2M A;  2CV5 A;  5AV8 A;  5B32 D;  5B24 D;  1U35 A;  5BNX B;  1P3K A;  3B0C W;  5AVB B;  1P3M A;  5CP6 B;  3AZN B;  2RIQ A;  4ZBJ C;  3AV2 B;  2Y2O A;  1F66 C;  5CP6 C;  5B32 G;  3W96 D;  2CWE A;  1F1E A;  3AZI B;  2BYK B;  4XZQ A;  5C3I B;  3AZG C;  5AV5 A;  1P3L B;  2PYO D;  1P3F B;  5G49 A;  3MGP C;  3LEL D;  3AZL B;  3AN2 B;  3AZI C;  4Z66 A;  4G91 B;  1KX4 A;  1KX3 A;  2YFW A;  3H0R C;  3AN2 C;  2ARO A;  3REK C;  3AZF C;  5AY8 A;  1TAF B;  4ZUX B;  3REH D;  2FJ7 C;  4KGC C;  4KUD A;  2NZD C;  3X1V B;  5CPK C;  2F8N A;  2JE5 A;  5CPI A;  5E5A D;  1F66 D;  4ZUX C;  1Q9C A;  4NE6 A;  3AZE B;  2IO5 B;  3WA9 A;  3UTB A;  3LZ1 A;  3AZG D;  3REI B;  3MGP D;  3AZM D;  3TU4 A;  2IO5 C;  2HIO A;  1M18 B;  1P3I A;  1P3G A;  2F8N H;  3AZF D;  3REK D;  1KX5 B;  3B6F B;  4LD9 C;  2FJ7 D;  4Z5T B;  4H9O A;  3WTP D;  4YS3 A;  4KGC D;  2NZD D;  1BH9 A;  5CPK D;  1M1A A;  1M18 C;  5B0Y B;  4H9P A;  3AZJ B;  4H9S A;  1KX5 C;  4XUJ B;  3B6F C;  3REJ D;  5F99 C;  5AVB A;  4WU9 A;  3W97 A;  3C1B A;  2VQR A;  3AYW B;  4XUJ C;  1P3B B;  3AZN A;  5B1M B;  1HQ3 B;  3MNN C;  3MVD D;  4QLC A;  2Y2G A;  5GXQ A;  1P3B C;  3W98 B;  3AV1 B;  5B1M C;  1HQ3 C;  2XD1 A;  3IP4 C;  3X1S D;  3UT9 C;  5JRG A;  3MGR A;  4LD9 D;  5B2I D;  3AZK A;  3W98 C;  3FDD A;  3AV1 C;  1P3P A;  5B33 B;  1A7W A;  4H9Q B;  4J8U A;  5AV6 A;  5AVC A;  2W8S A;  5CPJ A;  1S32 A;  5F99 D;  5B0Z B;  5B33 C;  4JJN A;  4J8W A;  3WAA B;  4J8V D;  3KUY C;  3MNN D;  3A6N B;  2NQB C;  5B32 B;  1P34 D;  5B24 B;  1ZLA A;  3UT9 D;  3EPL A;  3R45 B;  2G5H C;  3H0L C;  5B40 D;  5AV9 A;  1PZR A;  4J8X D;  3B0D B;  4G92 B;  4KHA B;  5B24 C;  2L5A A;  5GT3 D;  3LZ0 A;  1ID3 A;  3B0D C;  3W96 B;  4CSR B;  3LJA A;  2PYO B;  2ZY4 A;  3KUY D;  4XZQ C;  1P3O A;  3LEL B;  1AOI D;  3O62 C;  3WKJ A;  3WTP E;  3VH5 A;  1KX4 C;  5DNN B;  2NQB D;  2PYO C;  3LEL C;  1M19 A;  3REH B;  3KXB C;  1U35 D;  4KUD C; 
#chains in the Genus database with same CATH homology
 5JA4 A;  2UWX A;  5DNN C;  2LY8 A;  1P3M D;  5E5A B;  4ZBJ B;  4R8P A;  1F66 B;  4WU8 A;  3REH C;  3KWQ A;  4X23 A;  1WWI A;  5E5A C;  4CAY B;  5FUG A;  3KFU G;  3EG5 B;  3MGQ C;  3UTB C;  2BYM B;  3AZG B;  4XZQ D;  3MGP B;  5AV5 D;  3AZM B;  2YFV B;  4WZS B;  3O62 D;  3MGS A;  2RVQ D;  3VH5 T;  2Y2J A;  4Z66 D;  1KX4 D;  3AL0 C;  1H3O B;  5BNV B;  3AZM C;  1EQZ C;  5GT0 A;  3REK B;  3AZF B;  2FJ7 B;  3KXB D;  3NQU B;  3WTP B;  2ARO D;  4KGC B;  4KUD D;  5AY8 D;  2NZD B;  4WJ3 C;  5CPK B;  5DNN D;  2DF4 C;  3X1U A;  1M1A C;  2F8N D;  3R45 A;  3WTP C;  3REJ B;  3EPH A;  3C1C A;  1TZY A;  3X1T A;  3W99 A;  4KHA A;  5KDM A;  3UTA A;  5BS7 A;  1B67 A;  3MGQ D;  3REJ C;  3UTB D;  3LZ1 D;  1N1J B;  1P3A A;  3MVD B;  5GSU A;  2F8N G;  3W96 A;  3AFA A;  4DRA A;  3REL A;  2HIO D;  2ZY5 A;  3X1S B;  3MVD C;  1EQZ D;  1P3G D;  1P3I D;  4LD9 B;  5JRG C;  5B2I B;  3AZH A;  5B31 A;  4YS3 D;  3B6G B;  5BO0 B;  1M1A D;  3X1S C;  4UPK A;  4H9N A;  4J8U C;  5AV6 C;  4UUZ A;  5B2I C;  5AVC C;  5F99 B;  4YM6 C;  3V9R B;  3B6G C;  4H9R B;  4E45 A;  4WU9 D;  3C1B D;  3W97 D;  4J8W C;  4J8V B;  5BNX A;  3MNN B;  5CP6 A;  4Z2M H;  4QLC D;  5GXQ D;  3EPJ A;  3AV2 A;  4J8V C;  1P34 B;  2BYM A;  3UT9 B;  3MGP A;  5B40 B;  5JRG D;  3AZI A;  3MGR D;  4WNN B;  4J8X B;  2BYK A;  3AZK D;  1P34 C;  1P3P D;  1P3L A;  1BH8 B;  1H3O A;  3VH5 W;  1P3F A;  5B40 C;  4J8U D;  5GT3 B;  5DNM C;  5AV6 D;  3AZF A;  5B1L C;  5AVC D;  3AZL A;  4J8X C;  4YM6 D;  3AN2 A;  5CPJ D;  2FJ7 A;  3B6G D;  4KGC A;  1S32 D;  5CPK A;  4JJN D;  4J8W D;  5GT3 C;  1TAF A;  4ZUX A;  3KUY B;  3EPK A;  1AOI B;  3X1V A;  1P3O C;  4AWL B;  1W2E A;  2NQB B;  2ZM5 A;  1AOI C;  1ZLA D;  5B2J C;  3AZE A;  1U35 B;  4AWL C;  1P3M B;  5AV9 D;  2CV5 C;  5AV8 C;  3REI A;  5DNM D;  1U35 C;  5B1L D;  4WU8 C;  1P3K C;  3KWQ C;  1P3M C;  1ID3 D;  1M18 A;  1WWS A;  1T3U A;  3LJA D;  1KX5 A;  3B6F A;  4Z5T A;  4XZQ B;  3B0B A;  5AV5 B;  3O62 B;  5G49 B;  1P3O D;  5B0Y A;  3AZJ A;  4Z66 B;  3WKJ D;  2Y2L A;  4XUJ A;  1KX4 B;  2ZY3 A;  1KX3 B;  5AV5 C;  5B2J D;  3KXB B;  2RVQ C;  2ARO B;  4KUD B;  5AY8 B;  1M19 D;  4Z66 C;  3AYW A;  1P3B A;  1KX3 C;  2Y2Q A;  2CV5 D;  2F8N B;  5AV8 D;  5B1M A;  1HQ3 A;  1B6W A;  3UT9 A;  5CPI B;  4R8P D;  2ARO C;  5AY8 C;  4WU8 D;  1P3K D;  3KWQ D;  2F2A C;  3NQJ B;  1HTA A;  3AV1 A;  4X23 D;  3W98 A;  1BFM A;  3P5J B;  1JFI B;  1BH8 A;  5CPI C;  3MGQ B;  3UTB B;  3LZ1 B;  1P3A C;  5B33 A;  2Y2H A;  5BT1 C;  3MGS D;  4H9Q A;  3WA9 C;  2HIO B;  2XD5 A;  3LZ1 C;  1EQZ B;  5B0Z A;  1P3G B;  2JCH A;  1P3I B;  3TU4 C;  5GT0 D;  5CHL B;  3KSY A;  4H9O B;  4YS3 B;  2HIO C;  1BH9 B;  1KX3 D;  1M1A B;  2NQB A;  3WAA A;  4H9P B;  3VH6 A;  3X1U D;  1P3G C;  1P3I C;  3A6N A;  4YS3 C;  3C1C D;  1TZY D;  3C1B B;  5B32 A;  3X1T D;  4WU9 B;  3W97 B;  5B24 A;  3W99 D;  5CPI D;  4H9S C;  4M6B A;  3UTA D;  2Y2N A;  1P3A D;  5AVB C;  4WU9 C;  3C1B C;  3W97 C;  5BT1 D;  5GSU D;  5GXQ B;  4QLC B;  3WA9 D;  3AFA D;  3REL D;  4DRB A;  3AZN C;  3AV2 C;  3A1I A;  4CSR A;  5JRG B;  3O62 A;  4QLC C;  5GXQ C;  3MGR B;  3TU4 D;  3AZH D;  5B31 D;  3AZK B;  1P3P B;  3VH6 T;  2PYO A;  5C3I C;  3LEL A;  1P3L C;  4J8U B;  3A1K A;  5AV6 B;  1P3F C;  5AVC B;  3MGR C;  4NE3 A;  4NE5 A;  4YM6 B;  3KXB A;  2J8P A;  3AZL C;  5CPJ B;  3AZK C;  1S32 B;  1P3P C;  4G91 C;  5DNN A;  4Z2M G;  4JJN B;  4J8W B;  2JSS A;  1Z2C B;  3REH A;  4HGA B;  5CPJ C;  5B31 G;  1S32 C;  5AVB D;  3NQJ A;  5CP6 D;  3X1V C;  4JJN C;  2BG1 A;  5E5A A;  1JFI A;  1F66 A;  3AZN D;  4HGA C;  3MGQ A;  2Y2I A;  3AV2 D;  2G5I C;  1ZLA B;  3AZE C;  4CAY A;  5AV9 B;  3AZI D;  3AZG A;  1ZLA C;  3F6T A;  3AZM A;  1P3L D;  2YFV A;  5DNM B;  3REI C;  1P3F D;  5B1L B;  1EQZ A;  3AZL D;  3AN2 D;  3LZ0 B;  5AV9 C;  2DQN C;  1ID3 B;  5BNV A;  3LJA B;  3REK A;  2HUE B;  2Y2P A;  3NQU A;  3WTP A;  3LZ0 C;  4ZUX D;  1ID3 C;  4Z5T C;  2NZD A;  1P3O B;  3X1V D;  5B0Y C;  3LJA C;  3WKJ B;  2HUE C;  3AZJ C;  3REJ A;  5B2J B;  1M19 B;  3AZE D;  3WKJ C;  1R4V A;  2CV5 B;  5JA4 B;  5AV8 B;  3AYW C;  1N1J A;  3MVD A;  4WV4 B;  4R8P B;  3B0C T;  3REI D;  1M19 C;  4WU8 B;  1P3K B;  3KWQ B;  4X23 B;  2F8N K;  1M18 D;  3X1S A;  4R8P C;  5FUG B;  3VH6 W;  4LD9 A;  1KX5 D;  5B2I A;  3LZ0 D;  3B6F D;  4YM6 A;  4Z5T D;  4X23 C;  3B6G A;  5BO0 A;  3MGS B;  2ZY2 A;  5B0Y D;  3AZJ D;  3H0M C;  4XUJ D;  5F99 A;  3V9R A;  5B0Z C;  5GT0 B;  4H9R A;  3MGS C;  2YFW B;  3AYW D;  4J8V A;  1P3B D;  3X1U B;  3WAA C;  4EO5 B;  3MNN A;  5B1M D;  1HQ3 D;  5GT0 C;  3A6N C;  1ULY A;  3C1C B;  1TZY B;  3X1T B;  1P34 A;  3X1U C;  3AV1 D;  3W98 D;  4NFT A;  4EO5 C;  3W99 B;  5B32 C;  5KDM B;  3UTA B;  5B40 A;  5DNM A;  5B1L A;  4WNN A;  4J8X A;  3C1C C;  1P3A B;  1TZY C;  3X1T C;  1KU5 A;  5GSU B;  5B33 D;  3W99 C;  4G92 C;  3WA9 B;  3UTA C;  3AFA B;  5BS7 C;  3REL B;  5GT3 A;  4E44 A;  3TU4 B;  5B0Z D;  5GSU C;  3W96 C;  3AZH B;  3AFA C;  5B31 B;  3REL C;  2FFF B;  3KUY A;  3WAA D;  1AOI A;  4H9N B;  5B2J A;  4DQY B;  3A6N D;  4UUZ B;  2Y2K A;  5B31 C;  3AZH C;  2Y2M A;  2CV5 A;  5AV8 A;  5B32 D;  5B24 D;  1U35 A;  5BNX B;  1P3K A;  3B0C W;  5AVB B;  1P3M A;  5CP6 B;  3AZN B;  2RIQ A;  4ZBJ C;  3AV2 B;  2Y2O A;  1F66 C;  5CP6 C;  5B32 G;  3W96 D;  2CWE A;  1F1E A;  3AZI B;  2BYK B;  4XZQ A;  5C3I B;  3AZG C;  5AV5 A;  1P3L B;  2PYO D;  1P3F B;  5G49 A;  3MGP C;  3LEL D;  3AZL B;  3AN2 B;  3AZI C;  4Z66 A;  4G91 B;  1KX4 A;  1KX3 A;  2YFW A;  3H0R C;  3AN2 C;  2ARO A;  3REK C;  3AZF C;  5AY8 A;  1TAF B;  4ZUX B;  3REH D;  2FJ7 C;  4KGC C;  4KUD A;  2NZD C;  3X1V B;  5CPK C;  2F8N A;  2JE5 A;  5CPI A;  5E5A D;  1F66 D;  4ZUX C;  1Q9C A;  4NE6 A;  3AZE B;  2IO5 B;  3WA9 A;  3UTB A;  3LZ1 A;  3AZG D;  3REI B;  3MGP D;  3AZM D;  3TU4 A;  2IO5 C;  2HIO A;  1M18 B;  1P3I A;  1P3G A;  2F8N H;  3AZF D;  3REK D;  1KX5 B;  3B6F B;  4LD9 C;  2FJ7 D;  4Z5T B;  4H9O A;  3WTP D;  4YS3 A;  4KGC D;  2NZD D;  1BH9 A;  5CPK D;  1M1A A;  1M18 C;  5B0Y B;  4H9P A;  3AZJ B;  4H9S A;  1KX5 C;  4XUJ B;  3B6F C;  3REJ D;  5F99 C;  5AVB A;  4WU9 A;  3W97 A;  3C1B A;  2VQR A;  3AYW B;  4XUJ C;  1P3B B;  3AZN A;  5B1M B;  1HQ3 B;  3MNN C;  3MVD D;  4QLC A;  2Y2G A;  5GXQ A;  1P3B C;  3W98 B;  3AV1 B;  5B1M C;  1HQ3 C;  2XD1 A;  3IP4 C;  3X1S D;  3UT9 C;  5JRG A;  3MGR A;  4LD9 D;  5B2I D;  3AZK A;  3W98 C;  3FDD A;  3AV1 C;  1P3P A;  5B33 B;  1A7W A;  4H9Q B;  4J8U A;  5AV6 A;  5AVC A;  2W8S A;  5CPJ A;  1S32 A;  5F99 D;  5B0Z B;  5B33 C;  4JJN A;  4J8W A;  3WAA B;  4J8V D;  3KUY C;  3MNN D;  3A6N B;  2NQB C;  5B32 B;  1P34 D;  5B24 B;  1ZLA A;  3UT9 D;  3EPL A;  3R45 B;  2G5H C;  3H0L C;  5B40 D;  5AV9 A;  1PZR A;  4J8X D;  3B0D B;  4G92 B;  4KHA B;  5B24 C;  2L5A A;  5GT3 D;  3LZ0 A;  1ID3 A;  3B0D C;  3W96 B;  4CSR B;  3LJA A;  2PYO B;  2ZY4 A;  3KUY D;  4XZQ C;  1P3O A;  3LEL B;  1AOI D;  3O62 C;  3WKJ A;  3WTP E;  3VH5 A;  1KX4 C;  5DNN B;  2NQB D;  2PYO C;  3LEL C;  1M19 A;  3REH B;  3KXB C;  1U35 D;  4KUD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...