3W99A

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99A00
4UUZB 4WZSB 2HUEB 4H9RA 3AYWC 4G91C 3VH5W 1KX3A 5AV8A 3LJAD 2CV5B 5JA4A 1P34D 3W96D 3LJAB 3WKJA 5B32A 2CV5A 1P34B 3W96B 4WNNA 4NE3A 3C1BC 5B31D 4EO5B 2LY8A 5B0YC 1AOID 5B0ZC 2RVQD 5B2ID 1P3PA 3W98C 4H9OA 4H9PA 5F99B 4WU8C 1AOIB 4J8WC 5B2IB 5GT3C 1BH9B 5F99A 3UTAD 3X1TA 3UTAB 3WAAA 5B1MD 4XZQC 3MGSC 3AZFC 5BNVA 3REJC 2NZDC 3MGQC 3LZ0D 5B1MB 3W99D 4KUDB 5JRGD 4LD9A 4J8XC 4QLCA 3LZ0B 2CWEA 3W99B 5JRGB 1TZYC 5GSUC 4KUDA 5B32G 3TU4C 3AZEA 2JSSA 5B1LA 4XUJC 2F8NH 2NQBA 2BYMA 2F8ND 5AVBC 4WV4B 3VH5A 4X23D 3WTPD 3C1CD 2F8NB 3AZMD 5AY8D 1N1JB 4X23B 3WTPB 3C1CB 5AV5C 5B24D 4CAYB 3MNNA 3AZMB 5AY8B 1KX5A 5AV6C 5B40D 1M19C 3LELB 4YM6C 3WA9D 5B40B 5B24C 3X1VA 2HIOC 4DRBA 3LELA 3RELC 3WA9B 1P3OD 5KDMB 3V9RA 3REID 5B2JD 4Z66C 1M1AD 1EQZC 4YS3D 5CPJB 1P3OB 3REIB 5AVCC 5B2JB 4J8UA 4YS3B 5E5AC 3X1SD 3REHD 5CPJA 3B6FA 4KGCD 5GT0C 3AN2D 1P3KA 3AZGA 3X1SB 3REHB 3AZIA 1M1AC 4WU9A 3AN2B 3X1UD 4KGCB 5AV9A 3AFAD 1U35A 1P3GC 3X1UB 1P3MD 3KXBD 4JJNC 3AV2A 3AFAB 5CPID 1P3LC 1F66A 1ULYA 5GXQC 4G92C 3AZJA 3KXBB 1P3MB 1M18D 1ID3A 5CPIB 3REKC 5DNNA 3AZKC 1M18B 1S32C 3KUYA 3LZ1D 5CPKA 4H9NA 5DNMD 3KWQA 1B67A 3AV1D 1P3AA 5BNXA 3W97D 3LZ1B 5DNMB 3AV1B 1KX4D 1P3IA 3R45A 3B6GD 3W97B 1BH8B 2AROA 3A6NC 1KX4B 1ZLAA 3B6GB 4Z5TC 4DRAA 3AZLB 3AZHA 2IO5B 3O62C 1P3BC 4ZUXC 3AYWD 3AZLA 2PYOA 4J8VC 5CP6D 3UT9B 3AYWB 4G91B 2BYKB 4AWLC 3B0BA 1P3FA 3UT9A 4UUZA 3C1BD 5B33C 5CP6C 5B0YD 3C1BB 5B0ZD 3W98D 2FJ7C 5B0YB 3AZNC 3MGPC 4WU8D 4J8WD 5B0ZB 5GT3D 3UTBC 3W98B 4R8PC 4WU8B 3MVDC 3LJAA 4J8WB 1P34A 3B0DC 3W96A 5GT3B 3MGRC 5B31B 4XZQD 3MGSD 5B31A 3AZFD 3REJD 2NZDD 3MGQD 4XZQB 3MGSB 1AOIA 5B2IA 2YFVB 4J8XD 3REJB 3AZFB 3MGQB 5AV8C 1KX3C 2NZDB 5C3IC 1BH9A 1TZYD 4J8XB 5GSUD 3WKJC 5B32C 3UTAA 3TU4D 5BS7A 1TZYB 5GSUB 3TU4B 4XUJD 4Z2MH 1B6WA 1TAFB 5B1MA 5AVBD 4XUJB 1P3PC 4M6BA 3LZ0A 5AVBB 3W99A 5JRGA 5AV5D 3X1TC 5AV5B 3WAAC 4ZBJC 5AV6D 1M19D 5B31G 4YM6D 5AV6B 1M19B 2HIOD 2YFWB 2F8NA 3RELD 4YM6B 4H9SA 4LD9C 1N1JA 4QLCC 5B24B 3WTPA 4X23A 3C1CA 4Z66D 2HIOB 4CAYA 1EQZD 3RELB 3AZMA 4E44A 5AY8A 5AVCD 4Z66B 5B24A 1EQZB 3AZEC 3VH6W 5E5AD 5AVCB 5GT0D 5B1LC 5E5AB 1JFIB 2NQBC 5B40A 3NQJB 3VH5T 5GT0B 3WA9A 1WWSA 1H3OB 1P3GD 5KDMA 1M1AB 4NE5A 5FUGB 4JJND 1P3OA 1P3LD 1P3GB 3REIA 3MNNC 5B2JA 5GXQD 1M1AA 4JJNB 4YS3A 5FUGA 1P3LB 3REKD 1KX5C 3AZKD 5GXQB 4G92B 3B0CT 1S32D 5G49B 3X1SA 3REHA 3REKB 4KGCA 3AZKB 3AN2A 1S32B 3X1VC 4H9QB 2F8NG 3X1UA 1HQ3D 3AFAA 4H9QA 4HGAC 1P3MA 3KXBA 3A6ND 5CPIA 4J8UC 1M18A 4Z5TD 4CSRB 3B6FC 3A6NB 1P3KC 3AZGC 3O62D 4Z5TB 1P3BD 5BT1C 1HQ3C 3AZIC 4ZUXD 4WU9C 3O62B 1P3BB 5AV9C 3LZ1A 1U35C 4ZUXB 5DNMA 4J8VD 3AV1A 3W97A 3AV2C 1BH8A 1F66C 4J8VB 1KX4A 1ID3C 3AZJC 3VH6A 4KHAB 4AWLB 3B6GA 1KU5A 5DNNC 5B33D 3NQUB 3KUYC 5B33B 5CPKC 3KWQC 3KSYA 2FJ7D 5CP6B 1R4VA 5BO0B 3MGPD 3AZND 1P3AC 3AYWA 2BYKA 3UTBD 2FJ7B 4R8PD 3MVDD 3MGPB 3AZNB 1P3IC 5CP6A 2AROC 3MGRD 3UTBB 4R8PB 3MVDB 1ZLAC 3B0DB 3MGRB 3AZHC 3C1BA 4E45A 5B0YA 5B0ZA 2PYOC 4H9RB 1KX3D 5AV8D 3W98A 2F8NK 4WU8A 4J8WA 5GT3A 1KX3B 5AV8B 3WKJD 5JA4B 5B32D 5C3IB 2CV5D 1P3FC 3UT9C 3WKJB 5B32B 2HUEC 4WNNB 1Q9CA 4XZQA 3MGSA 1P3PD 2YFVA 3AZFA 3REJA 2NZDA 3MGQA 2CV5C 1P3PB 4H9OB 4H9PB 4J8XA 3LJAC 3B0CW 5F99D 1P34C 3X1TD 3W96C 1TZYA 5GSUA 3WAAD 3TU4A 3X1TB 4EO5C 3WAAB 1TAFA 4ZBJB 5B31C 4XUJA 5F99C 1AOIC 5AVBA 2RVQC 5B2IC 4LD9D 5BNVB 3WTPE 4QLCD 4LD9B 4KUDD 4QLCB 5AV5A 3UTAC 5BS7C 3AZED 5B1LD 3AZEB 2NQBD 5AV6A 1M19A 5B1MC 5B1LB 2YFWA 4KUDC 4YM6A 2NQBB 2BYMB 3LZ0C 2HIOA 3W99C 5JRGC 3RELA 3MNND 4Z66A 1EQZA 5AVCA 1KX5D 3MNNB 5E5AA 1JFIA 1KX5B 3NQJA 5GT0A 3X1VD 4NE6A 1H3OA 4Z2MG 3LELD 4H9SC 3X1VB 4X23C 3WTPC 1P3GA 3C1CC 2L5AA 3AZMC 5AY8C 4JJNA 3V9RB 1P3LA 4J8UD 4HGAB 5GXQA 5CPJD 3B6FD 5G49A 3REKA 4J8UB 3LELC 1P3KD 3AZGD 3AZKA 5BT1D 5B40C 3AZID 1S32A 3B6FB 4WU9D 1P3KB 3AZGB 5AV9D 1HQ3B 1U35D 3WA9C 3AZIB 4WU9B 1WWIA 5AV9B 3AV2D 5CPJC 1U35B 1P3OC 1F66D 1HQ3A 3REIC 5B2JC 1ID3D 3AZJD 4YS3C 3AV2B 4CSRA 1F66B 5DNND 3A6NA 1ID3B 3AZJB 4Z5TA 3X1SC 3REHC 5DNNB 4KGCC 3KUYD 3AN2C 3O62A 5CPKD 1P3BA 3KWQD 4ZUXA 3KUYB 3X1UC 1P3AD 5CPKB 4H9NB 3AFAC 3KWQB 1P3ID 1P3AB 4J8VA 5BNXB 2AROD 3KXBC 1P3MC 4KHAA 5CPIC 1P3IB 3R45B 1ZLAD 1M18C 2AROB 3NQUA 3AZHD 1ZLAB 5B33A 1HTAA 3AZHB 4NFTA 5BO0A 3AZLD 3LZ1C 1F1EA 2PYOD 5DNMC 3AV1C 2FJ7A 3AZNA 3MGPA 3W97C 2PYOB 1A7WA 3VH6T 3UTBA 1KX4C 4R8PA 3MVDA 1P3FD 3UT9D 3B6GC 3MGRA 1BFMA 3AZLC 2IO5C 1P3FB 5CHLB
chains in the Genus database with same CATH superfamily
3H0RC 4UUZB 4WZSB 2HUEB 4H9RA 3AYWC 2JE5A 2UWXA 4G91C 3VH5W 1KX3A 5AV8A 3LJAD 2CV5B 5JA4A 1P34D 3W96D 3LJAB 3WKJA 5B32A 2CV5A 1P34B 4WJ3C 3W96B 3P5JB 4WNNA 4NE3A 3C1BC 5B31D 4EO5B 2LY8A 5B0YC 1AOID 5B0ZC 2RVQD 5B2ID 1P3PA 3W98C 4H9OA 4H9PA 5F99B 4WU8C 1AOIB 4J8WC 5B2IB 5GT3C 1BH9B 5F99A 3UTAD 3X1TA 3UTAB 3WAAA 2FFFB 2DQNC 5B1MD 4XZQC 3MGSC 3AZFC 5BNVA 3REJC 2NZDC 3MGQC 3LZ0D 5B1MB 3W99D 2ZY4A 5JRGD 4KUDB 4LD9A 4J8XC 4QLCA 3LZ0B 2CWEA 3W99B 5JRGB 1TZYC 3A1IA 5GSUC 4KUDA 5B32G 3TU4C 3AZEA 2Y2KA 2JSSA 5B1LA 4XUJC 2F8NH 2NQBA 2BYMA 2F8ND 5AVBC 4WV4B 3VH5A 4X23D 3WTPD 3C1CD 3EPJA 2F8NB 3AZMD 5AY8D 1N1JB 4X23B 3WTPB 3C1CB 5AV5C 2Y2PA 4CAYB 5B24D 3MNNA 3AZMB 5AY8B 1KX5A 5AV6C 3H0MC 5B40D 1M19C 3LELB 4YM6C 3WA9D 1Z2CB 5B40B 5B24C 3A1KA 3X1VA 2HIOC 4DRBA 3LELA 3RELC 3WA9B 1P3OD 5KDMB 3V9RA 3REID 5B2JD 4Z66C 1M1AD 1EQZC 4YS3D 5CPJB 1P3OB 3REIB 5AVCC 5B2JB 2XD5A 4J8UA 4YS3B 5E5AC 3X1SD 3REHD 5CPJA 3B6FA 4KGCD 5GT0C 3AN2D 1P3KA 3AZGA 3X1SB 3REHB 3AZIA 1M1AC 4WU9A 3AN2B 3X1UD 4KGCB 5AV9A 3AFAD 1U35A 1P3GC 3X1UB 1P3MD 3KXBD 4JJNC 3AV2A 3AFAB 5CPID 1P3LC 1F66A 1ULYA 5GXQC 4G92C 3AZJA 3KXBB 1P3MB 1M18D 1ID3A 5CPIB 3REKC 5DNNA 3AZKC 1M18B 1S32C 3KUYA 3LZ1D 5CPKA 4H9NA 5DNMD 3KWQA 1B67A 3AV1D 1P3AA 5BNXA 3W97D 3LZ1B 5DNMB 3AV1B 1KX4D 1P3IA 3R45A 3B6GD 3W97B 1BH8B 2AROA 2VQRA 3A6NC 1KX4B 2JCHA 1ZLAA 3B6GB 4Z5TC 4DRAA 3AZLB 3AZHA 2IO5B 3O62C 2Y2LA 2RIQA 1P3BC 4ZUXC 2Y2QA 3AYWD 3AZLA 2PYOA 4J8VC 5CP6D 3UT9B 3AYWB 4G91B 2BYKB 4AWLC 3B0BA 1P3FA 3UT9A 3FDDA 4UUZA 3C1BD 5B33C 5CP6C 5B0YD 3C1BB 5B0ZD 3W98D 2FJ7C 5B0YB 3AZNC 3MGPC 4WU8D 4J8WD 5B0ZB 5GT3D 3UTBC 3W98B 4R8PC 2Y2JA 4WU8B 3MVDC 3LJAA 4J8WB 4DQYB 1P34A 3B0DC 3W96A 5GT3B 3MGRC 5B31B 4XZQD 3MGSD 5B31A 3AZFD 3REJD 2NZDD 3MGQD 4XZQB 3MGSB 1AOIA 5B2IA 2YFVB 4J8XD 3REJB 3AZFB 3MGQB 5AV8C 1KX3C 2NZDB 5C3IC 1BH9A 1TZYD 4J8XB 5GSUD 3WKJC 5B32C 3UTAA 3TU4D 5BS7A 1TZYB 5GSUB 3TU4B 4XUJD 4Z2MH 1B6WA 5AVBD 1TAFB 5B1MA 4XUJB 1P3PC 3IP4C 4M6BA 3LZ0A 5AVBB 3W99A 5JRGA 5AV5D 3X1TC 5AV5B 3WAAC 4ZBJC 5AV6D 2G5HC 1M19D 2Y2MA 5B31G 4YM6D 5AV6B 1M19B 4UPKA 2HIOD 2YFWB 2F8NA 3RELD 4YM6B 4H9SA 4LD9C 1N1JA 4QLCC 5B24B 3WTPA 4X23A 3C1CA 4Z66D 2HIOB 4CAYA 1EQZD 3RELB 3AZMA 4E44A 5AY8A 5AVCD 4Z66B 5B24A 1EQZB 3AZEC 3VH6W 5E5AD 5AVCB 5GT0D 5B1LC 5E5AB 1JFIB 2NQBC 5B40A 3NQJB 3VH5T 5GT0B 3AL0C 3WA9A 1WWSA 1H3OB 1P3GD 5KDMA 1M1AB 4NE5A 5FUGB 4JJND 1P3OA 1P3LD 1P3GB 3REIA 3MNNC 5B2JA 5GXQD 1M1AA 4JJNB 4YS3A 5FUGA 1P3LB 3REKD 2J8PA 1KX5C 3AZKD 5GXQB 4G92B 3B0CT 1S32D 5G49B 3X1SA 3REHA 3REKB 4KGCA 3AZKB 3AN2A 1S32B 3X1VC 4H9QB 2F8NG 3X1UA 1HQ3D 3AFAA 2Y2HA 4H9QA 4HGAC 1P3MA 3KXBA 3A6ND 5CPIA 4J8UC 1M18A 4Z5TD 4CSRB 3B6FC 3A6NB 1P3KC 3AZGC 3O62D 4Z5TB 1P3BD 5BT1C 1HQ3C 3AZIC 4ZUXD 4WU9C 3O62B 1P3BB 5AV9C 3LZ1A 1U35C 4ZUXB 5DNMA 4J8VD 3AV1A 3W97A 3AV2C 1BH8A 1F66C 4J8VB 1KX4A 1ID3C 3AZJC 3VH6A 4KHAB 4AWLB 3B6GA 2Y2IA 1KU5A 5DNNC 5B33D 3NQUB 2G5IC 3KUYC 2F2AC 2ZM5A 5B33B 5CPKC 3KWQC 3KSYA 2FJ7D 5CP6B 1R4VA 5BO0B 3MGPD 3AZND 1P3AC 3AYWA 2BYKA 3UTBD 1T3UA 2FJ7B 4R8PD 3MVDD 3MGPB 3AZNB 1P3IC 5CP6A 2AROC 3MGRD 3UTBB 4R8PB 3MVDB 1ZLAC 3B0DB 3MGRB 3AZHC 3C1BA 4E45A 3EPHA 3F6TA 5B0YA 2Y2NA 5B0ZA 2PYOC 4H9RB 1KX3D 5AV8D 3W98A 2F8NK 4WU8A 2ZY3A 4J8WA 5GT3A 1KX3B 5AV8B 3WKJD 5JA4B 5B32D 5C3IB 2CV5D 1P3FC 3UT9C 3WKJB 5B32B 2HUEC 4WNNB 1Q9CA 4XZQA 3MGSA 3EPKA 1P3PD 2YFVA 3AZFA 3REJA 2NZDA 3MGQA 2CV5C 1P3PB 4H9OB 4H9PB 4J8XA 3LJAC 3B0CW 5F99D 1P34C 3X1TD 3W96C 1TZYA 5GSUA 3WAAD 3TU4A 3X1TB 4EO5C 2Y2OA 3WAAB 1TAFA 4ZBJB 5B31C 4XUJA 5F99C 1AOIC 5AVBA 2RVQC 5B2IC 4LD9D 5BNVB 3WTPE 4QLCD 4LD9B 4KUDD 4QLCB 5AV5A 3UTAC 5BS7C 3AZED 5B1LD 3AZEB 2NQBD 5AV6A 1M19A 5B1MC 5B1LB 2YFWA 4KUDC 3H0LC 4YM6A 2NQBB 2BYMB 3LZ0C 2HIOA 3W99C 5JRGC 3RELA 3MNND 4Z66A 1EQZA 5AVCA 1KX5D 3MNNB 5E5AA 1JFIA 1KX5B 3NQJA 5GT0A 3X1VD 4NE6A 1H3OA 4Z2MG 3LELD 4H9SC 3X1VB 4X23C 3WTPC 1P3GA 3C1CC 2Y2GA 2L5AA 3AZMC 5AY8C 4JJNA 3V9RB 1P3LA 4J8UD 4HGAB 5GXQA 2DF4C 5CPJD 3B6FD 5G49A 3REKA 4J8UB 3LELC 1P3KD 3AZGD 3AZKA 5BT1D 5B40C 3AZID 1S32A 3B6FB 3EG5B 4WU9D 1P3KB 3AZGB 5AV9D 1HQ3B 1U35D 3WA9C 3AZIB 2ZY5A 4WU9B 1WWIA 2BG1A 5AV9B 3AV2D 5CPJC 1U35B 1P3OC 1F66D 1HQ3A 3REIC 5B2JC 1ID3D 3AZJD 4YS3C 3AV2B 1PZRA 4CSRA 1F66B 5DNND 3A6NA 1W2EA 1ID3B 3AZJB 4Z5TA 3X1SC 3REHC 5DNNB 4KGCC 3KUYD 3AN2C 3O62A 5CPKD 1P3BA 3KWQD 4ZUXA 3KUYB 3X1UC 2XD1A 1P3AD 5CPKB 4H9NB 3AFAC 3KWQB 1P3ID 1P3AB 4J8VA 5BNXB 2AROD 3KXBC 1P3MC 4KHAA 5CPIC 3EPLA 1P3IB 3R45B 1ZLAD 1M18C 2AROB 3NQUA 3AZHD 1ZLAB 2ZY2A 5B33A 1HTAA 3AZHB 2W8SA 4NFTA 5BO0A 3AZLD 3LZ1C 1F1EA 2PYOD 5DNMC 3AV1C 2FJ7A 3AZNA 3MGPA 3W97C 2PYOB 1A7WA 3VH6T 3UTBA 1KX4C 4R8PA 3MVDA 3KFUG 1P3FD 3UT9D 3B6GC 3MGRA 1BFMA 3AZLC 2IO5C 1P3FB 5CHLB
chains in the Genus database with same CATH topology
3H0RC 4UUZB 4WZSB 2HUEB 4H9RA 3AYWC 2JE5A 2UWXA 4G91C 3VH5W 1KX3A 5AV8A 3LJAD 2CV5B 5JA4A 1P34D 3W96D 3LJAB 3WKJA 5B32A 2CV5A 1P34B 4WJ3C 3W96B 3P5JB 4WNNA 4NE3A 3C1BC 5B31D 4EO5B 2LY8A 5B0YC 1AOID 5B0ZC 2RVQD 5B2ID 1P3PA 3W98C 4H9OA 4H9PA 5F99B 4WU8C 1AOIB 4J8WC 5B2IB 5GT3C 1BH9B 5F99A 3UTAD 3X1TA 3UTAB 3WAAA 2FFFB 2DQNC 5B1MD 4XZQC 3MGSC 3AZFC 5BNVA 3REJC 2NZDC 3MGQC 3LZ0D 5B1MB 3W99D 2ZY4A 5JRGD 4KUDB 4LD9A 4J8XC 4QLCA 3LZ0B 2CWEA 3W99B 5JRGB 1TZYC 3A1IA 5GSUC 4KUDA 5B32G 3TU4C 3AZEA 2Y2KA 2JSSA 5B1LA 4XUJC 2F8NH 2NQBA 2BYMA 2F8ND 5AVBC 4WV4B 3VH5A 4X23D 3WTPD 3C1CD 3EPJA 2F8NB 3AZMD 5AY8D 1N1JB 4X23B 3WTPB 3C1CB 5AV5C 2Y2PA 4CAYB 5B24D 3MNNA 3AZMB 5AY8B 1KX5A 5AV6C 3H0MC 5B40D 1M19C 3LELB 4YM6C 3WA9D 1Z2CB 5B40B 5B24C 3A1KA 3X1VA 2HIOC 4DRBA 3LELA 3RELC 3WA9B 1P3OD 5KDMB 3V9RA 3REID 5B2JD 4Z66C 1M1AD 1EQZC 4YS3D 5CPJB 1P3OB 3REIB 5AVCC 5B2JB 2XD5A 4J8UA 4YS3B 5E5AC 3X1SD 3REHD 5CPJA 3B6FA 4KGCD 5GT0C 3AN2D 1P3KA 3AZGA 3X1SB 3REHB 3AZIA 1M1AC 4WU9A 3AN2B 3X1UD 4KGCB 5AV9A 3AFAD 1U35A 1P3GC 3X1UB 1P3MD 3KXBD 4JJNC 3AV2A 3AFAB 5CPID 1P3LC 1F66A 1ULYA 5GXQC 4G92C 3AZJA 3KXBB 1P3MB 1M18D 1ID3A 5CPIB 3REKC 5DNNA 3AZKC 1M18B 1S32C 3KUYA 3LZ1D 5CPKA 4H9NA 5DNMD 3KWQA 1B67A 3AV1D 1P3AA 5BNXA 3W97D 3LZ1B 5DNMB 3AV1B 1KX4D 1P3IA 3R45A 3B6GD 3W97B 1BH8B 2AROA 2VQRA 3A6NC 1KX4B 2JCHA 1ZLAA 3B6GB 4Z5TC 4DRAA 3AZLB 3AZHA 2IO5B 3O62C 2Y2LA 2RIQA 1P3BC 4ZUXC 2Y2QA 3AYWD 3AZLA 2PYOA 4J8VC 5CP6D 3UT9B 3AYWB 4G91B 2BYKB 4AWLC 3B0BA 1P3FA 3UT9A 3FDDA 4UUZA 3C1BD 5B33C 5CP6C 5B0YD 3C1BB 5B0ZD 3W98D 2FJ7C 5B0YB 3AZNC 3MGPC 4WU8D 4J8WD 5B0ZB 5GT3D 3UTBC 3W98B 4R8PC 2Y2JA 4WU8B 3MVDC 3LJAA 4J8WB 4DQYB 1P34A 3B0DC 3W96A 5GT3B 3MGRC 5B31B 4XZQD 3MGSD 5B31A 3AZFD 3REJD 2NZDD 3MGQD 4XZQB 3MGSB 1AOIA 5B2IA 2YFVB 4J8XD 3REJB 3AZFB 3MGQB 5AV8C 1KX3C 2NZDB 5C3IC 1BH9A 1TZYD 4J8XB 5GSUD 3WKJC 5B32C 3UTAA 3TU4D 5BS7A 1TZYB 5GSUB 3TU4B 4XUJD 4Z2MH 1B6WA 5AVBD 1TAFB 5B1MA 4XUJB 1P3PC 3IP4C 4M6BA 3LZ0A 5AVBB 3W99A 5JRGA 5AV5D 3X1TC 5AV5B 3WAAC 4ZBJC 5AV6D 2G5HC 1M19D 2Y2MA 5B31G 4YM6D 5AV6B 1M19B 4UPKA 2HIOD 2YFWB 2F8NA 3RELD 4YM6B 4H9SA 4LD9C 1N1JA 4QLCC 5B24B 3WTPA 4X23A 3C1CA 4Z66D 2HIOB 4CAYA 1EQZD 3RELB 3AZMA 4E44A 5AY8A 5AVCD 4Z66B 5B24A 1EQZB 3AZEC 3VH6W 5E5AD 5AVCB 5GT0D 5B1LC 5E5AB 1JFIB 2NQBC 5B40A 3NQJB 3VH5T 5GT0B 3AL0C 3WA9A 1WWSA 1H3OB 1P3GD 5KDMA 1M1AB 4NE5A 5FUGB 4JJND 1P3OA 1P3LD 1P3GB 3REIA 3MNNC 5B2JA 5GXQD 1M1AA 4JJNB 4YS3A 5FUGA 1P3LB 3REKD 2J8PA 1KX5C 3AZKD 5GXQB 4G92B 3B0CT 1S32D 5G49B 3X1SA 3REHA 3REKB 4KGCA 3AZKB 3AN2A 1S32B 3X1VC 4H9QB 2F8NG 3X1UA 1HQ3D 3AFAA 2Y2HA 4H9QA 4HGAC 1P3MA 3KXBA 3A6ND 5CPIA 4J8UC 1M18A 4Z5TD 4CSRB 3B6FC 3A6NB 1P3KC 3AZGC 3O62D 4Z5TB 1P3BD 5BT1C 1HQ3C 3AZIC 4ZUXD 4WU9C 3O62B 1P3BB 5AV9C 3LZ1A 1U35C 4ZUXB 5DNMA 4J8VD 3AV1A 3W97A 3AV2C 1BH8A 1F66C 4J8VB 1KX4A 1ID3C 3AZJC 3VH6A 4KHAB 4AWLB 3B6GA 2Y2IA 1KU5A 5DNNC 5B33D 3NQUB 2G5IC 3KUYC 2F2AC 2ZM5A 5B33B 5CPKC 3KWQC 3KSYA 2FJ7D 5CP6B 1R4VA 5BO0B 3MGPD 3AZND 1P3AC 3AYWA 2BYKA 3UTBD 1T3UA 2FJ7B 4R8PD 3MVDD 3MGPB 3AZNB 1P3IC 5CP6A 2AROC 3MGRD 3UTBB 4R8PB 3MVDB 1ZLAC 3B0DB 3MGRB 3AZHC 3C1BA 4E45A 3EPHA 3F6TA 5B0YA 2Y2NA 5B0ZA 2PYOC 4H9RB 1KX3D 5AV8D 3W98A 2F8NK 4WU8A 2ZY3A 4J8WA 5GT3A 1KX3B 5AV8B 3WKJD 5JA4B 5B32D 5C3IB 2CV5D 1P3FC 3UT9C 3WKJB 5B32B 2HUEC 4WNNB 1Q9CA 4XZQA 3MGSA 3EPKA 1P3PD 2YFVA 3AZFA 3REJA 2NZDA 3MGQA 2CV5C 1P3PB 4H9OB 4H9PB 4J8XA 3LJAC 3B0CW 5F99D 1P34C 3X1TD 3W96C 1TZYA 5GSUA 3WAAD 3TU4A 3X1TB 4EO5C 2Y2OA 3WAAB 1TAFA 4ZBJB 5B31C 4XUJA 5F99C 1AOIC 5AVBA 2RVQC 5B2IC 4LD9D 5BNVB 3WTPE 4QLCD 4LD9B 4KUDD 4QLCB 5AV5A 3UTAC 5BS7C 3AZED 5B1LD 3AZEB 2NQBD 5AV6A 1M19A 5B1MC 5B1LB 2YFWA 4KUDC 3H0LC 4YM6A 2NQBB 2BYMB 3LZ0C 2HIOA 3W99C 5JRGC 3RELA 3MNND 4Z66A 1EQZA 5AVCA 1KX5D 3MNNB 5E5AA 1JFIA 1KX5B 3NQJA 5GT0A 3X1VD 4NE6A 1H3OA 4Z2MG 3LELD 4H9SC 3X1VB 4X23C 3WTPC 1P3GA 3C1CC 2Y2GA 2L5AA 3AZMC 5AY8C 4JJNA 3V9RB 1P3LA 4J8UD 4HGAB 5GXQA 2DF4C 5CPJD 3B6FD 5G49A 3REKA 4J8UB 3LELC 1P3KD 3AZGD 3AZKA 5BT1D 5B40C 3AZID 1S32A 3B6FB 3EG5B 4WU9D 1P3KB 3AZGB 5AV9D 1HQ3B 1U35D 3WA9C 3AZIB 2ZY5A 4WU9B 1WWIA 2BG1A 5AV9B 3AV2D 5CPJC 1U35B 1P3OC 1F66D 1HQ3A 3REIC 5B2JC 1ID3D 3AZJD 4YS3C 3AV2B 1PZRA 4CSRA 1F66B 5DNND 3A6NA 1W2EA 1ID3B 3AZJB 4Z5TA 3X1SC 3REHC 5DNNB 4KGCC 3KUYD 3AN2C 3O62A 5CPKD 1P3BA 3KWQD 4ZUXA 3KUYB 3X1UC 2XD1A 1P3AD 5CPKB 4H9NB 3AFAC 3KWQB 1P3ID 1P3AB 4J8VA 5BNXB 2AROD 3KXBC 1P3MC 4KHAA 5CPIC 3EPLA 1P3IB 3R45B 1ZLAD 1M18C 2AROB 3NQUA 3AZHD 1ZLAB 2ZY2A 5B33A 1HTAA 3AZHB 2W8SA 4NFTA 5BO0A 3AZLD 3LZ1C 1F1EA 2PYOD 5DNMC 3AV1C 2FJ7A 3AZNA 3MGPA 3W97C 2PYOB 1A7WA 3VH6T 3UTBA 1KX4C 4R8PA 3MVDA 3KFUG 1P3FD 3UT9D 3B6GC 3MGRA 1BFMA 3AZLC 2IO5C 1P3FB 5CHLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ B;  4WZS B;  2HUE B;  4H9R A;  3AYW C;  4G91 C;  3VH5 W;  1KX3 A;  5AV8 A;  3LJA D;  2CV5 B;  5JA4 A;  1P34 D;  3W96 D;  3LJA B;  3WKJ A;  5B32 A;  2CV5 A;  1P34 B;  3W96 B;  4WNN A;  4NE3 A;  3C1B C;  5B31 D;  4EO5 B;  2LY8 A;  5B0Y C;  1AOI D;  5B0Z C;  2RVQ D;  5B2I D;  1P3P A;  3W98 C;  4H9O A;  4H9P A;  5F99 B;  4WU8 C;  1AOI B;  4J8W C;  5B2I B;  5GT3 C;  1BH9 B;  5F99 A;  3UTA D;  3X1T A;  3UTA B;  3WAA A;  5B1M D;  4XZQ C;  3MGS C;  3AZF C;  5BNV A;  3REJ C;  2NZD C;  3MGQ C;  3LZ0 D;  5B1M B;  3W99 D;  4KUD B;  5JRG D;  4LD9 A;  4J8X C;  4QLC A;  3LZ0 B;  2CWE A;  3W99 B;  5JRG B;  1TZY C;  5GSU C;  4KUD A;  5B32 G;  3TU4 C;  3AZE A;  2JSS A;  5B1L A;  4XUJ C;  2F8N H;  2NQB A;  2BYM A;  2F8N D;  5AVB C;  4WV4 B;  3VH5 A;  4X23 D;  3WTP D;  3C1C D;  2F8N B;  3AZM D;  5AY8 D;  1N1J B;  4X23 B;  3WTP B;  3C1C B;  5AV5 C;  5B24 D;  4CAY B;  3MNN A;  3AZM B;  5AY8 B;  1KX5 A;  5AV6 C;  5B40 D;  1M19 C;  3LEL B;  4YM6 C;  3WA9 D;  5B40 B;  5B24 C;  3X1V A;  2HIO C;  4DRB A;  3LEL A;  3REL C;  3WA9 B;  1P3O D;  5KDM B;  3V9R A;  3REI D;  5B2J D;  4Z66 C;  1M1A D;  1EQZ C;  4YS3 D;  5CPJ B;  1P3O B;  3REI B;  5AVC C;  5B2J B;  4J8U A;  4YS3 B;  5E5A C;  3X1S D;  3REH D;  5CPJ A;  3B6F A;  4KGC D;  5GT0 C;  3AN2 D;  1P3K A;  3AZG A;  3X1S B;  3REH B;  3AZI A;  1M1A C;  4WU9 A;  3AN2 B;  3X1U D;  4KGC B;  5AV9 A;  3AFA D;  1U35 A;  1P3G C;  3X1U B;  1P3M D;  3KXB D;  4JJN C;  3AV2 A;  3AFA B;  5CPI D;  1P3L C;  1F66 A;  1ULY A;  5GXQ C;  4G92 C;  3AZJ A;  3KXB B;  1P3M B;  1M18 D;  1ID3 A;  5CPI B;  3REK C;  5DNN A;  3AZK C;  1M18 B;  1S32 C;  3KUY A;  3LZ1 D;  5CPK A;  4H9N A;  5DNM D;  3KWQ A;  1B67 A;  3AV1 D;  1P3A A;  5BNX A;  3W97 D;  3LZ1 B;  5DNM B;  3AV1 B;  1KX4 D;  1P3I A;  3R45 A;  3B6G D;  3W97 B;  1BH8 B;  2ARO A;  3A6N C;  1KX4 B;  1ZLA A;  3B6G B;  4Z5T C;  4DRA A;  3AZL B;  3AZH A;  2IO5 B;  3O62 C;  1P3B C;  4ZUX C;  3AYW D;  3AZL A;  2PYO A;  4J8V C;  5CP6 D;  3UT9 B;  3AYW B;  4G91 B;  2BYK B;  4AWL C;  3B0B A;  1P3F A;  3UT9 A;  4UUZ A;  3C1B D;  5B33 C;  5CP6 C;  5B0Y D;  3C1B B;  5B0Z D;  3W98 D;  2FJ7 C;  5B0Y B;  3AZN C;  3MGP C;  4WU8 D;  4J8W D;  5B0Z B;  5GT3 D;  3UTB C;  3W98 B;  4R8P C;  4WU8 B;  3MVD C;  3LJA A;  4J8W B;  1P34 A;  3B0D C;  3W96 A;  5GT3 B;  3MGR C;  5B31 B;  4XZQ D;  3MGS D;  5B31 A;  3AZF D;  3REJ D;  2NZD D;  3MGQ D;  4XZQ B;  3MGS B;  1AOI A;  5B2I A;  2YFV B;  4J8X D;  3REJ B;  3AZF B;  3MGQ B;  5AV8 C;  1KX3 C;  2NZD B;  5C3I C;  1BH9 A;  1TZY D;  4J8X B;  5GSU D;  3WKJ C;  5B32 C;  3UTA A;  3TU4 D;  5BS7 A;  1TZY B;  5GSU B;  3TU4 B;  4XUJ D;  4Z2M H;  1B6W A;  1TAF B;  5B1M A;  5AVB D;  4XUJ B;  1P3P C;  4M6B A;  3LZ0 A;  5AVB B;  3W99 A;  5JRG A;  5AV5 D;  3X1T C;  5AV5 B;  3WAA C;  4ZBJ C;  5AV6 D;  1M19 D;  5B31 G;  4YM6 D;  5AV6 B;  1M19 B;  2HIO D;  2YFW B;  2F8N A;  3REL D;  4YM6 B;  4H9S A;  4LD9 C;  1N1J A;  4QLC C;  5B24 B;  3WTP A;  4X23 A;  3C1C A;  4Z66 D;  2HIO B;  4CAY A;  1EQZ D;  3REL B;  3AZM A;  4E44 A;  5AY8 A;  5AVC D;  4Z66 B;  5B24 A;  1EQZ B;  3AZE C;  3VH6 W;  5E5A D;  5AVC B;  5GT0 D;  5B1L C;  5E5A B;  1JFI B;  2NQB C;  5B40 A;  3NQJ B;  3VH5 T;  5GT0 B;  3WA9 A;  1WWS A;  1H3O B;  1P3G D;  5KDM A;  1M1A B;  4NE5 A;  5FUG B;  4JJN D;  1P3O A;  1P3L D;  1P3G B;  3REI A;  3MNN C;  5B2J A;  5GXQ D;  1M1A A;  4JJN B;  4YS3 A;  5FUG A;  1P3L B;  3REK D;  1KX5 C;  3AZK D;  5GXQ B;  4G92 B;  3B0C T;  1S32 D;  5G49 B;  3X1S A;  3REH A;  3REK B;  4KGC A;  3AZK B;  3AN2 A;  1S32 B;  3X1V C;  4H9Q B;  2F8N G;  3X1U A;  1HQ3 D;  3AFA A;  4H9Q A;  4HGA C;  1P3M A;  3KXB A;  3A6N D;  5CPI A;  4J8U C;  1M18 A;  4Z5T D;  4CSR B;  3B6F C;  3A6N B;  1P3K C;  3AZG C;  3O62 D;  4Z5T B;  1P3B D;  5BT1 C;  1HQ3 C;  3AZI C;  4ZUX D;  4WU9 C;  3O62 B;  1P3B B;  5AV9 C;  3LZ1 A;  1U35 C;  4ZUX B;  5DNM A;  4J8V D;  3AV1 A;  3W97 A;  3AV2 C;  1BH8 A;  1F66 C;  4J8V B;  1KX4 A;  1ID3 C;  3AZJ C;  3VH6 A;  4KHA B;  4AWL B;  3B6G A;  1KU5 A;  5DNN C;  5B33 D;  3NQU B;  3KUY C;  5B33 B;  5CPK C;  3KWQ C;  3KSY A;  2FJ7 D;  5CP6 B;  1R4V A;  5BO0 B;  3MGP D;  3AZN D;  1P3A C;  3AYW A;  2BYK A;  3UTB D;  2FJ7 B;  4R8P D;  3MVD D;  3MGP B;  3AZN B;  1P3I C;  5CP6 A;  2ARO C;  3MGR D;  3UTB B;  4R8P B;  3MVD B;  1ZLA C;  3B0D B;  3MGR B;  3AZH C;  3C1B A;  4E45 A;  5B0Y A;  5B0Z A;  2PYO C;  4H9R B;  1KX3 D;  5AV8 D;  3W98 A;  2F8N K;  4WU8 A;  4J8W A;  5GT3 A;  1KX3 B;  5AV8 B;  3WKJ D;  5JA4 B;  5B32 D;  5C3I B;  2CV5 D;  1P3F C;  3UT9 C;  3WKJ B;  5B32 B;  2HUE C;  4WNN B;  1Q9C A;  4XZQ A;  3MGS A;  1P3P D;  2YFV A;  3AZF A;  3REJ A;  2NZD A;  3MGQ A;  2CV5 C;  1P3P B;  4H9O B;  4H9P B;  4J8X A;  3LJA C;  3B0C W;  5F99 D;  1P34 C;  3X1T D;  3W96 C;  1TZY A;  5GSU A;  3WAA D;  3TU4 A;  3X1T B;  4EO5 C;  3WAA B;  1TAF A;  4ZBJ B;  5B31 C;  4XUJ A;  5F99 C;  1AOI C;  5AVB A;  2RVQ C;  5B2I C;  4LD9 D;  5BNV B;  3WTP E;  4QLC D;  4LD9 B;  4KUD D;  4QLC B;  5AV5 A;  3UTA C;  5BS7 C;  3AZE D;  5B1L D;  3AZE B;  2NQB D;  5AV6 A;  1M19 A;  5B1M C;  5B1L B;  2YFW A;  4KUD C;  4YM6 A;  2NQB B;  2BYM B;  3LZ0 C;  2HIO A;  3W99 C;  5JRG C;  3REL A;  3MNN D;  4Z66 A;  1EQZ A;  5AVC A;  1KX5 D;  3MNN B;  5E5A A;  1JFI A;  1KX5 B;  3NQJ A;  5GT0 A;  3X1V D;  4NE6 A;  1H3O A;  4Z2M G;  3LEL D;  4H9S C;  3X1V B;  4X23 C;  3WTP C;  1P3G A;  3C1C C;  2L5A A;  3AZM C;  5AY8 C;  4JJN A;  3V9R B;  1P3L A;  4J8U D;  4HGA B;  5GXQ A;  5CPJ D;  3B6F D;  5G49 A;  3REK A;  4J8U B;  3LEL C;  1P3K D;  3AZG D;  3AZK A;  5BT1 D;  5B40 C;  3AZI D;  1S32 A;  3B6F B;  4WU9 D;  1P3K B;  3AZG B;  5AV9 D;  1HQ3 B;  1U35 D;  3WA9 C;  3AZI B;  4WU9 B;  1WWI A;  5AV9 B;  3AV2 D;  5CPJ C;  1U35 B;  1P3O C;  1F66 D;  1HQ3 A;  3REI C;  5B2J C;  1ID3 D;  3AZJ D;  4YS3 C;  3AV2 B;  4CSR A;  1F66 B;  5DNN D;  3A6N A;  1ID3 B;  3AZJ B;  4Z5T A;  3X1S C;  3REH C;  5DNN B;  4KGC C;  3KUY D;  3AN2 C;  3O62 A;  5CPK D;  1P3B A;  3KWQ D;  4ZUX A;  3KUY B;  3X1U C;  1P3A D;  5CPK B;  4H9N B;  3AFA C;  3KWQ B;  1P3I D;  1P3A B;  4J8V A;  5BNX B;  2ARO D;  3KXB C;  1P3M C;  4KHA A;  5CPI C;  1P3I B;  3R45 B;  1ZLA D;  1M18 C;  2ARO B;  3NQU A;  3AZH D;  1ZLA B;  5B33 A;  1HTA A;  3AZH B;  4NFT A;  5BO0 A;  3AZL D;  3LZ1 C;  1F1E A;  2PYO D;  5DNM C;  3AV1 C;  2FJ7 A;  3AZN A;  3MGP A;  3W97 C;  2PYO B;  1A7W A;  3VH6 T;  3UTB A;  1KX4 C;  4R8P A;  3MVD A;  1P3F D;  3UT9 D;  3B6G C;  3MGR A;  1BFM A;  3AZL C;  2IO5 C;  1P3F B;  5CHL B; 
#chains in the Genus database with same CATH topology
 3H0R C;  4UUZ B;  4WZS B;  2HUE B;  4H9R A;  3AYW C;  2JE5 A;  2UWX A;  4G91 C;  3VH5 W;  1KX3 A;  5AV8 A;  3LJA D;  2CV5 B;  5JA4 A;  1P34 D;  3W96 D;  3LJA B;  3WKJ A;  5B32 A;  2CV5 A;  1P34 B;  4WJ3 C;  3W96 B;  3P5J B;  4WNN A;  4NE3 A;  3C1B C;  5B31 D;  4EO5 B;  2LY8 A;  5B0Y C;  1AOI D;  5B0Z C;  2RVQ D;  5B2I D;  1P3P A;  3W98 C;  4H9O A;  4H9P A;  5F99 B;  4WU8 C;  1AOI B;  4J8W C;  5B2I B;  5GT3 C;  1BH9 B;  5F99 A;  3UTA D;  3X1T A;  3UTA B;  3WAA A;  2FFF B;  2DQN C;  5B1M D;  4XZQ C;  3MGS C;  3AZF C;  5BNV A;  3REJ C;  2NZD C;  3MGQ C;  3LZ0 D;  5B1M B;  3W99 D;  2ZY4 A;  5JRG D;  4KUD B;  4LD9 A;  4J8X C;  4QLC A;  3LZ0 B;  2CWE A;  3W99 B;  5JRG B;  1TZY C;  3A1I A;  5GSU C;  4KUD A;  5B32 G;  3TU4 C;  3AZE A;  2Y2K A;  2JSS A;  5B1L A;  4XUJ C;  2F8N H;  2NQB A;  2BYM A;  2F8N D;  5AVB C;  4WV4 B;  3VH5 A;  4X23 D;  3WTP D;  3C1C D;  3EPJ A;  2F8N B;  3AZM D;  5AY8 D;  1N1J B;  4X23 B;  3WTP B;  3C1C B;  5AV5 C;  2Y2P A;  4CAY B;  5B24 D;  3MNN A;  3AZM B;  5AY8 B;  1KX5 A;  5AV6 C;  3H0M C;  5B40 D;  1M19 C;  3LEL B;  4YM6 C;  3WA9 D;  1Z2C B;  5B40 B;  5B24 C;  3A1K A;  3X1V A;  2HIO C;  4DRB A;  3LEL A;  3REL C;  3WA9 B;  1P3O D;  5KDM B;  3V9R A;  3REI D;  5B2J D;  4Z66 C;  1M1A D;  1EQZ C;  4YS3 D;  5CPJ B;  1P3O B;  3REI B;  5AVC C;  5B2J B;  2XD5 A;  4J8U A;  4YS3 B;  5E5A C;  3X1S D;  3REH D;  5CPJ A;  3B6F A;  4KGC D;  5GT0 C;  3AN2 D;  1P3K A;  3AZG A;  3X1S B;  3REH B;  3AZI A;  1M1A C;  4WU9 A;  3AN2 B;  3X1U D;  4KGC B;  5AV9 A;  3AFA D;  1U35 A;  1P3G C;  3X1U B;  1P3M D;  3KXB D;  4JJN C;  3AV2 A;  3AFA B;  5CPI D;  1P3L C;  1F66 A;  1ULY A;  5GXQ C;  4G92 C;  3AZJ A;  3KXB B;  1P3M B;  1M18 D;  1ID3 A;  5CPI B;  3REK C;  5DNN A;  3AZK C;  1M18 B;  1S32 C;  3KUY A;  3LZ1 D;  5CPK A;  4H9N A;  5DNM D;  3KWQ A;  1B67 A;  3AV1 D;  1P3A A;  5BNX A;  3W97 D;  3LZ1 B;  5DNM B;  3AV1 B;  1KX4 D;  1P3I A;  3R45 A;  3B6G D;  3W97 B;  1BH8 B;  2ARO A;  2VQR A;  3A6N C;  1KX4 B;  2JCH A;  1ZLA A;  3B6G B;  4Z5T C;  4DRA A;  3AZL B;  3AZH A;  2IO5 B;  3O62 C;  2Y2L A;  2RIQ A;  1P3B C;  4ZUX C;  2Y2Q A;  3AYW D;  3AZL A;  2PYO A;  4J8V C;  5CP6 D;  3UT9 B;  3AYW B;  4G91 B;  2BYK B;  4AWL C;  3B0B A;  1P3F A;  3UT9 A;  3FDD A;  4UUZ A;  3C1B D;  5B33 C;  5CP6 C;  5B0Y D;  3C1B B;  5B0Z D;  3W98 D;  2FJ7 C;  5B0Y B;  3AZN C;  3MGP C;  4WU8 D;  4J8W D;  5B0Z B;  5GT3 D;  3UTB C;  3W98 B;  4R8P C;  2Y2J A;  4WU8 B;  3MVD C;  3LJA A;  4J8W B;  4DQY B;  1P34 A;  3B0D C;  3W96 A;  5GT3 B;  3MGR C;  5B31 B;  4XZQ D;  3MGS D;  5B31 A;  3AZF D;  3REJ D;  2NZD D;  3MGQ D;  4XZQ B;  3MGS B;  1AOI A;  5B2I A;  2YFV B;  4J8X D;  3REJ B;  3AZF B;  3MGQ B;  5AV8 C;  1KX3 C;  2NZD B;  5C3I C;  1BH9 A;  1TZY D;  4J8X B;  5GSU D;  3WKJ C;  5B32 C;  3UTA A;  3TU4 D;  5BS7 A;  1TZY B;  5GSU B;  3TU4 B;  4XUJ D;  4Z2M H;  1B6W A;  5AVB D;  1TAF B;  5B1M A;  4XUJ B;  1P3P C;  3IP4 C;  4M6B A;  3LZ0 A;  5AVB B;  3W99 A;  5JRG A;  5AV5 D;  3X1T C;  5AV5 B;  3WAA C;  4ZBJ C;  5AV6 D;  2G5H C;  1M19 D;  2Y2M A;  5B31 G;  4YM6 D;  5AV6 B;  1M19 B;  4UPK A;  2HIO D;  2YFW B;  2F8N A;  3REL D;  4YM6 B;  4H9S A;  4LD9 C;  1N1J A;  4QLC C;  5B24 B;  3WTP A;  4X23 A;  3C1C A;  4Z66 D;  2HIO B;  4CAY A;  1EQZ D;  3REL B;  3AZM A;  4E44 A;  5AY8 A;  5AVC D;  4Z66 B;  5B24 A;  1EQZ B;  3AZE C;  3VH6 W;  5E5A D;  5AVC B;  5GT0 D;  5B1L C;  5E5A B;  1JFI B;  2NQB C;  5B40 A;  3NQJ B;  3VH5 T;  5GT0 B;  3AL0 C;  3WA9 A;  1WWS A;  1H3O B;  1P3G D;  5KDM A;  1M1A B;  4NE5 A;  5FUG B;  4JJN D;  1P3O A;  1P3L D;  1P3G B;  3REI A;  3MNN C;  5B2J A;  5GXQ D;  1M1A A;  4JJN B;  4YS3 A;  5FUG A;  1P3L B;  3REK D;  2J8P A;  1KX5 C;  3AZK D;  5GXQ B;  4G92 B;  3B0C T;  1S32 D;  5G49 B;  3X1S A;  3REH A;  3REK B;  4KGC A;  3AZK B;  3AN2 A;  1S32 B;  3X1V C;  4H9Q B;  2F8N G;  3X1U A;  1HQ3 D;  3AFA A;  2Y2H A;  4H9Q A;  4HGA C;  1P3M A;  3KXB A;  3A6N D;  5CPI A;  4J8U C;  1M18 A;  4Z5T D;  4CSR B;  3B6F C;  3A6N B;  1P3K C;  3AZG C;  3O62 D;  4Z5T B;  1P3B D;  5BT1 C;  1HQ3 C;  3AZI C;  4ZUX D;  4WU9 C;  3O62 B;  1P3B B;  5AV9 C;  3LZ1 A;  1U35 C;  4ZUX B;  5DNM A;  4J8V D;  3AV1 A;  3W97 A;  3AV2 C;  1BH8 A;  1F66 C;  4J8V B;  1KX4 A;  1ID3 C;  3AZJ C;  3VH6 A;  4KHA B;  4AWL B;  3B6G A;  2Y2I A;  1KU5 A;  5DNN C;  5B33 D;  3NQU B;  2G5I C;  3KUY C;  2F2A C;  2ZM5 A;  5B33 B;  5CPK C;  3KWQ C;  3KSY A;  2FJ7 D;  5CP6 B;  1R4V A;  5BO0 B;  3MGP D;  3AZN D;  1P3A C;  3AYW A;  2BYK A;  3UTB D;  1T3U A;  2FJ7 B;  4R8P D;  3MVD D;  3MGP B;  3AZN B;  1P3I C;  5CP6 A;  2ARO C;  3MGR D;  3UTB B;  4R8P B;  3MVD B;  1ZLA C;  3B0D B;  3MGR B;  3AZH C;  3C1B A;  4E45 A;  3EPH A;  3F6T A;  5B0Y A;  2Y2N A;  5B0Z A;  2PYO C;  4H9R B;  1KX3 D;  5AV8 D;  3W98 A;  2F8N K;  4WU8 A;  2ZY3 A;  4J8W A;  5GT3 A;  1KX3 B;  5AV8 B;  3WKJ D;  5JA4 B;  5B32 D;  5C3I B;  2CV5 D;  1P3F C;  3UT9 C;  3WKJ B;  5B32 B;  2HUE C;  4WNN B;  1Q9C A;  4XZQ A;  3MGS A;  3EPK A;  1P3P D;  2YFV A;  3AZF A;  3REJ A;  2NZD A;  3MGQ A;  2CV5 C;  1P3P B;  4H9O B;  4H9P B;  4J8X A;  3LJA C;  3B0C W;  5F99 D;  1P34 C;  3X1T D;  3W96 C;  1TZY A;  5GSU A;  3WAA D;  3TU4 A;  3X1T B;  4EO5 C;  2Y2O A;  3WAA B;  1TAF A;  4ZBJ B;  5B31 C;  4XUJ A;  5F99 C;  1AOI C;  5AVB A;  2RVQ C;  5B2I C;  4LD9 D;  5BNV B;  3WTP E;  4QLC D;  4LD9 B;  4KUD D;  4QLC B;  5AV5 A;  3UTA C;  5BS7 C;  3AZE D;  5B1L D;  3AZE B;  2NQB D;  5AV6 A;  1M19 A;  5B1M C;  5B1L B;  2YFW A;  4KUD C;  3H0L C;  4YM6 A;  2NQB B;  2BYM B;  3LZ0 C;  2HIO A;  3W99 C;  5JRG C;  3REL A;  3MNN D;  4Z66 A;  1EQZ A;  5AVC A;  1KX5 D;  3MNN B;  5E5A A;  1JFI A;  1KX5 B;  3NQJ A;  5GT0 A;  3X1V D;  4NE6 A;  1H3O A;  4Z2M G;  3LEL D;  4H9S C;  3X1V B;  4X23 C;  3WTP C;  1P3G A;  3C1C C;  2Y2G A;  2L5A A;  3AZM C;  5AY8 C;  4JJN A;  3V9R B;  1P3L A;  4J8U D;  4HGA B;  5GXQ A;  2DF4 C;  5CPJ D;  3B6F D;  5G49 A;  3REK A;  4J8U B;  3LEL C;  1P3K D;  3AZG D;  3AZK A;  5BT1 D;  5B40 C;  3AZI D;  1S32 A;  3B6F B;  3EG5 B;  4WU9 D;  1P3K B;  3AZG B;  5AV9 D;  1HQ3 B;  1U35 D;  3WA9 C;  3AZI B;  2ZY5 A;  4WU9 B;  1WWI A;  2BG1 A;  5AV9 B;  3AV2 D;  5CPJ C;  1U35 B;  1P3O C;  1F66 D;  1HQ3 A;  3REI C;  5B2J C;  1ID3 D;  3AZJ D;  4YS3 C;  3AV2 B;  1PZR A;  4CSR A;  1F66 B;  5DNN D;  3A6N A;  1W2E A;  1ID3 B;  3AZJ B;  4Z5T A;  3X1S C;  3REH C;  5DNN B;  4KGC C;  3KUY D;  3AN2 C;  3O62 A;  5CPK D;  1P3B A;  3KWQ D;  4ZUX A;  3KUY B;  3X1U C;  2XD1 A;  1P3A D;  5CPK B;  4H9N B;  3AFA C;  3KWQ B;  1P3I D;  1P3A B;  4J8V A;  5BNX B;  2ARO D;  3KXB C;  1P3M C;  4KHA A;  5CPI C;  3EPL A;  1P3I B;  3R45 B;  1ZLA D;  1M18 C;  2ARO B;  3NQU A;  3AZH D;  1ZLA B;  2ZY2 A;  5B33 A;  1HTA A;  3AZH B;  2W8S A;  4NFT A;  5BO0 A;  3AZL D;  3LZ1 C;  1F1E A;  2PYO D;  5DNM C;  3AV1 C;  2FJ7 A;  3AZN A;  3MGP A;  3W97 C;  2PYO B;  1A7W A;  3VH6 T;  3UTB A;  1KX4 C;  4R8P A;  3MVD A;  3KFU G;  1P3F D;  3UT9 D;  3B6G C;  3MGR A;  1BFM A;  3AZL C;  2IO5 C;  1P3F B;  5CHL B; 
#chains in the Genus database with same CATH homology
 3H0R C;  4UUZ B;  4WZS B;  2HUE B;  4H9R A;  3AYW C;  2JE5 A;  2UWX A;  4G91 C;  3VH5 W;  1KX3 A;  5AV8 A;  3LJA D;  2CV5 B;  5JA4 A;  1P34 D;  3W96 D;  3LJA B;  3WKJ A;  5B32 A;  2CV5 A;  1P34 B;  4WJ3 C;  3W96 B;  3P5J B;  4WNN A;  4NE3 A;  3C1B C;  5B31 D;  4EO5 B;  2LY8 A;  5B0Y C;  1AOI D;  5B0Z C;  2RVQ D;  5B2I D;  1P3P A;  3W98 C;  4H9O A;  4H9P A;  5F99 B;  4WU8 C;  1AOI B;  4J8W C;  5B2I B;  5GT3 C;  1BH9 B;  5F99 A;  3UTA D;  3X1T A;  3UTA B;  3WAA A;  2FFF B;  2DQN C;  5B1M D;  4XZQ C;  3MGS C;  3AZF C;  5BNV A;  3REJ C;  2NZD C;  3MGQ C;  3LZ0 D;  5B1M B;  3W99 D;  2ZY4 A;  5JRG D;  4KUD B;  4LD9 A;  4J8X C;  4QLC A;  3LZ0 B;  2CWE A;  3W99 B;  5JRG B;  1TZY C;  3A1I A;  5GSU C;  4KUD A;  5B32 G;  3TU4 C;  3AZE A;  2Y2K A;  2JSS A;  5B1L A;  4XUJ C;  2F8N H;  2NQB A;  2BYM A;  2F8N D;  5AVB C;  4WV4 B;  3VH5 A;  4X23 D;  3WTP D;  3C1C D;  3EPJ A;  2F8N B;  3AZM D;  5AY8 D;  1N1J B;  4X23 B;  3WTP B;  3C1C B;  5AV5 C;  2Y2P A;  4CAY B;  5B24 D;  3MNN A;  3AZM B;  5AY8 B;  1KX5 A;  5AV6 C;  3H0M C;  5B40 D;  1M19 C;  3LEL B;  4YM6 C;  3WA9 D;  1Z2C B;  5B40 B;  5B24 C;  3A1K A;  3X1V A;  2HIO C;  4DRB A;  3LEL A;  3REL C;  3WA9 B;  1P3O D;  5KDM B;  3V9R A;  3REI D;  5B2J D;  4Z66 C;  1M1A D;  1EQZ C;  4YS3 D;  5CPJ B;  1P3O B;  3REI B;  5AVC C;  5B2J B;  2XD5 A;  4J8U A;  4YS3 B;  5E5A C;  3X1S D;  3REH D;  5CPJ A;  3B6F A;  4KGC D;  5GT0 C;  3AN2 D;  1P3K A;  3AZG A;  3X1S B;  3REH B;  3AZI A;  1M1A C;  4WU9 A;  3AN2 B;  3X1U D;  4KGC B;  5AV9 A;  3AFA D;  1U35 A;  1P3G C;  3X1U B;  1P3M D;  3KXB D;  4JJN C;  3AV2 A;  3AFA B;  5CPI D;  1P3L C;  1F66 A;  1ULY A;  5GXQ C;  4G92 C;  3AZJ A;  3KXB B;  1P3M B;  1M18 D;  1ID3 A;  5CPI B;  3REK C;  5DNN A;  3AZK C;  1M18 B;  1S32 C;  3KUY A;  3LZ1 D;  5CPK A;  4H9N A;  5DNM D;  3KWQ A;  1B67 A;  3AV1 D;  1P3A A;  5BNX A;  3W97 D;  3LZ1 B;  5DNM B;  3AV1 B;  1KX4 D;  1P3I A;  3R45 A;  3B6G D;  3W97 B;  1BH8 B;  2ARO A;  2VQR A;  3A6N C;  1KX4 B;  2JCH A;  1ZLA A;  3B6G B;  4Z5T C;  4DRA A;  3AZL B;  3AZH A;  2IO5 B;  3O62 C;  2Y2L A;  2RIQ A;  1P3B C;  4ZUX C;  2Y2Q A;  3AYW D;  3AZL A;  2PYO A;  4J8V C;  5CP6 D;  3UT9 B;  3AYW B;  4G91 B;  2BYK B;  4AWL C;  3B0B A;  1P3F A;  3UT9 A;  3FDD A;  4UUZ A;  3C1B D;  5B33 C;  5CP6 C;  5B0Y D;  3C1B B;  5B0Z D;  3W98 D;  2FJ7 C;  5B0Y B;  3AZN C;  3MGP C;  4WU8 D;  4J8W D;  5B0Z B;  5GT3 D;  3UTB C;  3W98 B;  4R8P C;  2Y2J A;  4WU8 B;  3MVD C;  3LJA A;  4J8W B;  4DQY B;  1P34 A;  3B0D C;  3W96 A;  5GT3 B;  3MGR C;  5B31 B;  4XZQ D;  3MGS D;  5B31 A;  3AZF D;  3REJ D;  2NZD D;  3MGQ D;  4XZQ B;  3MGS B;  1AOI A;  5B2I A;  2YFV B;  4J8X D;  3REJ B;  3AZF B;  3MGQ B;  5AV8 C;  1KX3 C;  2NZD B;  5C3I C;  1BH9 A;  1TZY D;  4J8X B;  5GSU D;  3WKJ C;  5B32 C;  3UTA A;  3TU4 D;  5BS7 A;  1TZY B;  5GSU B;  3TU4 B;  4XUJ D;  4Z2M H;  1B6W A;  5AVB D;  1TAF B;  5B1M A;  4XUJ B;  1P3P C;  3IP4 C;  4M6B A;  3LZ0 A;  5AVB B;  3W99 A;  5JRG A;  5AV5 D;  3X1T C;  5AV5 B;  3WAA C;  4ZBJ C;  5AV6 D;  2G5H C;  1M19 D;  2Y2M A;  5B31 G;  4YM6 D;  5AV6 B;  1M19 B;  4UPK A;  2HIO D;  2YFW B;  2F8N A;  3REL D;  4YM6 B;  4H9S A;  4LD9 C;  1N1J A;  4QLC C;  5B24 B;  3WTP A;  4X23 A;  3C1C A;  4Z66 D;  2HIO B;  4CAY A;  1EQZ D;  3REL B;  3AZM A;  4E44 A;  5AY8 A;  5AVC D;  4Z66 B;  5B24 A;  1EQZ B;  3AZE C;  3VH6 W;  5E5A D;  5AVC B;  5GT0 D;  5B1L C;  5E5A B;  1JFI B;  2NQB C;  5B40 A;  3NQJ B;  3VH5 T;  5GT0 B;  3AL0 C;  3WA9 A;  1WWS A;  1H3O B;  1P3G D;  5KDM A;  1M1A B;  4NE5 A;  5FUG B;  4JJN D;  1P3O A;  1P3L D;  1P3G B;  3REI A;  3MNN C;  5B2J A;  5GXQ D;  1M1A A;  4JJN B;  4YS3 A;  5FUG A;  1P3L B;  3REK D;  2J8P A;  1KX5 C;  3AZK D;  5GXQ B;  4G92 B;  3B0C T;  1S32 D;  5G49 B;  3X1S A;  3REH A;  3REK B;  4KGC A;  3AZK B;  3AN2 A;  1S32 B;  3X1V C;  4H9Q B;  2F8N G;  3X1U A;  1HQ3 D;  3AFA A;  2Y2H A;  4H9Q A;  4HGA C;  1P3M A;  3KXB A;  3A6N D;  5CPI A;  4J8U C;  1M18 A;  4Z5T D;  4CSR B;  3B6F C;  3A6N B;  1P3K C;  3AZG C;  3O62 D;  4Z5T B;  1P3B D;  5BT1 C;  1HQ3 C;  3AZI C;  4ZUX D;  4WU9 C;  3O62 B;  1P3B B;  5AV9 C;  3LZ1 A;  1U35 C;  4ZUX B;  5DNM A;  4J8V D;  3AV1 A;  3W97 A;  3AV2 C;  1BH8 A;  1F66 C;  4J8V B;  1KX4 A;  1ID3 C;  3AZJ C;  3VH6 A;  4KHA B;  4AWL B;  3B6G A;  2Y2I A;  1KU5 A;  5DNN C;  5B33 D;  3NQU B;  2G5I C;  3KUY C;  2F2A C;  2ZM5 A;  5B33 B;  5CPK C;  3KWQ C;  3KSY A;  2FJ7 D;  5CP6 B;  1R4V A;  5BO0 B;  3MGP D;  3AZN D;  1P3A C;  3AYW A;  2BYK A;  3UTB D;  1T3U A;  2FJ7 B;  4R8P D;  3MVD D;  3MGP B;  3AZN B;  1P3I C;  5CP6 A;  2ARO C;  3MGR D;  3UTB B;  4R8P B;  3MVD B;  1ZLA C;  3B0D B;  3MGR B;  3AZH C;  3C1B A;  4E45 A;  3EPH A;  3F6T A;  5B0Y A;  2Y2N A;  5B0Z A;  2PYO C;  4H9R B;  1KX3 D;  5AV8 D;  3W98 A;  2F8N K;  4WU8 A;  2ZY3 A;  4J8W A;  5GT3 A;  1KX3 B;  5AV8 B;  3WKJ D;  5JA4 B;  5B32 D;  5C3I B;  2CV5 D;  1P3F C;  3UT9 C;  3WKJ B;  5B32 B;  2HUE C;  4WNN B;  1Q9C A;  4XZQ A;  3MGS A;  3EPK A;  1P3P D;  2YFV A;  3AZF A;  3REJ A;  2NZD A;  3MGQ A;  2CV5 C;  1P3P B;  4H9O B;  4H9P B;  4J8X A;  3LJA C;  3B0C W;  5F99 D;  1P34 C;  3X1T D;  3W96 C;  1TZY A;  5GSU A;  3WAA D;  3TU4 A;  3X1T B;  4EO5 C;  2Y2O A;  3WAA B;  1TAF A;  4ZBJ B;  5B31 C;  4XUJ A;  5F99 C;  1AOI C;  5AVB A;  2RVQ C;  5B2I C;  4LD9 D;  5BNV B;  3WTP E;  4QLC D;  4LD9 B;  4KUD D;  4QLC B;  5AV5 A;  3UTA C;  5BS7 C;  3AZE D;  5B1L D;  3AZE B;  2NQB D;  5AV6 A;  1M19 A;  5B1M C;  5B1L B;  2YFW A;  4KUD C;  3H0L C;  4YM6 A;  2NQB B;  2BYM B;  3LZ0 C;  2HIO A;  3W99 C;  5JRG C;  3REL A;  3MNN D;  4Z66 A;  1EQZ A;  5AVC A;  1KX5 D;  3MNN B;  5E5A A;  1JFI A;  1KX5 B;  3NQJ A;  5GT0 A;  3X1V D;  4NE6 A;  1H3O A;  4Z2M G;  3LEL D;  4H9S C;  3X1V B;  4X23 C;  3WTP C;  1P3G A;  3C1C C;  2Y2G A;  2L5A A;  3AZM C;  5AY8 C;  4JJN A;  3V9R B;  1P3L A;  4J8U D;  4HGA B;  5GXQ A;  2DF4 C;  5CPJ D;  3B6F D;  5G49 A;  3REK A;  4J8U B;  3LEL C;  1P3K D;  3AZG D;  3AZK A;  5BT1 D;  5B40 C;  3AZI D;  1S32 A;  3B6F B;  3EG5 B;  4WU9 D;  1P3K B;  3AZG B;  5AV9 D;  1HQ3 B;  1U35 D;  3WA9 C;  3AZI B;  2ZY5 A;  4WU9 B;  1WWI A;  2BG1 A;  5AV9 B;  3AV2 D;  5CPJ C;  1U35 B;  1P3O C;  1F66 D;  1HQ3 A;  3REI C;  5B2J C;  1ID3 D;  3AZJ D;  4YS3 C;  3AV2 B;  1PZR A;  4CSR A;  1F66 B;  5DNN D;  3A6N A;  1W2E A;  1ID3 B;  3AZJ B;  4Z5T A;  3X1S C;  3REH C;  5DNN B;  4KGC C;  3KUY D;  3AN2 C;  3O62 A;  5CPK D;  1P3B A;  3KWQ D;  4ZUX A;  3KUY B;  3X1U C;  2XD1 A;  1P3A D;  5CPK B;  4H9N B;  3AFA C;  3KWQ B;  1P3I D;  1P3A B;  4J8V A;  5BNX B;  2ARO D;  3KXB C;  1P3M C;  4KHA A;  5CPI C;  3EPL A;  1P3I B;  3R45 B;  1ZLA D;  1M18 C;  2ARO B;  3NQU A;  3AZH D;  1ZLA B;  2ZY2 A;  5B33 A;  1HTA A;  3AZH B;  2W8S A;  4NFT A;  5BO0 A;  3AZL D;  3LZ1 C;  1F1E A;  2PYO D;  5DNM C;  3AV1 C;  2FJ7 A;  3AZN A;  3MGP A;  3W97 C;  2PYO B;  1A7W A;  3VH6 T;  3UTB A;  1KX4 C;  4R8P A;  3MVD A;  3KFU G;  1P3F D;  3UT9 D;  3B6G C;  3MGR A;  1BFM A;  3AZL C;  2IO5 C;  1P3F B;  5CHL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...