3W99A

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99A00
3NQUA 3W99A 2HUEB 5AV6C 1JFIB 3KXBC 5AV9A 3NQJA 1EQZB 4J8VA 3B6GC 5B0ZC 3WAAA 3A6NA 5AV6A 3KXBA 3MNNB 3REJD 3B6GA 2AROC 4XUJD 5AVBB 5B0ZA 2NQBD 3UTAD 3R45B 3VH6W 1AOID 1M19A 3LELB 3AZEB 1P3AD 3AZFB 1M1AC 4KGCB 1F66A 3AV1A 5DNND 1N1JB 5GXQA 5FUGA 4H9NA 1TZYC 3KSYA 5JRGB 3WTPE 1M18C 4YM6D 1M1AA 1ZLAC 5AV9D 3B0CT 5BO0A 5GT0C 3WTPB 3WAAD 5B2IA 4QLCA 3WKJC 3MGRB 1M18A 1BFMA 3AZID 1KX4B 3AZNA 1ZLAA 4G91C 3B6GD 5B0ZD 5GT0A 4KUDB 3X1UD 3KWQB 4X23C 1TAFA 3MGSC 2F8NB 1HQ3C 2HIOB 4NE6A 2AROD 1P3PB 4XZQB 3C1CB 1B67A 5B24A 3MGSA 5CP6B 1HQ3A 3AZLA 4H9OA 3C1BC 1M1AD 5CPKC 1P3GC 4YS3C 2JSSA 1ULYA 3TU4D 1ID3C 1P34B 3C1BA 1TZYD 1M18D 4AWLB 5CPKA 3REHB 4YS3A 1P3GA 5G49A 3MVDC 1S32B 5B32G 3WKJD 4H9SC 4JJNC 5AVCB 3MVDA 3AYWC 5CPJC 1B6WA 3B0CW 4H9RA 4H9SA 5B40D 4X23D 4JJNA 3X1TB 4Z66B 1HQ3D 4EO5C 5CPID 4KHAA 5AY8C 4CAYB 3AYWA 3X1SC 4J8UC 2FJ7C 1JFIA 3LJAB 3AZIB 2YFWA 3C1BD 2LY8A 5E5AA 3B6FB 4HGAB 4YS3D 5GT3B 5AV5B 3X1SA 3X1UB 3UT9C 1P3GD 2FJ7A 3AZHB 1ID3D 3VH5A 5BT1D 3UTBC 3MGPC 1P3FB 2YFVA 4ZBJB 3MNNA 3O62D 3LZ1C 3MVDD 5B0YB 1P3OB 3UTBA 3MGPA 3LELA 1U35B 3AZEA 2CV5C 3AZFA 1P3LC 4DRAA 4WU8B 4CSRB 3W96C 3TU4B 5CPJD 1P3IC 3VH6T 2PYOB 1TZYB 3B0DB 3REKC 1P3LA 3AZKC 4LD9B 5B1MB 5AY8D 3W96A 3WTPA 1P3IA 3X1SD 4J8UD 5GSUD 3MGRA 2FJ7D 1KX4A 5F99D 4H9QB 3AZKA 4Z5TC 3UT9D 4NE3A 5B40B 5CPIB 2F8NA 4J8WB 3MGPD 3W99C 4Z5TA 4XZQA 3LZ1D 5B31C 5CP6A 4J8VC 3AN2B 3A6NC 2CV5D 1P3LD 5B31A 4E45A 1KX3C 4WZSB 1BH8A 5AV8B 3W96D 4H9PA 3MGQC 1R4VA 3REKD 3O62B 5DNMD 1WWIA 3AZKD 1M19C 1KX3A 3W97C 1S32A 3LZ0B 3MGQA 3AV1C 1F66C 5AVCA 5BS7A 1KU5A 3VH5W 5JA4B 5GXQC 4Z5TD 3W97A 3X1TA 4Z66A 5B2IC 4QLCC 3W99D 4CAYA 5B31D 3AZNC 3AV2C 3KUYB 5CHLB 3X1VC 4J8VD 3LJAA 5F99B 3A6ND 5AV6D 3REIB 3KXBD 5GT3A 3W98B 3AV2A 3X1VA 3WA9B 1P3MB 3AZJB 3MGQD 5B24C 3AZLC 5B33B 3AZGB 1M19D 3W97D 5KDMB 1P3OA 1F66D 5GSUB 5B32B 3AV1D 1U35A 5B1LC 5GXQD 3AZMC 2RVQC 1P3BC 5BNXB 2IO5C 4WNNB 4G92B 4R8PC 5B1LA 5DNMB 3AZMA 1P3BA 5B2ID 4QLCD 3RELC 4ZUXC 5C3IC 5B1MA 3REJB 4XUJB 3AFAC 3AZND 1ZLAD 3AV2D 2NQBB 3UTAB 4R8PA 3X1VD 5GT0D 1AOIB 1KX5C 3RELA 4ZUXA 5BNVB 3AFAA 1P3AB 1P3KC 5B2JC 5DNNB 4WU9C 4UUZA 4J8XC 1KX5A 5B24D 2NZDC 3MGSD 2HUEC 1P3KA 1BH9A 3AZLD 4YM6B 5AV9B 5B2JA 1EQZC 5E5AC 4WU9A 4J8XA 3WAAB 2NZDA 5B1LD 5AV6B 3AZMD 3KXBB 1P3BD 1EQZA 3MNNC 3B6GB 5B0ZB 5AVBC 5CPKD 4R8PD 3RELD 4ZUXD 3LELC 3AZEC 2AROB 5AVBA 3AZFC 5B31G 4KGCC 3LZ0A 3R45A 5FUGB 4H9NB 4JJND 5JRGC 1P3KD 1M1AB 4KGCA 5B2JD 1N1JA 3WTPC 3AYWD 4J8XD 3VH5T 4DRBA 4QLCB 5JRGA 3MGRC 1M18B 1KX4C 1ZLAB 4E44A 1EQZD 5E5AD 5GT0B 3KWQC 3WKJB 1TAFB 2HIOC 4G91B 3MNND 3WA9A 5AVBD 1HTAA 3AZJA 4XZQC 3C1CC 3KWQA 4KUDA 4X23B 2BYMB 5CP6C 3MGSB 1HQ3B 2HIOA 3AZGA 3UTBD 4H9OB 3LELD 3AZED 5KDMA 3AZFD 1P3PA 3C1CA 4KGCD 5GSUA 5B32A 1WWSA 1P34C 3C1BB 4AWLC 3REHC 5CPKB 4YS3B 1P3GB 1Q9CA 5G49B 3WTPD 1P3ID 1S32C 1ID3B 1P34A 3MGRD 3REJA 5AVCC 5BS7C 4XUJA 1KX4D 3REHA 4NE5A 3MVDB 4M6BA 4H9RB 2CWEA 4JJNB 4Z66C 3X1TC 2HIOD 5BNVA 1P3AA 2F8ND 1H3OB 5DNNA 4KHAB 4XZQD 3AYWB 5CPJB 5CP6D 2BYKB 4EO5B 4YM6A 3LJAC 3AZIC 2YFWB 5E5AB 3B6FC 4HGAC 5AY8B 5GT3C 5AV5C 3X1UC 3X1SB 4J8UB 2FJ7B 3AZHC 3AZIA 1P34D 1P3FC 2YFVB 4ZBJC 3B6FA 3REHD 5AV5A 3UT9B 3X1UA 1KX3D 3AZHA 5B0YC 1P3OC 1S32D 3UTBB 3MGPB 1P3FA 1U35C 5AVCD 2AROA 3LZ1B 4J8XB 4WU8C 5B0YA 3V9RB 3TU4C 2L5AA 4Z2MH 3X1TD 2CV5B 4Z66D 3B0DC 2PYOC 1P3LB 4WU8A 4LD9C 5B1MC 4CSRA 3W96B 3TU4A 1P3IB 2PYOA 1TZYA 3REKB 4Z2MG 3LJAD 3AZKB 4LD9A 3B6FD 5GT3D 5AV5D 3WKJA 5B40C 5CPIC 3AZHD 4J8WC 4H9QA 1P3FD 4Z5TB 4X23A 5B40A 2BYMA 5CPIA 5B0YD 1P3OD 4J8WA 2F8NH 3AN2C 1U35D 3B0BA 3NQUB 3W99B 5B31B 4WU8D 3NQJB 1BH8B 5AV8C 4J8VB 3AN2A 5BT1C 3A6NB 2PYOD 4H9PB 2F8NG 3O62C 2RVQD 1KX3B 4LD9D 5B1MD 5AV8A 1ID3A 3LZ0C 3MGQB 3O62A 1M19B 3AFAD 3W97B 1F66B 3AV1B 4NFTA 5JA4A 4J8WD 5GXQB 1H3OA 1KX5D 5CPJA 3KUYC 2BYKA 4WV4B 5BO0B 4WU9D 3AN2D 5F99C 2NZDD 5B2IB 3REIC 5AY8A 3W98C 3AZNB 3AV2B 4J8UA 3KUYA 5AV8D 3X1VB 1P3MC 3WA9C 3AZJC 4KUDC 5F99A 3VH6A 3REIA 3W98A 3UT9A 5B33C 3AZGC 2F8NK 1A7WA 1P3PC 1P3MA 3LZ0D 5GSUC 5B32C 5B24B 5B33A 3LZ1A 3AZLB 3V9RA 4G92C 2CV5A 5B1LB 5DNMC 3AZMB 1P3BB 5BNXA 5JRGD 2IO5B 3REJC 4WNNA 4XUJC 1F1EA 2NQBC 3UTAC 3KUYD 4R8PB 3REKA 5DNMA 1AOIC 3RELB 4ZUXB 5C3IB 3REID 1P3AC 3AFAB 2NQBA 3W98D 3UTAA 3WA9D 1P3MD 5DNNC 3AZJD 4KUDD 1AOIA 3KWQD 4UUZB 1KX5B 1P3KB 1BH9B 5B33D 4YM6C 3AZGD 5AV9C 5B2JB 1P3PD 4WU9B 3C1CD 3WAAC 5B32D 2NZDB
chains in the Genus database with same CATH superfamily
3NQUA 3W99A 2HUEB 5AV6C 1JFIB 3KXBC 5AV9A 3NQJA 1EQZB 4J8VA 3IP4C 5B0ZC 3B6GC 3WAAA 3A6NA 2UWXA 5AV6A 3KXBA 3MNNB 3REJD 3B6GA 2AROC 4XUJD 5AVBB 5B0ZA 2NQBD 3UTAD 3R45B 3VH6W 1AOID 1M19A 3LELB 3AZEB 1P3AD 3AZFB 1M1AC 4KGCB 1F66A 3AV1A 5DNND 1N1JB 5GXQA 5FUGA 4H9NA 1TZYC 3KSYA 5JRGB 3WTPE 1M18C 4YM6D 1M1AA 1ZLAC 5AV9D 3B0CT 2RIQA 5BO0A 5GT0C 3WTPB 3WAAD 5B2IA 4QLCA 3WKJC 3MGRB 1M18A 1BFMA 2Y2MA 3AZID 3AZNA 1KX4B 1ZLAA 4G91C 3B6GD 5B0ZD 5GT0A 4KUDB 3X1UD 3KWQB 4X23C 1TAFA 3MGSC 2F8NB 1HQ3C 2HIOB 4NE6A 2AROD 1P3PB 4XZQB 2Y2IA 3C1CB 1B67A 5B24A 3MGSA 5CP6B 1HQ3A 3AZLA 4H9OA 3C1BC 1M1AD 5CPKC 1P3GC 4YS3C 3EPJA 2JSSA 1ULYA 3TU4D 1ID3C 1P34B 3C1BA 1TZYD 2ZM5A 1M18D 4AWLB 5CPKA 3REHB 4YS3A 1P3GA 2ZY3A 5G49A 3MVDC 1S32B 5B32G 3WKJD 4H9SC 4JJNC 5AVCB 3MVDA 2Y2OA 3AYWC 5CPJC 1B6WA 3B0CW 4H9RA 4H9SA 5B40D 4X23D 4JJNA 3X1TB 4Z66B 1HQ3D 4EO5C 5CPID 4KHAA 5AY8C 4CAYB 3AYWA 3X1SC 4J8UC 2FJ7C 1JFIA 2ZY5A 3LJAB 3AZIB 2YFWA 3C1BD 2LY8A 5E5AA 2Y2QA 3B6FB 4HGAB 4YS3D 5GT3B 5AV5B 3X1SA 3X1UB 3EPKA 3UT9C 1P3GD 2FJ7A 3AZHB 1ID3D 3VH5A 5BT1D 3UTBC 3MGPC 1P3FB 2YFVA 4ZBJB 3MNNA 3O62D 3LZ1C 3MVDD 5B0YB 1P3OB 3UTBA 3MGPA 3LELA 1U35B 3AZEA 2CV5C 3AZFA 1P3LC 4DRAA 3A1KA 4WU8B 4CSRB 3W96C 3TU4B 5CPJD 1P3IC 3VH6T 1Z2CB 2PYOB 1TZYB 3B0DB 3REKC 1P3LA 3AZKC 4LD9B 2J8PA 5B1MB 5AY8D 3W96A 3WTPA 1P3IA 3X1SD 4J8UD 5GSUD 3MGRA 2FJ7D 1KX4A 5F99D 4H9QB 3AZKA 4Z5TC 3UT9D 2Y2KA 4NE3A 5B40B 5CPIB 2F8NA 3H0MC 4J8WB 3MGPD 1PZRA 3W99C 4Z5TA 4XZQA 3LZ1D 5B31C 5CP6A 2JE5A 4J8VC 3AN2B 3A6NC 2CV5D 1P3LD 5B31A 4E45A 1KX3C 4WZSB 1BH8A 5AV8B 3W96D 2DQNC 3EG5B 4H9PA 3MGQC 1R4VA 3REKD 3O62B 5DNMD 1WWIA 3AZKD 1M19C 1KX3A 3W97C 1S32A 3LZ0B 3MGQA 3AV1C 1F66C 5AVCA 5BS7A 1KU5A 3VH5W 5JA4B 5GXQC 4Z5TD 3W97A 3X1TA 4Z66A 5B2IC 4QLCC 2VQRA 3W99D 4CAYA 5B31D 3AZNC 3AV2C 3KUYB 5CHLB 3X1VC 4J8VD 3LJAA 5F99B 3A6ND 5AV6D 3REIB 3KXBD 5GT3A 3W98B 3AV2A 3X1VA 3WA9B 1P3MB 2G5HC 3AZJB 2ZY4A 3MGQD 5B24C 1T3UA 3AZLC 5B33B 3AZGB 1M19D 3W97D 5KDMB 1P3OA 1F66D 5GSUB 5B32B 3AV1D 1U35A 5B1LC 5GXQD 3AZMC 2RVQC 1P3BC 5BNXB 2IO5C 4WNNB 4G92B 4R8PC 5B1LA 5DNMB 3AZMA 1P3BA 5B2ID 4QLCD 3RELC 4ZUXC 5C3IC 5B1MA 3REJB 4XUJB 3AFAC 3AZND 1ZLAD 3AV2D 2NQBB 3UTAB 4R8PA 3X1VD 5GT0D 2BG1A 1AOIB 1KX5C 3RELA 4ZUXA 5BNVB 3AFAA 1P3AB 1P3KC 5B2JC 5DNNB 4WU9C 4UUZA 4J8XC 1KX5A 5B24D 2NZDC 3MGSD 3KFUG 2HUEC 1P3KA 1BH9A 3AZLD 4YM6B 5AV9B 5B2JA 1EQZC 5E5AC 4WU9A 4J8XA 3WAAB 2NZDA 5B1LD 5AV6B 3AZMD 3KXBB 1P3BD 1EQZA 3MNNC 3B6GB 5B0ZB 5AVBC 5CPKD 3H0LC 4R8PD 3EPLA 3RELD 4ZUXD 3LELC 3AZEC 2AROB 2Y2LA 5AVBA 5B31G 3AZFC 4KGCC 3LZ0A 3R45A 5FUGB 4H9NB 4JJND 5JRGC 1P3KD 1M1AB 4KGCA 5B2JD 1N1JA 3WTPC 3AYWD 4J8XD 3VH5T 4DRBA 4QLCB 5JRGA 3MGRC 1M18B 1KX4C 1ZLAB 4E44A 1EQZD 5E5AD 5GT0B 3KWQC 3WKJB 1TAFB 2HIOC 4G91B 3MNND 2XD5A 3WA9A 5AVBD 1HTAA 3AZJA 4XZQC 3C1CC 3KWQA 4KUDA 4X23B 2BYMB 5CP6C 3MGSB 1HQ3B 2HIOA 3AZGA 3UTBD 4H9OB 3LELD 3AZED 5KDMA 3AZFD 1P3PA 3C1CA 4KGCD 3EPHA 5GSUA 5B32A 1WWSA 1P34C 3C1BB 4AWLC 3REHC 5CPKB 4YS3B 1P3GB 3P5JB 1Q9CA 5G49B 4UPKA 3WTPD 1P3ID 1S32C 1ID3B 2JCHA 1P34A 3MGRD 3REJA 5AVCC 5BS7C 2ZY2A 4XUJA 3REHA 1KX4D 4NE5A 3MVDB 4M6BA 4H9RB 2CWEA 4JJNB 4Z66C 3X1TC 2HIOD 5BNVA 1P3AA 2F8ND 1H3OB 2XD1A 5DNNA 4KHAB 4XZQD 3AYWB 5CPJB 5CP6D 2BYKB 4EO5B 4YM6A 3LJAC 3AZIC 2YFWB 5E5AB 3B6FC 5AY8B 4HGAC 5GT3C 5AV5C 3X1SB 3X1UC 3F6TA 4J8UB 2FJ7B 3AZHC 3AZIA 1P34D 1P3FC 2YFVB 4ZBJC 3B6FA 3REHD 5AV5A 3UT9B 3X1UA 1KX3D 3AZHA 5B0YC 1P3OC 1S32D 3UTBB 3MGPB 1P3FA 1U35C 5AVCD 2DF4C 2AROA 3LZ1B 4J8XB 4WU8C 5B0YA 3V9RB 3TU4C 2L5AA 4Z2MH 3X1TD 2CV5B 3B0DC 4Z66D 2PYOC 1P3LB 2Y2HA 4WU8A 4LD9C 5B1MC 4CSRA 3W96B 3TU4A 1P3IB 2PYOA 1TZYA 3REKB 4Z2MG 3LJAD 3AZKB 4LD9A 3B6FD 5GT3D 5AV5D 3WKJA 5B40C 5CPIC 3AZHD 4J8WC 4H9QA 1P3FD 4Z5TB 4X23A 5B40A 2BYMA 5CPIA 5B0YD 1P3OD 4J8WA 2F8NH 3AN2C 1U35D 3B0BA 3NQUB 3W99B 5B31B 4WU8D 3NQJB 1BH8B 5AV8C 4J8VB 3AN2A 5BT1C 3A6NB 2PYOD 4H9PB 2F8NG 3O62C 2RVQD 1KX3B 2Y2PA 4LD9D 5B1MD 5AV8A 1ID3A 3LZ0C 3FDDA 3MGQB 3O62A 2Y2GA 1M19B 4DQYB 3AFAD 3W97B 1F66B 3AV1B 4NFTA 5JA4A 4J8WD 5GXQB 1H3OA 1KX5D 2G5IC 3AL0C 4WJ3C 5CPJA 3KUYC 2BYKA 4WV4B 5BO0B 4WU9D 3AN2D 5F99C 2NZDD 5B2IB 3REIC 5AY8A 3W98C 3AZNB 3AV2B 4J8UA 3KUYA 5AV8D 3X1VB 1P3MC 3WA9C 3AZJC 4KUDC 5F99A 2Y2NA 3VH6A 3REIA 3W98A 3UT9A 5B33C 3AZGC 2F8NK 1A7WA 1P3PC 1P3MA 3H0RC 3LZ0D 5GSUC 5B32C 5B24B 1W2EA 2W8SA 5B33A 3LZ1A 3AZLB 3V9RA 4G92C 2CV5A 5B1LB 5DNMC 3AZMB 1P3BB 3A1IA 5BNXA 5JRGD 2Y2JA 2IO5B 3REJC 4WNNA 4XUJC 1F1EA 2NQBC 3UTAC 3KUYD 4R8PB 3REKA 5DNMA 1AOIC 2F2AC 3RELB 4ZUXB 5C3IB 3REID 1P3AC 3AFAB 2NQBA 3W98D 3UTAA 3WA9D 1P3MD 5DNNC 3AZJD 4KUDD 1AOIA 3KWQD 4UUZB 1KX5B 1P3KB 1BH9B 5B33D 4YM6C 3AZGD 5AV9C 5B2JB 1P3PD 4WU9B 2FFFB 3C1CD 3WAAC 5B32D 2NZDB
chains in the Genus database with same CATH topology
3NQUA 3W99A 2HUEB 5AV6C 1JFIB 3KXBC 5AV9A 3NQJA 1EQZB 4J8VA 3IP4C 5B0ZC 3B6GC 3WAAA 3A6NA 2UWXA 5AV6A 3KXBA 3MNNB 3REJD 3B6GA 2AROC 4XUJD 5AVBB 5B0ZA 2NQBD 3UTAD 3R45B 3VH6W 1AOID 1M19A 3LELB 3AZEB 1P3AD 3AZFB 1M1AC 4KGCB 1F66A 3AV1A 5DNND 1N1JB 5GXQA 5FUGA 4H9NA 1TZYC 3KSYA 5JRGB 3WTPE 1M18C 4YM6D 1M1AA 1ZLAC 5AV9D 3B0CT 2RIQA 5BO0A 5GT0C 3WTPB 3WAAD 5B2IA 4QLCA 3WKJC 3MGRB 1M18A 1BFMA 2Y2MA 3AZID 3AZNA 1KX4B 1ZLAA 4G91C 3B6GD 5B0ZD 5GT0A 4KUDB 3X1UD 3KWQB 4X23C 1TAFA 3MGSC 2F8NB 1HQ3C 2HIOB 4NE6A 2AROD 1P3PB 4XZQB 2Y2IA 3C1CB 1B67A 5B24A 3MGSA 5CP6B 1HQ3A 3AZLA 4H9OA 3C1BC 1M1AD 5CPKC 1P3GC 4YS3C 3EPJA 2JSSA 1ULYA 3TU4D 1ID3C 1P34B 3C1BA 1TZYD 2ZM5A 1M18D 4AWLB 5CPKA 3REHB 4YS3A 1P3GA 2ZY3A 5G49A 3MVDC 1S32B 5B32G 3WKJD 4H9SC 4JJNC 5AVCB 3MVDA 2Y2OA 3AYWC 5CPJC 1B6WA 3B0CW 4H9RA 4H9SA 5B40D 4X23D 4JJNA 3X1TB 4Z66B 1HQ3D 4EO5C 5CPID 4KHAA 5AY8C 4CAYB 3AYWA 3X1SC 4J8UC 2FJ7C 1JFIA 2ZY5A 3LJAB 3AZIB 2YFWA 3C1BD 2LY8A 5E5AA 2Y2QA 3B6FB 4HGAB 4YS3D 5GT3B 5AV5B 3X1SA 3X1UB 3EPKA 3UT9C 1P3GD 2FJ7A 3AZHB 1ID3D 3VH5A 5BT1D 3UTBC 3MGPC 1P3FB 2YFVA 4ZBJB 3MNNA 3O62D 3LZ1C 3MVDD 5B0YB 1P3OB 3UTBA 3MGPA 3LELA 1U35B 3AZEA 2CV5C 3AZFA 1P3LC 4DRAA 3A1KA 4WU8B 4CSRB 3W96C 3TU4B 5CPJD 1P3IC 3VH6T 1Z2CB 2PYOB 1TZYB 3B0DB 3REKC 1P3LA 3AZKC 4LD9B 2J8PA 5B1MB 5AY8D 3W96A 3WTPA 1P3IA 3X1SD 4J8UD 5GSUD 3MGRA 2FJ7D 1KX4A 5F99D 4H9QB 3AZKA 4Z5TC 3UT9D 2Y2KA 4NE3A 5B40B 5CPIB 2F8NA 3H0MC 4J8WB 3MGPD 1PZRA 3W99C 4Z5TA 4XZQA 3LZ1D 5B31C 5CP6A 2JE5A 4J8VC 3AN2B 3A6NC 2CV5D 1P3LD 5B31A 4E45A 1KX3C 4WZSB 1BH8A 5AV8B 3W96D 2DQNC 3EG5B 4H9PA 3MGQC 1R4VA 3REKD 3O62B 5DNMD 1WWIA 3AZKD 1M19C 1KX3A 3W97C 1S32A 3LZ0B 3MGQA 3AV1C 1F66C 5AVCA 5BS7A 1KU5A 3VH5W 5JA4B 5GXQC 4Z5TD 3W97A 3X1TA 4Z66A 5B2IC 4QLCC 2VQRA 3W99D 4CAYA 5B31D 3AZNC 3AV2C 3KUYB 5CHLB 3X1VC 4J8VD 3LJAA 5F99B 3A6ND 5AV6D 3REIB 3KXBD 5GT3A 3W98B 3AV2A 3X1VA 3WA9B 1P3MB 2G5HC 3AZJB 2ZY4A 3MGQD 5B24C 1T3UA 3AZLC 5B33B 3AZGB 1M19D 3W97D 5KDMB 1P3OA 1F66D 5GSUB 5B32B 3AV1D 1U35A 5B1LC 5GXQD 3AZMC 2RVQC 1P3BC 5BNXB 2IO5C 4WNNB 4G92B 4R8PC 5B1LA 5DNMB 3AZMA 1P3BA 5B2ID 4QLCD 3RELC 4ZUXC 5C3IC 5B1MA 3REJB 4XUJB 3AFAC 3AZND 1ZLAD 3AV2D 2NQBB 3UTAB 4R8PA 3X1VD 5GT0D 2BG1A 1AOIB 1KX5C 3RELA 4ZUXA 5BNVB 3AFAA 1P3AB 1P3KC 5B2JC 5DNNB 4WU9C 4UUZA 4J8XC 1KX5A 5B24D 2NZDC 3MGSD 3KFUG 2HUEC 1P3KA 1BH9A 3AZLD 4YM6B 5AV9B 5B2JA 1EQZC 5E5AC 4WU9A 4J8XA 3WAAB 2NZDA 5B1LD 5AV6B 3AZMD 3KXBB 1P3BD 1EQZA 3MNNC 3B6GB 5B0ZB 5AVBC 5CPKD 3H0LC 4R8PD 3EPLA 3RELD 4ZUXD 3LELC 3AZEC 2AROB 2Y2LA 5AVBA 5B31G 3AZFC 4KGCC 3LZ0A 3R45A 5FUGB 4H9NB 4JJND 5JRGC 1P3KD 1M1AB 4KGCA 5B2JD 1N1JA 3WTPC 3AYWD 4J8XD 3VH5T 4DRBA 4QLCB 5JRGA 3MGRC 1M18B 1KX4C 1ZLAB 4E44A 1EQZD 5E5AD 5GT0B 3KWQC 3WKJB 1TAFB 2HIOC 4G91B 3MNND 2XD5A 3WA9A 5AVBD 1HTAA 3AZJA 4XZQC 3C1CC 3KWQA 4KUDA 4X23B 2BYMB 5CP6C 3MGSB 1HQ3B 2HIOA 3AZGA 3UTBD 4H9OB 3LELD 3AZED 5KDMA 3AZFD 1P3PA 3C1CA 4KGCD 3EPHA 5GSUA 5B32A 1WWSA 1P34C 3C1BB 4AWLC 3REHC 5CPKB 4YS3B 1P3GB 3P5JB 1Q9CA 5G49B 4UPKA 3WTPD 1P3ID 1S32C 1ID3B 2JCHA 1P34A 3MGRD 3REJA 5AVCC 5BS7C 2ZY2A 4XUJA 3REHA 1KX4D 4NE5A 3MVDB 4M6BA 4H9RB 2CWEA 4JJNB 4Z66C 3X1TC 2HIOD 5BNVA 1P3AA 2F8ND 1H3OB 2XD1A 5DNNA 4KHAB 4XZQD 3AYWB 5CPJB 5CP6D 2BYKB 4EO5B 4YM6A 3LJAC 3AZIC 2YFWB 5E5AB 3B6FC 5AY8B 4HGAC 5GT3C 5AV5C 3X1SB 3X1UC 3F6TA 4J8UB 2FJ7B 3AZHC 3AZIA 1P34D 1P3FC 2YFVB 4ZBJC 3B6FA 3REHD 5AV5A 3UT9B 3X1UA 1KX3D 3AZHA 5B0YC 1P3OC 1S32D 3UTBB 3MGPB 1P3FA 1U35C 5AVCD 2DF4C 2AROA 3LZ1B 4J8XB 4WU8C 5B0YA 3V9RB 3TU4C 2L5AA 4Z2MH 3X1TD 2CV5B 3B0DC 4Z66D 2PYOC 1P3LB 2Y2HA 4WU8A 4LD9C 5B1MC 4CSRA 3W96B 3TU4A 1P3IB 2PYOA 1TZYA 3REKB 4Z2MG 3LJAD 3AZKB 4LD9A 3B6FD 5GT3D 5AV5D 3WKJA 5B40C 5CPIC 3AZHD 4J8WC 4H9QA 1P3FD 4Z5TB 4X23A 5B40A 2BYMA 5CPIA 5B0YD 1P3OD 4J8WA 2F8NH 3AN2C 1U35D 3B0BA 3NQUB 3W99B 5B31B 4WU8D 3NQJB 1BH8B 5AV8C 4J8VB 3AN2A 5BT1C 3A6NB 2PYOD 4H9PB 2F8NG 3O62C 2RVQD 1KX3B 2Y2PA 4LD9D 5B1MD 5AV8A 1ID3A 3LZ0C 3FDDA 3MGQB 3O62A 2Y2GA 1M19B 4DQYB 3AFAD 3W97B 1F66B 3AV1B 4NFTA 5JA4A 4J8WD 5GXQB 1H3OA 1KX5D 2G5IC 3AL0C 4WJ3C 5CPJA 3KUYC 2BYKA 4WV4B 5BO0B 4WU9D 3AN2D 5F99C 2NZDD 5B2IB 3REIC 5AY8A 3W98C 3AZNB 3AV2B 4J8UA 3KUYA 5AV8D 3X1VB 1P3MC 3WA9C 3AZJC 4KUDC 5F99A 2Y2NA 3VH6A 3REIA 3W98A 3UT9A 5B33C 3AZGC 2F8NK 1A7WA 1P3PC 1P3MA 3H0RC 3LZ0D 5GSUC 5B32C 5B24B 1W2EA 2W8SA 5B33A 3LZ1A 3AZLB 3V9RA 4G92C 2CV5A 5B1LB 5DNMC 3AZMB 1P3BB 3A1IA 5BNXA 5JRGD 2Y2JA 2IO5B 3REJC 4WNNA 4XUJC 1F1EA 2NQBC 3UTAC 3KUYD 4R8PB 3REKA 5DNMA 1AOIC 2F2AC 3RELB 4ZUXB 5C3IB 3REID 1P3AC 3AFAB 2NQBA 3W98D 3UTAA 3WA9D 1P3MD 5DNNC 3AZJD 4KUDD 1AOIA 3KWQD 4UUZB 1KX5B 1P3KB 1BH9B 5B33D 4YM6C 3AZGD 5AV9C 5B2JB 1P3PD 4WU9B 2FFFB 3C1CD 3WAAC 5B32D 2NZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  3W99 A;  2HUE B;  5AV6 C;  1JFI B;  3KXB C;  5AV9 A;  3NQJ A;  1EQZ B;  4J8V A;  3B6G C;  5B0Z C;  3WAA A;  3A6N A;  5AV6 A;  3KXB A;  3MNN B;  3REJ D;  3B6G A;  2ARO C;  4XUJ D;  5AVB B;  5B0Z A;  2NQB D;  3UTA D;  3R45 B;  3VH6 W;  1AOI D;  1M19 A;  3LEL B;  3AZE B;  1P3A D;  3AZF B;  1M1A C;  4KGC B;  1F66 A;  3AV1 A;  5DNN D;  1N1J B;  5GXQ A;  5FUG A;  4H9N A;  1TZY C;  3KSY A;  5JRG B;  3WTP E;  1M18 C;  4YM6 D;  1M1A A;  1ZLA C;  5AV9 D;  3B0C T;  5BO0 A;  5GT0 C;  3WTP B;  3WAA D;  5B2I A;  4QLC A;  3WKJ C;  3MGR B;  1M18 A;  1BFM A;  3AZI D;  1KX4 B;  3AZN A;  1ZLA A;  4G91 C;  3B6G D;  5B0Z D;  5GT0 A;  4KUD B;  3X1U D;  3KWQ B;  4X23 C;  1TAF A;  3MGS C;  2F8N B;  1HQ3 C;  2HIO B;  4NE6 A;  2ARO D;  1P3P B;  4XZQ B;  3C1C B;  1B67 A;  5B24 A;  3MGS A;  5CP6 B;  1HQ3 A;  3AZL A;  4H9O A;  3C1B C;  1M1A D;  5CPK C;  1P3G C;  4YS3 C;  2JSS A;  1ULY A;  3TU4 D;  1ID3 C;  1P34 B;  3C1B A;  1TZY D;  1M18 D;  4AWL B;  5CPK A;  3REH B;  4YS3 A;  1P3G A;  5G49 A;  3MVD C;  1S32 B;  5B32 G;  3WKJ D;  4H9S C;  4JJN C;  5AVC B;  3MVD A;  3AYW C;  5CPJ C;  1B6W A;  3B0C W;  4H9R A;  4H9S A;  5B40 D;  4X23 D;  4JJN A;  3X1T B;  4Z66 B;  1HQ3 D;  4EO5 C;  5CPI D;  4KHA A;  5AY8 C;  4CAY B;  3AYW A;  3X1S C;  4J8U C;  2FJ7 C;  1JFI A;  3LJA B;  3AZI B;  2YFW A;  3C1B D;  2LY8 A;  5E5A A;  3B6F B;  4HGA B;  4YS3 D;  5GT3 B;  5AV5 B;  3X1S A;  3X1U B;  3UT9 C;  1P3G D;  2FJ7 A;  3AZH B;  1ID3 D;  3VH5 A;  5BT1 D;  3UTB C;  3MGP C;  1P3F B;  2YFV A;  4ZBJ B;  3MNN A;  3O62 D;  3LZ1 C;  3MVD D;  5B0Y B;  1P3O B;  3UTB A;  3MGP A;  3LEL A;  1U35 B;  3AZE A;  2CV5 C;  3AZF A;  1P3L C;  4DRA A;  4WU8 B;  4CSR B;  3W96 C;  3TU4 B;  5CPJ D;  1P3I C;  3VH6 T;  2PYO B;  1TZY B;  3B0D B;  3REK C;  1P3L A;  3AZK C;  4LD9 B;  5B1M B;  5AY8 D;  3W96 A;  3WTP A;  1P3I A;  3X1S D;  4J8U D;  5GSU D;  3MGR A;  2FJ7 D;  1KX4 A;  5F99 D;  4H9Q B;  3AZK A;  4Z5T C;  3UT9 D;  4NE3 A;  5B40 B;  5CPI B;  2F8N A;  4J8W B;  3MGP D;  3W99 C;  4Z5T A;  4XZQ A;  3LZ1 D;  5B31 C;  5CP6 A;  4J8V C;  3AN2 B;  3A6N C;  2CV5 D;  1P3L D;  5B31 A;  4E45 A;  1KX3 C;  4WZS B;  1BH8 A;  5AV8 B;  3W96 D;  4H9P A;  3MGQ C;  1R4V A;  3REK D;  3O62 B;  5DNM D;  1WWI A;  3AZK D;  1M19 C;  1KX3 A;  3W97 C;  1S32 A;  3LZ0 B;  3MGQ A;  3AV1 C;  1F66 C;  5AVC A;  5BS7 A;  1KU5 A;  3VH5 W;  5JA4 B;  5GXQ C;  4Z5T D;  3W97 A;  3X1T A;  4Z66 A;  5B2I C;  4QLC C;  3W99 D;  4CAY A;  5B31 D;  3AZN C;  3AV2 C;  3KUY B;  5CHL B;  3X1V C;  4J8V D;  3LJA A;  5F99 B;  3A6N D;  5AV6 D;  3REI B;  3KXB D;  5GT3 A;  3W98 B;  3AV2 A;  3X1V A;  3WA9 B;  1P3M B;  3AZJ B;  3MGQ D;  5B24 C;  3AZL C;  5B33 B;  3AZG B;  1M19 D;  3W97 D;  5KDM B;  1P3O A;  1F66 D;  5GSU B;  5B32 B;  3AV1 D;  1U35 A;  5B1L C;  5GXQ D;  3AZM C;  2RVQ C;  1P3B C;  5BNX B;  2IO5 C;  4WNN B;  4G92 B;  4R8P C;  5B1L A;  5DNM B;  3AZM A;  1P3B A;  5B2I D;  4QLC D;  3REL C;  4ZUX C;  5C3I C;  5B1M A;  3REJ B;  4XUJ B;  3AFA C;  3AZN D;  1ZLA D;  3AV2 D;  2NQB B;  3UTA B;  4R8P A;  3X1V D;  5GT0 D;  1AOI B;  1KX5 C;  3REL A;  4ZUX A;  5BNV B;  3AFA A;  1P3A B;  1P3K C;  5B2J C;  5DNN B;  4WU9 C;  4UUZ A;  4J8X C;  1KX5 A;  5B24 D;  2NZD C;  3MGS D;  2HUE C;  1P3K A;  1BH9 A;  3AZL D;  4YM6 B;  5AV9 B;  5B2J A;  1EQZ C;  5E5A C;  4WU9 A;  4J8X A;  3WAA B;  2NZD A;  5B1L D;  5AV6 B;  3AZM D;  3KXB B;  1P3B D;  1EQZ A;  3MNN C;  3B6G B;  5B0Z B;  5AVB C;  5CPK D;  4R8P D;  3REL D;  4ZUX D;  3LEL C;  3AZE C;  2ARO B;  5AVB A;  3AZF C;  5B31 G;  4KGC C;  3LZ0 A;  3R45 A;  5FUG B;  4H9N B;  4JJN D;  5JRG C;  1P3K D;  1M1A B;  4KGC A;  5B2J D;  1N1J A;  3WTP C;  3AYW D;  4J8X D;  3VH5 T;  4DRB A;  4QLC B;  5JRG A;  3MGR C;  1M18 B;  1KX4 C;  1ZLA B;  4E44 A;  1EQZ D;  5E5A D;  5GT0 B;  3KWQ C;  3WKJ B;  1TAF B;  2HIO C;  4G91 B;  3MNN D;  3WA9 A;  5AVB D;  1HTA A;  3AZJ A;  4XZQ C;  3C1C C;  3KWQ A;  4KUD A;  4X23 B;  2BYM B;  5CP6 C;  3MGS B;  1HQ3 B;  2HIO A;  3AZG A;  3UTB D;  4H9O B;  3LEL D;  3AZE D;  5KDM A;  3AZF D;  1P3P A;  3C1C A;  4KGC D;  5GSU A;  5B32 A;  1WWS A;  1P34 C;  3C1B B;  4AWL C;  3REH C;  5CPK B;  4YS3 B;  1P3G B;  1Q9C A;  5G49 B;  3WTP D;  1P3I D;  1S32 C;  1ID3 B;  1P34 A;  3MGR D;  3REJ A;  5AVC C;  5BS7 C;  4XUJ A;  1KX4 D;  3REH A;  4NE5 A;  3MVD B;  4M6B A;  4H9R B;  2CWE A;  4JJN B;  4Z66 C;  3X1T C;  2HIO D;  5BNV A;  1P3A A;  2F8N D;  1H3O B;  5DNN A;  4KHA B;  4XZQ D;  3AYW B;  5CPJ B;  5CP6 D;  2BYK B;  4EO5 B;  4YM6 A;  3LJA C;  3AZI C;  2YFW B;  5E5A B;  3B6F C;  4HGA C;  5AY8 B;  5GT3 C;  5AV5 C;  3X1U C;  3X1S B;  4J8U B;  2FJ7 B;  3AZH C;  3AZI A;  1P34 D;  1P3F C;  2YFV B;  4ZBJ C;  3B6F A;  3REH D;  5AV5 A;  3UT9 B;  3X1U A;  1KX3 D;  3AZH A;  5B0Y C;  1P3O C;  1S32 D;  3UTB B;  3MGP B;  1P3F A;  1U35 C;  5AVC D;  2ARO A;  3LZ1 B;  4J8X B;  4WU8 C;  5B0Y A;  3V9R B;  3TU4 C;  2L5A A;  4Z2M H;  3X1T D;  2CV5 B;  4Z66 D;  3B0D C;  2PYO C;  1P3L B;  4WU8 A;  4LD9 C;  5B1M C;  4CSR A;  3W96 B;  3TU4 A;  1P3I B;  2PYO A;  1TZY A;  3REK B;  4Z2M G;  3LJA D;  3AZK B;  4LD9 A;  3B6F D;  5GT3 D;  5AV5 D;  3WKJ A;  5B40 C;  5CPI C;  3AZH D;  4J8W C;  4H9Q A;  1P3F D;  4Z5T B;  4X23 A;  5B40 A;  2BYM A;  5CPI A;  5B0Y D;  1P3O D;  4J8W A;  2F8N H;  3AN2 C;  1U35 D;  3B0B A;  3NQU B;  3W99 B;  5B31 B;  4WU8 D;  3NQJ B;  1BH8 B;  5AV8 C;  4J8V B;  3AN2 A;  5BT1 C;  3A6N B;  2PYO D;  4H9P B;  2F8N G;  3O62 C;  2RVQ D;  1KX3 B;  4LD9 D;  5B1M D;  5AV8 A;  1ID3 A;  3LZ0 C;  3MGQ B;  3O62 A;  1M19 B;  3AFA D;  3W97 B;  1F66 B;  3AV1 B;  4NFT A;  5JA4 A;  4J8W D;  5GXQ B;  1H3O A;  1KX5 D;  5CPJ A;  3KUY C;  2BYK A;  4WV4 B;  5BO0 B;  4WU9 D;  3AN2 D;  5F99 C;  2NZD D;  5B2I B;  3REI C;  5AY8 A;  3W98 C;  3AZN B;  3AV2 B;  4J8U A;  3KUY A;  5AV8 D;  3X1V B;  1P3M C;  3WA9 C;  3AZJ C;  4KUD C;  5F99 A;  3VH6 A;  3REI A;  3W98 A;  3UT9 A;  5B33 C;  3AZG C;  2F8N K;  1A7W A;  1P3P C;  1P3M A;  3LZ0 D;  5GSU C;  5B32 C;  5B24 B;  5B33 A;  3LZ1 A;  3AZL B;  3V9R A;  4G92 C;  2CV5 A;  5B1L B;  5DNM C;  3AZM B;  1P3B B;  5BNX A;  5JRG D;  2IO5 B;  3REJ C;  4WNN A;  4XUJ C;  1F1E A;  2NQB C;  3UTA C;  3KUY D;  4R8P B;  3REK A;  5DNM A;  1AOI C;  3REL B;  4ZUX B;  5C3I B;  3REI D;  1P3A C;  3AFA B;  2NQB A;  3W98 D;  3UTA A;  3WA9 D;  1P3M D;  5DNN C;  3AZJ D;  4KUD D;  1AOI A;  3KWQ D;  4UUZ B;  1KX5 B;  1P3K B;  1BH9 B;  5B33 D;  4YM6 C;  3AZG D;  5AV9 C;  5B2J B;  1P3P D;  4WU9 B;  3C1C D;  3WAA C;  5B32 D;  2NZD B; 
#chains in the Genus database with same CATH topology
 3NQU A;  3W99 A;  2HUE B;  5AV6 C;  1JFI B;  3KXB C;  5AV9 A;  3NQJ A;  1EQZ B;  4J8V A;  3IP4 C;  5B0Z C;  3B6G C;  3WAA A;  3A6N A;  2UWX A;  5AV6 A;  3KXB A;  3MNN B;  3REJ D;  3B6G A;  2ARO C;  4XUJ D;  5AVB B;  5B0Z A;  2NQB D;  3UTA D;  3R45 B;  3VH6 W;  1AOI D;  1M19 A;  3LEL B;  3AZE B;  1P3A D;  3AZF B;  1M1A C;  4KGC B;  1F66 A;  3AV1 A;  5DNN D;  1N1J B;  5GXQ A;  5FUG A;  4H9N A;  1TZY C;  3KSY A;  5JRG B;  3WTP E;  1M18 C;  4YM6 D;  1M1A A;  1ZLA C;  5AV9 D;  3B0C T;  2RIQ A;  5BO0 A;  5GT0 C;  3WTP B;  3WAA D;  5B2I A;  4QLC A;  3WKJ C;  3MGR B;  1M18 A;  1BFM A;  2Y2M A;  3AZI D;  3AZN A;  1KX4 B;  1ZLA A;  4G91 C;  3B6G D;  5B0Z D;  5GT0 A;  4KUD B;  3X1U D;  3KWQ B;  4X23 C;  1TAF A;  3MGS C;  2F8N B;  1HQ3 C;  2HIO B;  4NE6 A;  2ARO D;  1P3P B;  4XZQ B;  2Y2I A;  3C1C B;  1B67 A;  5B24 A;  3MGS A;  5CP6 B;  1HQ3 A;  3AZL A;  4H9O A;  3C1B C;  1M1A D;  5CPK C;  1P3G C;  4YS3 C;  3EPJ A;  2JSS A;  1ULY A;  3TU4 D;  1ID3 C;  1P34 B;  3C1B A;  1TZY D;  2ZM5 A;  1M18 D;  4AWL B;  5CPK A;  3REH B;  4YS3 A;  1P3G A;  2ZY3 A;  5G49 A;  3MVD C;  1S32 B;  5B32 G;  3WKJ D;  4H9S C;  4JJN C;  5AVC B;  3MVD A;  2Y2O A;  3AYW C;  5CPJ C;  1B6W A;  3B0C W;  4H9R A;  4H9S A;  5B40 D;  4X23 D;  4JJN A;  3X1T B;  4Z66 B;  1HQ3 D;  4EO5 C;  5CPI D;  4KHA A;  5AY8 C;  4CAY B;  3AYW A;  3X1S C;  4J8U C;  2FJ7 C;  1JFI A;  2ZY5 A;  3LJA B;  3AZI B;  2YFW A;  3C1B D;  2LY8 A;  5E5A A;  2Y2Q A;  3B6F B;  4HGA B;  4YS3 D;  5GT3 B;  5AV5 B;  3X1S A;  3X1U B;  3EPK A;  3UT9 C;  1P3G D;  2FJ7 A;  3AZH B;  1ID3 D;  3VH5 A;  5BT1 D;  3UTB C;  3MGP C;  1P3F B;  2YFV A;  4ZBJ B;  3MNN A;  3O62 D;  3LZ1 C;  3MVD D;  5B0Y B;  1P3O B;  3UTB A;  3MGP A;  3LEL A;  1U35 B;  3AZE A;  2CV5 C;  3AZF A;  1P3L C;  4DRA A;  3A1K A;  4WU8 B;  4CSR B;  3W96 C;  3TU4 B;  5CPJ D;  1P3I C;  3VH6 T;  1Z2C B;  2PYO B;  1TZY B;  3B0D B;  3REK C;  1P3L A;  3AZK C;  4LD9 B;  2J8P A;  5B1M B;  5AY8 D;  3W96 A;  3WTP A;  1P3I A;  3X1S D;  4J8U D;  5GSU D;  3MGR A;  2FJ7 D;  1KX4 A;  5F99 D;  4H9Q B;  3AZK A;  4Z5T C;  3UT9 D;  2Y2K A;  4NE3 A;  5B40 B;  5CPI B;  2F8N A;  3H0M C;  4J8W B;  3MGP D;  1PZR A;  3W99 C;  4Z5T A;  4XZQ A;  3LZ1 D;  5B31 C;  5CP6 A;  2JE5 A;  4J8V C;  3AN2 B;  3A6N C;  2CV5 D;  1P3L D;  5B31 A;  4E45 A;  1KX3 C;  4WZS B;  1BH8 A;  5AV8 B;  3W96 D;  2DQN C;  3EG5 B;  4H9P A;  3MGQ C;  1R4V A;  3REK D;  3O62 B;  5DNM D;  1WWI A;  3AZK D;  1M19 C;  1KX3 A;  3W97 C;  1S32 A;  3LZ0 B;  3MGQ A;  3AV1 C;  1F66 C;  5AVC A;  5BS7 A;  1KU5 A;  3VH5 W;  5JA4 B;  5GXQ C;  4Z5T D;  3W97 A;  3X1T A;  4Z66 A;  5B2I C;  4QLC C;  2VQR A;  3W99 D;  4CAY A;  5B31 D;  3AZN C;  3AV2 C;  3KUY B;  5CHL B;  3X1V C;  4J8V D;  3LJA A;  5F99 B;  3A6N D;  5AV6 D;  3REI B;  3KXB D;  5GT3 A;  3W98 B;  3AV2 A;  3X1V A;  3WA9 B;  1P3M B;  2G5H C;  3AZJ B;  2ZY4 A;  3MGQ D;  5B24 C;  1T3U A;  3AZL C;  5B33 B;  3AZG B;  1M19 D;  3W97 D;  5KDM B;  1P3O A;  1F66 D;  5GSU B;  5B32 B;  3AV1 D;  1U35 A;  5B1L C;  5GXQ D;  3AZM C;  2RVQ C;  1P3B C;  5BNX B;  2IO5 C;  4WNN B;  4G92 B;  4R8P C;  5B1L A;  5DNM B;  3AZM A;  1P3B A;  5B2I D;  4QLC D;  3REL C;  4ZUX C;  5C3I C;  5B1M A;  3REJ B;  4XUJ B;  3AFA C;  3AZN D;  1ZLA D;  3AV2 D;  2NQB B;  3UTA B;  4R8P A;  3X1V D;  5GT0 D;  2BG1 A;  1AOI B;  1KX5 C;  3REL A;  4ZUX A;  5BNV B;  3AFA A;  1P3A B;  1P3K C;  5B2J C;  5DNN B;  4WU9 C;  4UUZ A;  4J8X C;  1KX5 A;  5B24 D;  2NZD C;  3MGS D;  3KFU G;  2HUE C;  1P3K A;  1BH9 A;  3AZL D;  4YM6 B;  5AV9 B;  5B2J A;  1EQZ C;  5E5A C;  4WU9 A;  4J8X A;  3WAA B;  2NZD A;  5B1L D;  5AV6 B;  3AZM D;  3KXB B;  1P3B D;  1EQZ A;  3MNN C;  3B6G B;  5B0Z B;  5AVB C;  5CPK D;  3H0L C;  4R8P D;  3EPL A;  3REL D;  4ZUX D;  3LEL C;  3AZE C;  2ARO B;  2Y2L A;  5AVB A;  5B31 G;  3AZF C;  4KGC C;  3LZ0 A;  3R45 A;  5FUG B;  4H9N B;  4JJN D;  5JRG C;  1P3K D;  1M1A B;  4KGC A;  5B2J D;  1N1J A;  3WTP C;  3AYW D;  4J8X D;  3VH5 T;  4DRB A;  4QLC B;  5JRG A;  3MGR C;  1M18 B;  1KX4 C;  1ZLA B;  4E44 A;  1EQZ D;  5E5A D;  5GT0 B;  3KWQ C;  3WKJ B;  1TAF B;  2HIO C;  4G91 B;  3MNN D;  2XD5 A;  3WA9 A;  5AVB D;  1HTA A;  3AZJ A;  4XZQ C;  3C1C C;  3KWQ A;  4KUD A;  4X23 B;  2BYM B;  5CP6 C;  3MGS B;  1HQ3 B;  2HIO A;  3AZG A;  3UTB D;  4H9O B;  3LEL D;  3AZE D;  5KDM A;  3AZF D;  1P3P A;  3C1C A;  4KGC D;  3EPH A;  5GSU A;  5B32 A;  1WWS A;  1P34 C;  3C1B B;  4AWL C;  3REH C;  5CPK B;  4YS3 B;  1P3G B;  3P5J B;  1Q9C A;  5G49 B;  4UPK A;  3WTP D;  1P3I D;  1S32 C;  1ID3 B;  2JCH A;  1P34 A;  3MGR D;  3REJ A;  5AVC C;  5BS7 C;  2ZY2 A;  4XUJ A;  3REH A;  1KX4 D;  4NE5 A;  3MVD B;  4M6B A;  4H9R B;  2CWE A;  4JJN B;  4Z66 C;  3X1T C;  2HIO D;  5BNV A;  1P3A A;  2F8N D;  1H3O B;  2XD1 A;  5DNN A;  4KHA B;  4XZQ D;  3AYW B;  5CPJ B;  5CP6 D;  2BYK B;  4EO5 B;  4YM6 A;  3LJA C;  3AZI C;  2YFW B;  5E5A B;  3B6F C;  5AY8 B;  4HGA C;  5GT3 C;  5AV5 C;  3X1S B;  3X1U C;  3F6T A;  4J8U B;  2FJ7 B;  3AZH C;  3AZI A;  1P34 D;  1P3F C;  2YFV B;  4ZBJ C;  3B6F A;  3REH D;  5AV5 A;  3UT9 B;  3X1U A;  1KX3 D;  3AZH A;  5B0Y C;  1P3O C;  1S32 D;  3UTB B;  3MGP B;  1P3F A;  1U35 C;  5AVC D;  2DF4 C;  2ARO A;  3LZ1 B;  4J8X B;  4WU8 C;  5B0Y A;  3V9R B;  3TU4 C;  2L5A A;  4Z2M H;  3X1T D;  2CV5 B;  3B0D C;  4Z66 D;  2PYO C;  1P3L B;  2Y2H A;  4WU8 A;  4LD9 C;  5B1M C;  4CSR A;  3W96 B;  3TU4 A;  1P3I B;  2PYO A;  1TZY A;  3REK B;  4Z2M G;  3LJA D;  3AZK B;  4LD9 A;  3B6F D;  5GT3 D;  5AV5 D;  3WKJ A;  5B40 C;  5CPI C;  3AZH D;  4J8W C;  4H9Q A;  1P3F D;  4Z5T B;  4X23 A;  5B40 A;  2BYM A;  5CPI A;  5B0Y D;  1P3O D;  4J8W A;  2F8N H;  3AN2 C;  1U35 D;  3B0B A;  3NQU B;  3W99 B;  5B31 B;  4WU8 D;  3NQJ B;  1BH8 B;  5AV8 C;  4J8V B;  3AN2 A;  5BT1 C;  3A6N B;  2PYO D;  4H9P B;  2F8N G;  3O62 C;  2RVQ D;  1KX3 B;  2Y2P A;  4LD9 D;  5B1M D;  5AV8 A;  1ID3 A;  3LZ0 C;  3FDD A;  3MGQ B;  3O62 A;  2Y2G A;  1M19 B;  4DQY B;  3AFA D;  3W97 B;  1F66 B;  3AV1 B;  4NFT A;  5JA4 A;  4J8W D;  5GXQ B;  1H3O A;  1KX5 D;  2G5I C;  3AL0 C;  4WJ3 C;  5CPJ A;  3KUY C;  2BYK A;  4WV4 B;  5BO0 B;  4WU9 D;  3AN2 D;  5F99 C;  2NZD D;  5B2I B;  3REI C;  5AY8 A;  3W98 C;  3AZN B;  3AV2 B;  4J8U A;  3KUY A;  5AV8 D;  3X1V B;  1P3M C;  3WA9 C;  3AZJ C;  4KUD C;  5F99 A;  2Y2N A;  3VH6 A;  3REI A;  3W98 A;  3UT9 A;  5B33 C;  3AZG C;  2F8N K;  1A7W A;  1P3P C;  1P3M A;  3H0R C;  3LZ0 D;  5GSU C;  5B32 C;  5B24 B;  1W2E A;  2W8S A;  5B33 A;  3LZ1 A;  3AZL B;  3V9R A;  4G92 C;  2CV5 A;  5B1L B;  5DNM C;  3AZM B;  1P3B B;  3A1I A;  5BNX A;  5JRG D;  2Y2J A;  2IO5 B;  3REJ C;  4WNN A;  4XUJ C;  1F1E A;  2NQB C;  3UTA C;  3KUY D;  4R8P B;  3REK A;  5DNM A;  1AOI C;  2F2A C;  3REL B;  4ZUX B;  5C3I B;  3REI D;  1P3A C;  3AFA B;  2NQB A;  3W98 D;  3UTA A;  3WA9 D;  1P3M D;  5DNN C;  3AZJ D;  4KUD D;  1AOI A;  3KWQ D;  4UUZ B;  1KX5 B;  1P3K B;  1BH9 B;  5B33 D;  4YM6 C;  3AZG D;  5AV9 C;  5B2J B;  1P3P D;  4WU9 B;  2FFF B;  3C1C D;  3WAA C;  5B32 D;  2NZD B; 
#chains in the Genus database with same CATH homology
 3NQU A;  3W99 A;  2HUE B;  5AV6 C;  1JFI B;  3KXB C;  5AV9 A;  3NQJ A;  1EQZ B;  4J8V A;  3IP4 C;  5B0Z C;  3B6G C;  3WAA A;  3A6N A;  2UWX A;  5AV6 A;  3KXB A;  3MNN B;  3REJ D;  3B6G A;  2ARO C;  4XUJ D;  5AVB B;  5B0Z A;  2NQB D;  3UTA D;  3R45 B;  3VH6 W;  1AOI D;  1M19 A;  3LEL B;  3AZE B;  1P3A D;  3AZF B;  1M1A C;  4KGC B;  1F66 A;  3AV1 A;  5DNN D;  1N1J B;  5GXQ A;  5FUG A;  4H9N A;  1TZY C;  3KSY A;  5JRG B;  3WTP E;  1M18 C;  4YM6 D;  1M1A A;  1ZLA C;  5AV9 D;  3B0C T;  2RIQ A;  5BO0 A;  5GT0 C;  3WTP B;  3WAA D;  5B2I A;  4QLC A;  3WKJ C;  3MGR B;  1M18 A;  1BFM A;  2Y2M A;  3AZI D;  3AZN A;  1KX4 B;  1ZLA A;  4G91 C;  3B6G D;  5B0Z D;  5GT0 A;  4KUD B;  3X1U D;  3KWQ B;  4X23 C;  1TAF A;  3MGS C;  2F8N B;  1HQ3 C;  2HIO B;  4NE6 A;  2ARO D;  1P3P B;  4XZQ B;  2Y2I A;  3C1C B;  1B67 A;  5B24 A;  3MGS A;  5CP6 B;  1HQ3 A;  3AZL A;  4H9O A;  3C1B C;  1M1A D;  5CPK C;  1P3G C;  4YS3 C;  3EPJ A;  2JSS A;  1ULY A;  3TU4 D;  1ID3 C;  1P34 B;  3C1B A;  1TZY D;  2ZM5 A;  1M18 D;  4AWL B;  5CPK A;  3REH B;  4YS3 A;  1P3G A;  2ZY3 A;  5G49 A;  3MVD C;  1S32 B;  5B32 G;  3WKJ D;  4H9S C;  4JJN C;  5AVC B;  3MVD A;  2Y2O A;  3AYW C;  5CPJ C;  1B6W A;  3B0C W;  4H9R A;  4H9S A;  5B40 D;  4X23 D;  4JJN A;  3X1T B;  4Z66 B;  1HQ3 D;  4EO5 C;  5CPI D;  4KHA A;  5AY8 C;  4CAY B;  3AYW A;  3X1S C;  4J8U C;  2FJ7 C;  1JFI A;  2ZY5 A;  3LJA B;  3AZI B;  2YFW A;  3C1B D;  2LY8 A;  5E5A A;  2Y2Q A;  3B6F B;  4HGA B;  4YS3 D;  5GT3 B;  5AV5 B;  3X1S A;  3X1U B;  3EPK A;  3UT9 C;  1P3G D;  2FJ7 A;  3AZH B;  1ID3 D;  3VH5 A;  5BT1 D;  3UTB C;  3MGP C;  1P3F B;  2YFV A;  4ZBJ B;  3MNN A;  3O62 D;  3LZ1 C;  3MVD D;  5B0Y B;  1P3O B;  3UTB A;  3MGP A;  3LEL A;  1U35 B;  3AZE A;  2CV5 C;  3AZF A;  1P3L C;  4DRA A;  3A1K A;  4WU8 B;  4CSR B;  3W96 C;  3TU4 B;  5CPJ D;  1P3I C;  3VH6 T;  1Z2C B;  2PYO B;  1TZY B;  3B0D B;  3REK C;  1P3L A;  3AZK C;  4LD9 B;  2J8P A;  5B1M B;  5AY8 D;  3W96 A;  3WTP A;  1P3I A;  3X1S D;  4J8U D;  5GSU D;  3MGR A;  2FJ7 D;  1KX4 A;  5F99 D;  4H9Q B;  3AZK A;  4Z5T C;  3UT9 D;  2Y2K A;  4NE3 A;  5B40 B;  5CPI B;  2F8N A;  3H0M C;  4J8W B;  3MGP D;  1PZR A;  3W99 C;  4Z5T A;  4XZQ A;  3LZ1 D;  5B31 C;  5CP6 A;  2JE5 A;  4J8V C;  3AN2 B;  3A6N C;  2CV5 D;  1P3L D;  5B31 A;  4E45 A;  1KX3 C;  4WZS B;  1BH8 A;  5AV8 B;  3W96 D;  2DQN C;  3EG5 B;  4H9P A;  3MGQ C;  1R4V A;  3REK D;  3O62 B;  5DNM D;  1WWI A;  3AZK D;  1M19 C;  1KX3 A;  3W97 C;  1S32 A;  3LZ0 B;  3MGQ A;  3AV1 C;  1F66 C;  5AVC A;  5BS7 A;  1KU5 A;  3VH5 W;  5JA4 B;  5GXQ C;  4Z5T D;  3W97 A;  3X1T A;  4Z66 A;  5B2I C;  4QLC C;  2VQR A;  3W99 D;  4CAY A;  5B31 D;  3AZN C;  3AV2 C;  3KUY B;  5CHL B;  3X1V C;  4J8V D;  3LJA A;  5F99 B;  3A6N D;  5AV6 D;  3REI B;  3KXB D;  5GT3 A;  3W98 B;  3AV2 A;  3X1V A;  3WA9 B;  1P3M B;  2G5H C;  3AZJ B;  2ZY4 A;  3MGQ D;  5B24 C;  1T3U A;  3AZL C;  5B33 B;  3AZG B;  1M19 D;  3W97 D;  5KDM B;  1P3O A;  1F66 D;  5GSU B;  5B32 B;  3AV1 D;  1U35 A;  5B1L C;  5GXQ D;  3AZM C;  2RVQ C;  1P3B C;  5BNX B;  2IO5 C;  4WNN B;  4G92 B;  4R8P C;  5B1L A;  5DNM B;  3AZM A;  1P3B A;  5B2I D;  4QLC D;  3REL C;  4ZUX C;  5C3I C;  5B1M A;  3REJ B;  4XUJ B;  3AFA C;  3AZN D;  1ZLA D;  3AV2 D;  2NQB B;  3UTA B;  4R8P A;  3X1V D;  5GT0 D;  2BG1 A;  1AOI B;  1KX5 C;  3REL A;  4ZUX A;  5BNV B;  3AFA A;  1P3A B;  1P3K C;  5B2J C;  5DNN B;  4WU9 C;  4UUZ A;  4J8X C;  1KX5 A;  5B24 D;  2NZD C;  3MGS D;  3KFU G;  2HUE C;  1P3K A;  1BH9 A;  3AZL D;  4YM6 B;  5AV9 B;  5B2J A;  1EQZ C;  5E5A C;  4WU9 A;  4J8X A;  3WAA B;  2NZD A;  5B1L D;  5AV6 B;  3AZM D;  3KXB B;  1P3B D;  1EQZ A;  3MNN C;  3B6G B;  5B0Z B;  5AVB C;  5CPK D;  3H0L C;  4R8P D;  3EPL A;  3REL D;  4ZUX D;  3LEL C;  3AZE C;  2ARO B;  2Y2L A;  5AVB A;  5B31 G;  3AZF C;  4KGC C;  3LZ0 A;  3R45 A;  5FUG B;  4H9N B;  4JJN D;  5JRG C;  1P3K D;  1M1A B;  4KGC A;  5B2J D;  1N1J A;  3WTP C;  3AYW D;  4J8X D;  3VH5 T;  4DRB A;  4QLC B;  5JRG A;  3MGR C;  1M18 B;  1KX4 C;  1ZLA B;  4E44 A;  1EQZ D;  5E5A D;  5GT0 B;  3KWQ C;  3WKJ B;  1TAF B;  2HIO C;  4G91 B;  3MNN D;  2XD5 A;  3WA9 A;  5AVB D;  1HTA A;  3AZJ A;  4XZQ C;  3C1C C;  3KWQ A;  4KUD A;  4X23 B;  2BYM B;  5CP6 C;  3MGS B;  1HQ3 B;  2HIO A;  3AZG A;  3UTB D;  4H9O B;  3LEL D;  3AZE D;  5KDM A;  3AZF D;  1P3P A;  3C1C A;  4KGC D;  3EPH A;  5GSU A;  5B32 A;  1WWS A;  1P34 C;  3C1B B;  4AWL C;  3REH C;  5CPK B;  4YS3 B;  1P3G B;  3P5J B;  1Q9C A;  5G49 B;  4UPK A;  3WTP D;  1P3I D;  1S32 C;  1ID3 B;  2JCH A;  1P34 A;  3MGR D;  3REJ A;  5AVC C;  5BS7 C;  2ZY2 A;  4XUJ A;  3REH A;  1KX4 D;  4NE5 A;  3MVD B;  4M6B A;  4H9R B;  2CWE A;  4JJN B;  4Z66 C;  3X1T C;  2HIO D;  5BNV A;  1P3A A;  2F8N D;  1H3O B;  2XD1 A;  5DNN A;  4KHA B;  4XZQ D;  3AYW B;  5CPJ B;  5CP6 D;  2BYK B;  4EO5 B;  4YM6 A;  3LJA C;  3AZI C;  2YFW B;  5E5A B;  3B6F C;  5AY8 B;  4HGA C;  5GT3 C;  5AV5 C;  3X1S B;  3X1U C;  3F6T A;  4J8U B;  2FJ7 B;  3AZH C;  3AZI A;  1P34 D;  1P3F C;  2YFV B;  4ZBJ C;  3B6F A;  3REH D;  5AV5 A;  3UT9 B;  3X1U A;  1KX3 D;  3AZH A;  5B0Y C;  1P3O C;  1S32 D;  3UTB B;  3MGP B;  1P3F A;  1U35 C;  5AVC D;  2DF4 C;  2ARO A;  3LZ1 B;  4J8X B;  4WU8 C;  5B0Y A;  3V9R B;  3TU4 C;  2L5A A;  4Z2M H;  3X1T D;  2CV5 B;  3B0D C;  4Z66 D;  2PYO C;  1P3L B;  2Y2H A;  4WU8 A;  4LD9 C;  5B1M C;  4CSR A;  3W96 B;  3TU4 A;  1P3I B;  2PYO A;  1TZY A;  3REK B;  4Z2M G;  3LJA D;  3AZK B;  4LD9 A;  3B6F D;  5GT3 D;  5AV5 D;  3WKJ A;  5B40 C;  5CPI C;  3AZH D;  4J8W C;  4H9Q A;  1P3F D;  4Z5T B;  4X23 A;  5B40 A;  2BYM A;  5CPI A;  5B0Y D;  1P3O D;  4J8W A;  2F8N H;  3AN2 C;  1U35 D;  3B0B A;  3NQU B;  3W99 B;  5B31 B;  4WU8 D;  3NQJ B;  1BH8 B;  5AV8 C;  4J8V B;  3AN2 A;  5BT1 C;  3A6N B;  2PYO D;  4H9P B;  2F8N G;  3O62 C;  2RVQ D;  1KX3 B;  2Y2P A;  4LD9 D;  5B1M D;  5AV8 A;  1ID3 A;  3LZ0 C;  3FDD A;  3MGQ B;  3O62 A;  2Y2G A;  1M19 B;  4DQY B;  3AFA D;  3W97 B;  1F66 B;  3AV1 B;  4NFT A;  5JA4 A;  4J8W D;  5GXQ B;  1H3O A;  1KX5 D;  2G5I C;  3AL0 C;  4WJ3 C;  5CPJ A;  3KUY C;  2BYK A;  4WV4 B;  5BO0 B;  4WU9 D;  3AN2 D;  5F99 C;  2NZD D;  5B2I B;  3REI C;  5AY8 A;  3W98 C;  3AZN B;  3AV2 B;  4J8U A;  3KUY A;  5AV8 D;  3X1V B;  1P3M C;  3WA9 C;  3AZJ C;  4KUD C;  5F99 A;  2Y2N A;  3VH6 A;  3REI A;  3W98 A;  3UT9 A;  5B33 C;  3AZG C;  2F8N K;  1A7W A;  1P3P C;  1P3M A;  3H0R C;  3LZ0 D;  5GSU C;  5B32 C;  5B24 B;  1W2E A;  2W8S A;  5B33 A;  3LZ1 A;  3AZL B;  3V9R A;  4G92 C;  2CV5 A;  5B1L B;  5DNM C;  3AZM B;  1P3B B;  3A1I A;  5BNX A;  5JRG D;  2Y2J A;  2IO5 B;  3REJ C;  4WNN A;  4XUJ C;  1F1E A;  2NQB C;  3UTA C;  3KUY D;  4R8P B;  3REK A;  5DNM A;  1AOI C;  2F2A C;  3REL B;  4ZUX B;  5C3I B;  3REI D;  1P3A C;  3AFA B;  2NQB A;  3W98 D;  3UTA A;  3WA9 D;  1P3M D;  5DNN C;  3AZJ D;  4KUD D;  1AOI A;  3KWQ D;  4UUZ B;  1KX5 B;  1P3K B;  1BH9 B;  5B33 D;  4YM6 C;  3AZG D;  5AV9 C;  5B2J B;  1P3P D;  4WU9 B;  2FFF B;  3C1C D;  3WAA C;  5B32 D;  2NZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...