5DNNB

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnB00
5B1LA 1P3FA 4QLCD 3W98D 1P3MA 5AV9D 3X1TA 2NQBB 5AVCD 1M1AA 3REKA 2CV5B 4YM6C 4M6BA 2YFVA 4YS3B 1KU5A 1P34B 4X23B 4QLCC 3W98C 5AV9C 4CSRB 4J8VD 3WAAB 5AVCC 1P3KA 3O62A 4J8WB 3LJAC 5AV6D 1U35A 4J8UA 5AV5A 4R8PA 4LD9D 3AFAA 3C1BB 2BYMA 5GT0A 4J8VC 3MGQA 4KUDB 5JRGD 3AZFB 5GXQB 1BH8B 4HGAB 1P3LA 4G92B 3AZEA 5AV6C 2NZDB 3TU4B 4LD9C 3B6GD 4WU9D 3UT9B 2AROD 1M18D 2HIOA 3MGSA 5BO0B 2PYOD 1P3BA 1P3PD 3B6GC 3AZJB 4WU9C 3V9RB 5CPKA 1AOIB 3WTPE 3WKJA 4XUJA 2AROC 1M18C 4Z66D 3AZHA 3RELB 1P3PC 1KX5A 5B2JB 1M19B 3AV2A 3AZKA 4H9PB 4KHAB 4Z66C 5B32D 4NE6A 3WTPD 5AY8D 3AYWB 3LZ1D 4YM6A 1ZLAD 5CPJB 4QLCA 5B32C 5AV9A 1P3ID 3WTPC 3W99D 5GSUA 5B1LD 5AY8C 1KX4B 1P3FD 3LZ1C 3X1SD 4XZQD 1P3GB 3B0DC 1P3OB 3REKD 1F66B 1ZLAC 2HUEC 3REID 4UUZA 2F8NB 1P3IC 3W99C 4J8VA 1HQ3D 5B1LC 1P3FC 5CPID 4AWLC 3X1SC 4XZQC 4WU8B 4H9RB 3AV1B 5C3IB 5AV6A 3REKC 4Z5TD 5AVBD 3REIC 5B0YB 5B33B 1HQ3C 5JRGA 1H3OA 3NQJA 5CPIC 4E44A 4H9OB 2F8NG 4Z5TC 3B0CW 5AVBC 3X1TB 4WU9A 1M1AB 5FUGA 3KUYD 4R8PC 5B1MD 2AROA 5B24B 4E45A 2PYOA 3MNND 1KX3B 5B31B 3KUYC 1P3BD 5B1MC 3VH6T 5DNMB 1U35B 4Z66A 4NE5A 5AV5B 3LZ0A 4J8UB 3AFAB 3X1VB 3MNNC 3AN2D 5GT0B 3VH5A 1P3AB 5BNXA 1P3BC 3AZEB 3R45B 1WWIA 2IO5B 3AN2C 3REHD 5B31G 3W96A 3AZLD 5DNND 3MGSB 4ZBJB 3VH5W 3MGPB 3REJB 3LELB 3REHC 3W99A 4XUJB 3AZLC 4H9SA 5B0ZB 4J8XD 3X1SA 4XZQA 5DNNC 5GSUD 3AZHB 3REIA 2CV5D 3AV2B 4YS3D 1HQ3A 4X23D 5CPIA 4J8XC 5KDMA 5GSUC 3UTBA 3WA9B 4J8WD 4Z5TA 5AVBA 1EQZB 4YS3C 4X23C 4QLCB 3W98B 4J8WC 1S32B 1BH9A 5AV8A 3AZMA 3W97B 5AVCB 3KUYA 5B1MA 3LJAB 1ID3D 5F99D 4UUZB 5JRGC 3MNNA 4HGAC 1B6WA 5JA4B 4DRBA 4KGCB 4NE3A 4H9QA 2F8NH 3KXBD 3AZJD 1ID3C 5AV6B 5B40D 5F99C 4LD9B 3MGRB 3B6FD 5B2IA 3AN2A 4WNNA 3LZ0D 2PYOC 3KXBC 3A6NA 3AZJC 3UTAB 5B40C 4JJNB 5CP6D 3MVDA 3AZNA 3B6GB 3B6FC 3REHA 1Q9CA 3NQUA 3B0BA 3LZ0C 1M18B 2AROB 3AZGA 3AZLA 5DNNA 1TAFA 3W96D 5CP6C 5G49B 1P3PB 3X1UD 5CPJD 4ZUXB 4J8XA 4Z66B 4H9NA 3W96C 2CV5A 2YFWB 3X1UC 4YS3A 2BYKB 5CPJC 4X23A 4EO5B 2F8ND 1F1EA 1A7WA 5B32B 4J8WA 4H9SC 3WTPB 3AV1D 4WU8D 5AY8B 3C1CB 3UTBD 3LZ1B 4WZSB 1N1JB 1ZLAB 2HUEB 3AZFA 1JFIB 5GXQA 3AZID 2LY8A 1BH8A 1P3IB 1B67A 3AV1C 2RVQD 5B1LB 5C3IC 4WU8C 1P3FB 3UTBC 1P3MB 4AWLB 3X1SB 1ID3A 5AV8D 5BNVA 3AZMD 5F99A 3REKB 3UT9A 4CAYA 5B24D 3AZIC 2YFVB 2RVQC 1HQ3B 1KX3D 3KXBA 3AZJA 5AV8C 3AZMC 5B40A 1P3KB 5B31D 3O62B 5AVBB 3B6FA 5CHLB 5BT1D 5B24C 1TZYD 3KWQD 4R8PB 3VH6A 5GT3D 3X1VD 3RELA 4G91B 5B2ID 1KX3C 2FJ7D 2BYMB 3MGQB 5CP6A 5B31C 1P3AD 1BH9B 4KHAA 1P3LB 5BT1C 3A6ND 1TZYC 3KWQC 3MVDD 3AZND 5GT3C 3X1VC 5E5AD 5B2IC 2FJ7C 5BS7A 4NFTA 3VH6W 2JSSA 3MNNB 3AZGD 2F8NK 2HIOB 1P3AC 3A6NC 3X1UA 3MVDC 3AZNC 5CPJA 1P3BB 3LELD 2IO5C 5E5AC 5CPKB 3WKJB 3AZGC 3AN2B 2NQBD 1KX5B 3LELC 2F8NA 3AZKB 1P34D 4Z2MG 1WWSA 3REHB 4WU8A 4H9RA 3AV1A 2NQBC 3WAAD 3WA9D 5DNNB 1EQZD 1TAFB 2CV5C 5B33A 1P34C 2L5AA 4YM6B 3C1BD 3AZIA 3WAAC 4H9OA 4KUDD 5AV9B 4J8XB 3AZFD 5GXQD 1S32D 3WA9C 4H9NB 1EQZC 5GSUB 3W97D 2NZDD 3LJAD 3TU4D 5B24A 3C1BC 3UT9D 1KX3A 3AZFC 4KUDC 5GXQC 1S32C 4J8VB 4G92C 3W97C 5B31A 4KGCD 2NZDC 3TU4C 5DNMA 1TZYA 3KWQA 1AOID 3MGRD 5GT3A 3X1VA 3UT9C 2FJ7A 5JRGB 1H3OB 3NQJB 3RELD 1P3AA 4KGCC 5B2JD 3UTAD 1M19D 4JJND 1AOIC 3R45A 3MGRC 1ID3B 4WU9B 5BNVB 5E5AA 5F99B 5FUGB 4CAYB 3RELC 5B2JC 3UTAC 1M19C 3MGPA 4JJNC 3REJA 3AYWD 2PYOB 3KXBB 3LELA 5B40B 1ULYA 3B6FB 4ZUXD 2CWEA 5B0ZA 5BS7C 3LZ0B 2NQBA 1KX4D 3AYWC 1P3GD 5CP6B 1P3OD 1P34A 1F66D 5BNXB 4ZUXC 4CSRA 3WAAA 1KX4C 3WA9A 1EQZA 1P3GC 3C1CD 3W96B 1P3OC 1F66C 3B0DB 4EO5C 3C1BA 5B0YD 3X1UB 5B33D 3W98A 4KUDA 4DRAA 4Z2MH 3KSYA 1S32A 3W99B 3W97A 5AVCA 3C1CC 1P3MD 2NZDA 3LJAA 3TU4A 1R4VA 4XZQB 3X1TD 5B0YC 1M1AD 5B32G 5B33C 4WV4B 3REIB 3B0CT 5BO0A 1HTAA 5JA4A 5CPIB 1P3MC 4KGCA 3X1TC 3V9RA 5KDMB 3UTBB 1M1AC 1AOIA 1P3KD 4LD9A 3O62D 3MGRA 4Z5TB 5DNMD 1U35D 4J8UD 5AV5D 4R8PD 3AFAD 3AZIB 5B2JA 5GT0D 3UTAA 3MGQD 1M19A 4JJNA 1P3KC 3O62C 4H9PA 3B6GA 1P3LD 5AV8B 5DNMC 3AZMB 3AZED 1U35C 3KUYB 4J8UC 5AV5C 5B1MB 1M18A 3AFAC 4G91C 5GT0C 3MGQC 3AYWA 5G49A 1P3PA 2HIOD 3MGSD 1P3LC 3AZEC 3MGPD 3REJD 4H9QB 4ZUXA 1TZYB 3KWQB 5CPKD 3VH5T 5GT3B 1KX4A 3WKJD 4XUJD 5B2IB 5B0ZD 2HIOC 2FJ7B 3MGSC 4WNNB 1P3GA 2YFWA 4ZBJC 1P3OA 3MGPC 3REJC 3AZHD 2BYKA 1F66A 1KX5D 3A6NB 3AV2D 1BFMA 3AZKD 5CPKC 3MVDB 3AZNB 5B32A 3WKJC 5E5AB 4XUJC 5B0ZC 3WTPA 5AY8A 3NQUB 3C1CA 3LZ1A 3AZLB 3AZGB 3AZHC 1N1JA 1KX5C 5B0YA 3AV2C 3AZKC 1ZLAA 1JFIA 4YM6D 1P3IA
chains in the Genus database with same CATH superfamily
5B1LA 1P3FA 4QLCD 3W98D 3F6TA 5AV9D 1P3MA 3X1TA 2NQBB 5AVCD 1M1AA 3REKA 2CV5B 4YM6C 4M6BA 2YFVA 4YS3B 1KU5A 1P34B 4X23B 4QLCC 3W98C 5AV9C 3KFUG 4CSRB 4J8VD 3WAAB 3IP4C 5AVCC 1P3KA 3O62A 4J8WB 3LJAC 5AV6D 1U35A 4J8UA 5AV5A 4R8PA 4LD9D 3AFAA 3C1BB 3EPJA 2BYMA 5GT0A 4J8VC 3MGQA 4KUDB 5JRGD 3AZFB 5GXQB 1BH8B 4HGAB 1P3LA 4G92B 3AZEA 5AV6C 2NZDB 3TU4B 4LD9C 3B6GD 4WU9D 3UT9B 2AROD 1M18D 2HIOA 3MGSA 5BO0B 2PYOD 1P3BA 1P3PD 3B6GC 3AZJB 4WU9C 3V9RB 5CPKA 1AOIB 2DQNC 3WTPE 3WKJA 4XUJA 2AROC 1M18C 2ZM5A 4Z66D 3AZHA 3RELB 1P3PC 1KX5A 5B2JB 1M19B 3AV2A 3AZKA 4H9PB 4KHAB 4Z66C 5B32D 1T3UA 4NE6A 3WTPD 5AY8D 3AYWB 3LZ1D 4YM6A 1ZLAD 5CPJB 4QLCA 5B32C 5AV9A 1P3ID 3WTPC 3W99D 5GSUA 5B1LD 5AY8C 1KX4B 1P3FD 3LZ1C 3P5JB 3X1SD 4XZQD 1P3GB 2FFFB 3B0DC 1P3OB 3REKD 1F66B 1ZLAC 2HUEC 3REID 4UUZA 2F8NB 1P3IC 3W99C 4J8VA 1HQ3D 5B1LC 1P3FC 5CPID 3H0MC 4AWLC 3X1SC 4XZQC 4WU8B 4H9RB 3AV1B 5C3IB 5AV6A 3REKC 2RIQA 4Z5TD 5AVBD 3REIC 5B0YB 5B33B 1HQ3C 5JRGA 1H3OA 2G5IC 3NQJA 5CPIC 4E44A 4H9OB 2F8NG 4Z5TC 3B0CW 5AVBC 3X1TB 4WU9A 1M1AB 5FUGA 3KUYD 2J8PA 4R8PC 5B1MD 2AROA 5B24B 4E45A 2PYOA 2Y2IA 3MNND 1KX3B 5B31B 3KUYC 1P3BD 5B1MC 3VH6T 5DNMB 1U35B 4Z66A 4NE5A 5AV5B 3LZ0A 4J8UB 3AFAB 3X1VB 3MNNC 3AN2D 5GT0B 3VH5A 2XD1A 3A1KA 1P3AB 5BNXA 1P3BC 3AZEB 3R45B 1WWIA 2IO5B 3AN2C 3REHD 5B31G 3W96A 3AZLD 5DNND 3MGSB 4ZBJB 3VH5W 3MGPB 3REJB 3LELB 3REHC 3W99A 4XUJB 2F2AC 4H9SA 5B0ZB 4J8XD 3AZLC 3X1SA 4XZQA 5DNNC 5GSUD 3AZHB 3REIA 2CV5D 3AV2B 4YS3D 1HQ3A 4X23D 5CPIA 4J8XC 5KDMA 5GSUC 3UTBA 3WA9B 4J8WD 4Z5TA 5AVBA 1EQZB 4YS3C 4X23C 4QLCB 3W98B 4J8WC 1S32B 1BH9A 5AV8A 3AZMA 3W97B 5AVCB 3KUYA 5B1MA 3LJAB 1ID3D 5F99D 3H0LC 4UUZB 5JRGC 3MNNA 4HGAC 1B6WA 2JE5A 4DRBA 5JA4B 4NE3A 4H9QA 2F8NH 3KXBD 4KGCB 3AZJD 1ID3C 5AV6B 5B40D 5F99C 4LD9B 3MGRB 3B6FD 5B2IA 3AN2A 4WNNA 3LZ0D 2PYOC 3KXBC 3A6NA 3AZJC 2Y2HA 3UTAB 5B40C 4JJNB 5CP6D 3MVDA 3AZNA 3B6GB 3B6FC 3REHA 1Q9CA 3NQUA 3B0BA 3LZ0C 1M18B 2AROB 3AZGA 3AZLA 5DNNA 3FDDA 1TAFA 3W96D 5CP6C 5G49B 1P3PB 3X1UD 5CPJD 3EPKA 4ZUXB 4J8XA 4Z66B 4H9NA 3W96C 2CV5A 2YFWB 3X1UC 4YS3A 3AL0C 2BYKB 5CPJC 4X23A 4EO5B 2F8ND 1F1EA 1A7WA 5B32B 4J8WA 4H9SC 3WTPB 3AV1D 4WU8D 5AY8B 3C1CB 3UTBD 3LZ1B 4WZSB 1N1JB 1ZLAB 2HUEB 3AZFA 1JFIB 5GXQA 3AZID 2LY8A 1BH8A 1P3IB 1B67A 3AV1C 2RVQD 5B1LB 5C3IC 4WU8C 2Y2JA 1P3FB 3UTBC 1P3MB 4AWLB 3X1SB 1ID3A 5AV8D 5BNVA 3AZMD 2ZY4A 5F99A 3REKB 3UT9A 4CAYA 5B24D 3AZIC 2YFVB 2RVQC 1HQ3B 1KX3D 3KXBA 3AZJA 5AV8C 3AZMC 5B40A 1P3KB 5B31D 3O62B 5AVBB 3B6FA 5CHLB 5BT1D 5B24C 1TZYD 3KWQD 2ZY3A 4R8PB 3VH6A 5GT3D 3X1VD 3RELA 4G91B 5B2ID 1KX3C 2FJ7D 2BYMB 3MGQB 5CP6A 2Y2GA 5B31C 1P3AD 1BH9B 4KHAA 1P3LB 5BT1C 3A6ND 1TZYC 3KWQC 3MVDD 3AZND 5GT3C 3X1VC 5E5AD 1W2EA 5B2IC 2FJ7C 5BS7A 4NFTA 3VH6W 2JSSA 3MNNB 3AZGD 2F8NK 2HIOB 1P3AC 3A6NC 3X1UA 3MVDC 3AZNC 5CPJA 1P3BB 3LELD 2IO5C 5E5AC 5CPKB 3WKJB 3AZGC 3AN2B 2NQBD 1KX5B 3LELC 2F8NA 3AZKB 1P34D 4Z2MG 1WWSA 3REHB 4WU8A 4H9RA 3AV1A 2NQBC 3WAAD 3WA9D 5DNNB 1EQZD 1TAFB 2CV5C 5B33A 1P34C 2L5AA 2BG1A 4YM6B 3C1BD 3AZIA 3WAAC 4H9OA 4KUDD 5AV9B 4J8XB 3EPLA 5GXQD 3AZFD 1S32D 3WA9C 4H9NB 4UPKA 1EQZC 5GSUB 2XD5A 3W97D 2NZDD 3LJAD 3TU4D 5B24A 3C1BC 3UT9D 1KX3A 3AZFC 4KUDC 5GXQC 1S32C 4J8VB 4G92C 3W97C 5B31A 4KGCD 2NZDC 3TU4C 5DNMA 1TZYA 3KWQA 1AOID 3MGRD 5GT3A 3X1VA 3UT9C 2FJ7A 5JRGB 1H3OB 3NQJB 3RELD 1P3AA 4KGCC 5B2JD 3UTAD 1M19D 4JJND 1AOIC 3R45A 3MGRC 1ID3B 4DQYB 5BNVB 5E5AA 4WU9B 5F99B 5FUGB 2Y2NA 4CAYB 3RELC 5B2JC 3EPHA 3UTAC 2Y2QA 3MGPA 4JJNC 3REJA 3AYWD 1M19C 2PYOB 3KXBB 3LELA 3H0RC 5B40B 1ULYA 2UWXA 3B6FB 4ZUXD 2CWEA 5B0ZA 5BS7C 3LZ0B 2NQBA 1KX4D 3AYWC 1P3GD 5CP6B 1P3OD 1P34A 1F66D 5BNXB 4ZUXC 4CSRA 1Z2CB 3WAAA 1KX4C 3WA9A 1EQZA 1P3GC 3C1CD 3W96B 1P3OC 1F66C 3B0DB 4EO5C 3C1BA 5B0YD 3X1UB 2W8SA 5B33D 2DF4C 3W98A 4KUDA 4DRAA 4Z2MH 3KSYA 1S32A 3W99B 3W97A 5AVCA 3C1CC 2ZY5A 1P3MD 2Y2MA 2NZDA 3LJAA 3TU4A 1R4VA 4XZQB 3X1TD 5B0YC 1M1AD 5B32G 5B33C 4WV4B 3REIB 3B0CT 5BO0A 1PZRA 1HTAA 5JA4A 5CPIB 1P3MC 4KGCA 2Y2LA 3X1TC 3V9RA 5KDMB 3UTBB 1M1AC 1AOIA 1P3KD 4LD9A 3O62D 3MGRA 4Z5TB 5DNMD 1U35D 4J8UD 5AV5D 4R8PD 3AFAD 3AZIB 5B2JA 5GT0D 3UTAA 3MGQD 1M19A 4JJNA 1P3KC 3O62C 4H9PA 3B6GA 2Y2KA 5AV8B 5DNMC 3AZMB 3AZED 1P3LD 1U35C 2VQRA 3KUYB 4J8UC 5AV5C 5B1MB 2Y2OA 1M18A 3AFAC 4G91C 3EG5B 5GT0C 3A1IA 3MGQC 3AYWA 5G49A 1P3PA 2HIOD 3MGSD 1P3LC 3AZEC 3MGPD 3REJD 4H9QB 4ZUXA 1TZYB 3KWQB 5CPKD 2ZY2A 3VH5T 5GT3B 1KX4A 3WKJD 4XUJD 5B2IB 5B0ZD 2HIOC 2FJ7B 3MGSC 4WNNB 2G5HC 1P3GA 2YFWA 4ZBJC 1P3OA 2JCHA 3MGPC 3REJC 3AZHD 2BYKA 1F66A 1KX5D 4WJ3C 3A6NB 3AV2D 1BFMA 3AZKD 5CPKC 3MVDB 3AZNB 5B32A 3WKJC 5E5AB 4XUJC 5B0ZC 3WTPA 5AY8A 3NQUB 3C1CA 3LZ1A 2Y2PA 3AZLB 3AZHC 3AZGB 1N1JA 1KX5C 5B0YA 3AV2C 3AZKC 1ZLAA 1JFIA 4YM6D 1P3IA
chains in the Genus database with same CATH topology
5B1LA 1P3FA 4QLCD 3W98D 3F6TA 5AV9D 1P3MA 3X1TA 2NQBB 5AVCD 1M1AA 3REKA 2CV5B 4YM6C 4M6BA 2YFVA 4YS3B 1KU5A 1P34B 4X23B 4QLCC 3W98C 5AV9C 3KFUG 4CSRB 4J8VD 3WAAB 3IP4C 5AVCC 1P3KA 3O62A 4J8WB 3LJAC 5AV6D 1U35A 4J8UA 5AV5A 4R8PA 4LD9D 3AFAA 3C1BB 3EPJA 2BYMA 5GT0A 4J8VC 3MGQA 4KUDB 5JRGD 3AZFB 5GXQB 1BH8B 4HGAB 1P3LA 4G92B 3AZEA 5AV6C 2NZDB 3TU4B 4LD9C 3B6GD 4WU9D 3UT9B 2AROD 1M18D 2HIOA 3MGSA 5BO0B 2PYOD 1P3BA 1P3PD 3B6GC 3AZJB 4WU9C 3V9RB 5CPKA 1AOIB 2DQNC 3WTPE 3WKJA 4XUJA 2AROC 1M18C 2ZM5A 4Z66D 3AZHA 3RELB 1P3PC 1KX5A 5B2JB 1M19B 3AV2A 3AZKA 4H9PB 4KHAB 4Z66C 5B32D 1T3UA 4NE6A 3WTPD 5AY8D 3AYWB 3LZ1D 4YM6A 1ZLAD 5CPJB 4QLCA 5B32C 5AV9A 1P3ID 3WTPC 3W99D 5GSUA 5B1LD 5AY8C 1KX4B 1P3FD 3LZ1C 3P5JB 3X1SD 4XZQD 1P3GB 2FFFB 3B0DC 1P3OB 3REKD 1F66B 1ZLAC 2HUEC 3REID 4UUZA 2F8NB 1P3IC 3W99C 4J8VA 1HQ3D 5B1LC 1P3FC 5CPID 3H0MC 4AWLC 3X1SC 4XZQC 4WU8B 4H9RB 3AV1B 5C3IB 5AV6A 3REKC 2RIQA 4Z5TD 5AVBD 3REIC 5B0YB 5B33B 1HQ3C 5JRGA 1H3OA 2G5IC 3NQJA 5CPIC 4E44A 4H9OB 2F8NG 4Z5TC 3B0CW 5AVBC 3X1TB 4WU9A 1M1AB 5FUGA 3KUYD 2J8PA 4R8PC 5B1MD 2AROA 5B24B 4E45A 2PYOA 2Y2IA 3MNND 1KX3B 5B31B 3KUYC 1P3BD 5B1MC 3VH6T 5DNMB 1U35B 4Z66A 4NE5A 5AV5B 3LZ0A 4J8UB 3AFAB 3X1VB 3MNNC 3AN2D 5GT0B 3VH5A 2XD1A 3A1KA 1P3AB 5BNXA 1P3BC 3AZEB 3R45B 1WWIA 2IO5B 3AN2C 3REHD 5B31G 3W96A 3AZLD 5DNND 3MGSB 4ZBJB 3VH5W 3MGPB 3REJB 3LELB 3REHC 3W99A 4XUJB 2F2AC 4H9SA 5B0ZB 4J8XD 3AZLC 3X1SA 4XZQA 5DNNC 5GSUD 3AZHB 3REIA 2CV5D 3AV2B 4YS3D 1HQ3A 4X23D 5CPIA 4J8XC 5KDMA 5GSUC 3UTBA 3WA9B 4J8WD 4Z5TA 5AVBA 1EQZB 4YS3C 4X23C 4QLCB 3W98B 4J8WC 1S32B 1BH9A 5AV8A 3AZMA 3W97B 5AVCB 3KUYA 5B1MA 3LJAB 1ID3D 5F99D 3H0LC 4UUZB 5JRGC 3MNNA 4HGAC 1B6WA 2JE5A 4DRBA 5JA4B 4NE3A 4H9QA 2F8NH 3KXBD 4KGCB 3AZJD 1ID3C 5AV6B 5B40D 5F99C 4LD9B 3MGRB 3B6FD 5B2IA 3AN2A 4WNNA 3LZ0D 2PYOC 3KXBC 3A6NA 3AZJC 2Y2HA 3UTAB 5B40C 4JJNB 5CP6D 3MVDA 3AZNA 3B6GB 3B6FC 3REHA 1Q9CA 3NQUA 3B0BA 3LZ0C 1M18B 2AROB 3AZGA 3AZLA 5DNNA 3FDDA 1TAFA 3W96D 5CP6C 5G49B 1P3PB 3X1UD 5CPJD 3EPKA 4ZUXB 4J8XA 4Z66B 4H9NA 3W96C 2CV5A 2YFWB 3X1UC 4YS3A 3AL0C 2BYKB 5CPJC 4X23A 4EO5B 2F8ND 1F1EA 1A7WA 5B32B 4J8WA 4H9SC 3WTPB 3AV1D 4WU8D 5AY8B 3C1CB 3UTBD 3LZ1B 4WZSB 1N1JB 1ZLAB 2HUEB 3AZFA 1JFIB 5GXQA 3AZID 2LY8A 1BH8A 1P3IB 1B67A 3AV1C 2RVQD 5B1LB 5C3IC 4WU8C 2Y2JA 1P3FB 3UTBC 1P3MB 4AWLB 3X1SB 1ID3A 5AV8D 5BNVA 3AZMD 2ZY4A 5F99A 3REKB 3UT9A 4CAYA 5B24D 3AZIC 2YFVB 2RVQC 1HQ3B 1KX3D 3KXBA 3AZJA 5AV8C 3AZMC 5B40A 1P3KB 5B31D 3O62B 5AVBB 3B6FA 5CHLB 5BT1D 5B24C 1TZYD 3KWQD 2ZY3A 4R8PB 3VH6A 5GT3D 3X1VD 3RELA 4G91B 5B2ID 1KX3C 2FJ7D 2BYMB 3MGQB 5CP6A 2Y2GA 5B31C 1P3AD 1BH9B 4KHAA 1P3LB 5BT1C 3A6ND 1TZYC 3KWQC 3MVDD 3AZND 5GT3C 3X1VC 5E5AD 1W2EA 5B2IC 2FJ7C 5BS7A 4NFTA 3VH6W 2JSSA 3MNNB 3AZGD 2F8NK 2HIOB 1P3AC 3A6NC 3X1UA 3MVDC 3AZNC 5CPJA 1P3BB 3LELD 2IO5C 5E5AC 5CPKB 3WKJB 3AZGC 3AN2B 2NQBD 1KX5B 3LELC 2F8NA 3AZKB 1P34D 4Z2MG 1WWSA 3REHB 4WU8A 4H9RA 3AV1A 2NQBC 3WAAD 3WA9D 5DNNB 1EQZD 1TAFB 2CV5C 5B33A 1P34C 2L5AA 2BG1A 4YM6B 3C1BD 3AZIA 3WAAC 4H9OA 4KUDD 5AV9B 4J8XB 3EPLA 5GXQD 3AZFD 1S32D 3WA9C 4H9NB 4UPKA 1EQZC 5GSUB 2XD5A 3W97D 2NZDD 3LJAD 3TU4D 5B24A 3C1BC 3UT9D 1KX3A 3AZFC 4KUDC 5GXQC 1S32C 4J8VB 4G92C 3W97C 5B31A 4KGCD 2NZDC 3TU4C 5DNMA 1TZYA 3KWQA 1AOID 3MGRD 5GT3A 3X1VA 3UT9C 2FJ7A 5JRGB 1H3OB 3NQJB 3RELD 1P3AA 4KGCC 5B2JD 3UTAD 1M19D 4JJND 1AOIC 3R45A 3MGRC 1ID3B 4DQYB 5BNVB 5E5AA 4WU9B 5F99B 5FUGB 2Y2NA 4CAYB 3RELC 5B2JC 3EPHA 3UTAC 2Y2QA 3MGPA 4JJNC 3REJA 3AYWD 1M19C 2PYOB 3KXBB 3LELA 3H0RC 5B40B 1ULYA 2UWXA 3B6FB 4ZUXD 2CWEA 5B0ZA 5BS7C 3LZ0B 2NQBA 1KX4D 3AYWC 1P3GD 5CP6B 1P3OD 1P34A 1F66D 5BNXB 4ZUXC 4CSRA 1Z2CB 3WAAA 1KX4C 3WA9A 1EQZA 1P3GC 3C1CD 3W96B 1P3OC 1F66C 3B0DB 4EO5C 3C1BA 5B0YD 3X1UB 2W8SA 5B33D 2DF4C 3W98A 4KUDA 4DRAA 4Z2MH 3KSYA 1S32A 3W99B 3W97A 5AVCA 3C1CC 2ZY5A 1P3MD 2Y2MA 2NZDA 3LJAA 3TU4A 1R4VA 4XZQB 3X1TD 5B0YC 1M1AD 5B32G 5B33C 4WV4B 3REIB 3B0CT 5BO0A 1PZRA 1HTAA 5JA4A 5CPIB 1P3MC 4KGCA 2Y2LA 3X1TC 3V9RA 5KDMB 3UTBB 1M1AC 1AOIA 1P3KD 4LD9A 3O62D 3MGRA 4Z5TB 5DNMD 1U35D 4J8UD 5AV5D 4R8PD 3AFAD 3AZIB 5B2JA 5GT0D 3UTAA 3MGQD 1M19A 4JJNA 1P3KC 3O62C 4H9PA 3B6GA 2Y2KA 5AV8B 5DNMC 3AZMB 3AZED 1P3LD 1U35C 2VQRA 3KUYB 4J8UC 5AV5C 5B1MB 2Y2OA 1M18A 3AFAC 4G91C 3EG5B 5GT0C 3A1IA 3MGQC 3AYWA 5G49A 1P3PA 2HIOD 3MGSD 1P3LC 3AZEC 3MGPD 3REJD 4H9QB 4ZUXA 1TZYB 3KWQB 5CPKD 2ZY2A 3VH5T 5GT3B 1KX4A 3WKJD 4XUJD 5B2IB 5B0ZD 2HIOC 2FJ7B 3MGSC 4WNNB 2G5HC 1P3GA 2YFWA 4ZBJC 1P3OA 2JCHA 3MGPC 3REJC 3AZHD 2BYKA 1F66A 1KX5D 4WJ3C 3A6NB 3AV2D 1BFMA 3AZKD 5CPKC 3MVDB 3AZNB 5B32A 3WKJC 5E5AB 4XUJC 5B0ZC 3WTPA 5AY8A 3NQUB 3C1CA 3LZ1A 2Y2PA 3AZLB 3AZHC 3AZGB 1N1JA 1KX5C 5B0YA 3AV2C 3AZKC 1ZLAA 1JFIA 4YM6D 1P3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L A;  1P3F A;  4QLC D;  3W98 D;  1P3M A;  5AV9 D;  3X1T A;  2NQB B;  5AVC D;  1M1A A;  3REK A;  2CV5 B;  4YM6 C;  4M6B A;  2YFV A;  4YS3 B;  1KU5 A;  1P34 B;  4X23 B;  4QLC C;  3W98 C;  5AV9 C;  4CSR B;  4J8V D;  3WAA B;  5AVC C;  1P3K A;  3O62 A;  4J8W B;  3LJA C;  5AV6 D;  1U35 A;  4J8U A;  5AV5 A;  4R8P A;  4LD9 D;  3AFA A;  3C1B B;  2BYM A;  5GT0 A;  4J8V C;  3MGQ A;  4KUD B;  5JRG D;  3AZF B;  5GXQ B;  1BH8 B;  4HGA B;  1P3L A;  4G92 B;  3AZE A;  5AV6 C;  2NZD B;  3TU4 B;  4LD9 C;  3B6G D;  4WU9 D;  3UT9 B;  2ARO D;  1M18 D;  2HIO A;  3MGS A;  5BO0 B;  2PYO D;  1P3B A;  1P3P D;  3B6G C;  3AZJ B;  4WU9 C;  3V9R B;  5CPK A;  1AOI B;  3WTP E;  3WKJ A;  4XUJ A;  2ARO C;  1M18 C;  4Z66 D;  3AZH A;  3REL B;  1P3P C;  1KX5 A;  5B2J B;  1M19 B;  3AV2 A;  3AZK A;  4H9P B;  4KHA B;  4Z66 C;  5B32 D;  4NE6 A;  3WTP D;  5AY8 D;  3AYW B;  3LZ1 D;  4YM6 A;  1ZLA D;  5CPJ B;  4QLC A;  5B32 C;  5AV9 A;  1P3I D;  3WTP C;  3W99 D;  5GSU A;  5B1L D;  5AY8 C;  1KX4 B;  1P3F D;  3LZ1 C;  3X1S D;  4XZQ D;  1P3G B;  3B0D C;  1P3O B;  3REK D;  1F66 B;  1ZLA C;  2HUE C;  3REI D;  4UUZ A;  2F8N B;  1P3I C;  3W99 C;  4J8V A;  1HQ3 D;  5B1L C;  1P3F C;  5CPI D;  4AWL C;  3X1S C;  4XZQ C;  4WU8 B;  4H9R B;  3AV1 B;  5C3I B;  5AV6 A;  3REK C;  4Z5T D;  5AVB D;  3REI C;  5B0Y B;  5B33 B;  1HQ3 C;  5JRG A;  1H3O A;  3NQJ A;  5CPI C;  4E44 A;  4H9O B;  2F8N G;  4Z5T C;  3B0C W;  5AVB C;  3X1T B;  4WU9 A;  1M1A B;  5FUG A;  3KUY D;  4R8P C;  5B1M D;  2ARO A;  5B24 B;  4E45 A;  2PYO A;  3MNN D;  1KX3 B;  5B31 B;  3KUY C;  1P3B D;  5B1M C;  3VH6 T;  5DNM B;  1U35 B;  4Z66 A;  4NE5 A;  5AV5 B;  3LZ0 A;  4J8U B;  3AFA B;  3X1V B;  3MNN C;  3AN2 D;  5GT0 B;  3VH5 A;  1P3A B;  5BNX A;  1P3B C;  3AZE B;  3R45 B;  1WWI A;  2IO5 B;  3AN2 C;  3REH D;  5B31 G;  3W96 A;  3AZL D;  5DNN D;  3MGS B;  4ZBJ B;  3VH5 W;  3MGP B;  3REJ B;  3LEL B;  3REH C;  3W99 A;  4XUJ B;  3AZL C;  4H9S A;  5B0Z B;  4J8X D;  3X1S A;  4XZQ A;  5DNN C;  5GSU D;  3AZH B;  3REI A;  2CV5 D;  3AV2 B;  4YS3 D;  1HQ3 A;  4X23 D;  5CPI A;  4J8X C;  5KDM A;  5GSU C;  3UTB A;  3WA9 B;  4J8W D;  4Z5T A;  5AVB A;  1EQZ B;  4YS3 C;  4X23 C;  4QLC B;  3W98 B;  4J8W C;  1S32 B;  1BH9 A;  5AV8 A;  3AZM A;  3W97 B;  5AVC B;  3KUY A;  5B1M A;  3LJA B;  1ID3 D;  5F99 D;  4UUZ B;  5JRG C;  3MNN A;  4HGA C;  1B6W A;  5JA4 B;  4DRB A;  4KGC B;  4NE3 A;  4H9Q A;  2F8N H;  3KXB D;  3AZJ D;  1ID3 C;  5AV6 B;  5B40 D;  5F99 C;  4LD9 B;  3MGR B;  3B6F D;  5B2I A;  3AN2 A;  4WNN A;  3LZ0 D;  2PYO C;  3KXB C;  3A6N A;  3AZJ C;  3UTA B;  5B40 C;  4JJN B;  5CP6 D;  3MVD A;  3AZN A;  3B6G B;  3B6F C;  3REH A;  1Q9C A;  3NQU A;  3B0B A;  3LZ0 C;  1M18 B;  2ARO B;  3AZG A;  3AZL A;  5DNN A;  1TAF A;  3W96 D;  5CP6 C;  5G49 B;  1P3P B;  3X1U D;  5CPJ D;  4ZUX B;  4J8X A;  4Z66 B;  4H9N A;  3W96 C;  2CV5 A;  2YFW B;  3X1U C;  4YS3 A;  2BYK B;  5CPJ C;  4X23 A;  4EO5 B;  2F8N D;  1F1E A;  1A7W A;  5B32 B;  4J8W A;  4H9S C;  3WTP B;  3AV1 D;  4WU8 D;  5AY8 B;  3C1C B;  3UTB D;  3LZ1 B;  4WZS B;  1N1J B;  1ZLA B;  2HUE B;  3AZF A;  1JFI B;  5GXQ A;  3AZI D;  2LY8 A;  1BH8 A;  1P3I B;  1B67 A;  3AV1 C;  2RVQ D;  5B1L B;  5C3I C;  4WU8 C;  1P3F B;  3UTB C;  1P3M B;  4AWL B;  3X1S B;  1ID3 A;  5AV8 D;  5BNV A;  3AZM D;  5F99 A;  3REK B;  3UT9 A;  4CAY A;  5B24 D;  3AZI C;  2YFV B;  2RVQ C;  1HQ3 B;  1KX3 D;  3KXB A;  3AZJ A;  5AV8 C;  3AZM C;  5B40 A;  1P3K B;  5B31 D;  3O62 B;  5AVB B;  3B6F A;  5CHL B;  5BT1 D;  5B24 C;  1TZY D;  3KWQ D;  4R8P B;  3VH6 A;  5GT3 D;  3X1V D;  3REL A;  4G91 B;  5B2I D;  1KX3 C;  2FJ7 D;  2BYM B;  3MGQ B;  5CP6 A;  5B31 C;  1P3A D;  1BH9 B;  4KHA A;  1P3L B;  5BT1 C;  3A6N D;  1TZY C;  3KWQ C;  3MVD D;  3AZN D;  5GT3 C;  3X1V C;  5E5A D;  5B2I C;  2FJ7 C;  5BS7 A;  4NFT A;  3VH6 W;  2JSS A;  3MNN B;  3AZG D;  2F8N K;  2HIO B;  1P3A C;  3A6N C;  3X1U A;  3MVD C;  3AZN C;  5CPJ A;  1P3B B;  3LEL D;  2IO5 C;  5E5A C;  5CPK B;  3WKJ B;  3AZG C;  3AN2 B;  2NQB D;  1KX5 B;  3LEL C;  2F8N A;  3AZK B;  1P34 D;  4Z2M G;  1WWS A;  3REH B;  4WU8 A;  4H9R A;  3AV1 A;  2NQB C;  3WAA D;  3WA9 D;  5DNN B;  1EQZ D;  1TAF B;  2CV5 C;  5B33 A;  1P34 C;  2L5A A;  4YM6 B;  3C1B D;  3AZI A;  3WAA C;  4H9O A;  4KUD D;  5AV9 B;  4J8X B;  3AZF D;  5GXQ D;  1S32 D;  3WA9 C;  4H9N B;  1EQZ C;  5GSU B;  3W97 D;  2NZD D;  3LJA D;  3TU4 D;  5B24 A;  3C1B C;  3UT9 D;  1KX3 A;  3AZF C;  4KUD C;  5GXQ C;  1S32 C;  4J8V B;  4G92 C;  3W97 C;  5B31 A;  4KGC D;  2NZD C;  3TU4 C;  5DNM A;  1TZY A;  3KWQ A;  1AOI D;  3MGR D;  5GT3 A;  3X1V A;  3UT9 C;  2FJ7 A;  5JRG B;  1H3O B;  3NQJ B;  3REL D;  1P3A A;  4KGC C;  5B2J D;  3UTA D;  1M19 D;  4JJN D;  1AOI C;  3R45 A;  3MGR C;  1ID3 B;  4WU9 B;  5BNV B;  5E5A A;  5F99 B;  5FUG B;  4CAY B;  3REL C;  5B2J C;  3UTA C;  1M19 C;  3MGP A;  4JJN C;  3REJ A;  3AYW D;  2PYO B;  3KXB B;  3LEL A;  5B40 B;  1ULY A;  3B6F B;  4ZUX D;  2CWE A;  5B0Z A;  5BS7 C;  3LZ0 B;  2NQB A;  1KX4 D;  3AYW C;  1P3G D;  5CP6 B;  1P3O D;  1P34 A;  1F66 D;  5BNX B;  4ZUX C;  4CSR A;  3WAA A;  1KX4 C;  3WA9 A;  1EQZ A;  1P3G C;  3C1C D;  3W96 B;  1P3O C;  1F66 C;  3B0D B;  4EO5 C;  3C1B A;  5B0Y D;  3X1U B;  5B33 D;  3W98 A;  4KUD A;  4DRA A;  4Z2M H;  3KSY A;  1S32 A;  3W99 B;  3W97 A;  5AVC A;  3C1C C;  1P3M D;  2NZD A;  3LJA A;  3TU4 A;  1R4V A;  4XZQ B;  3X1T D;  5B0Y C;  1M1A D;  5B32 G;  5B33 C;  4WV4 B;  3REI B;  3B0C T;  5BO0 A;  1HTA A;  5JA4 A;  5CPI B;  1P3M C;  4KGC A;  3X1T C;  3V9R A;  5KDM B;  3UTB B;  1M1A C;  1AOI A;  1P3K D;  4LD9 A;  3O62 D;  3MGR A;  4Z5T B;  5DNM D;  1U35 D;  4J8U D;  5AV5 D;  4R8P D;  3AFA D;  3AZI B;  5B2J A;  5GT0 D;  3UTA A;  3MGQ D;  1M19 A;  4JJN A;  1P3K C;  3O62 C;  4H9P A;  3B6G A;  1P3L D;  5AV8 B;  5DNM C;  3AZM B;  3AZE D;  1U35 C;  3KUY B;  4J8U C;  5AV5 C;  5B1M B;  1M18 A;  3AFA C;  4G91 C;  5GT0 C;  3MGQ C;  3AYW A;  5G49 A;  1P3P A;  2HIO D;  3MGS D;  1P3L C;  3AZE C;  3MGP D;  3REJ D;  4H9Q B;  4ZUX A;  1TZY B;  3KWQ B;  5CPK D;  3VH5 T;  5GT3 B;  1KX4 A;  3WKJ D;  4XUJ D;  5B2I B;  5B0Z D;  2HIO C;  2FJ7 B;  3MGS C;  4WNN B;  1P3G A;  2YFW A;  4ZBJ C;  1P3O A;  3MGP C;  3REJ C;  3AZH D;  2BYK A;  1F66 A;  1KX5 D;  3A6N B;  3AV2 D;  1BFM A;  3AZK D;  5CPK C;  3MVD B;  3AZN B;  5B32 A;  3WKJ C;  5E5A B;  4XUJ C;  5B0Z C;  3WTP A;  5AY8 A;  3NQU B;  3C1C A;  3LZ1 A;  3AZL B;  3AZG B;  3AZH C;  1N1J A;  1KX5 C;  5B0Y A;  3AV2 C;  3AZK C;  1ZLA A;  1JFI A;  4YM6 D;  1P3I A; 
#chains in the Genus database with same CATH topology
 5B1L A;  1P3F A;  4QLC D;  3W98 D;  3F6T A;  5AV9 D;  1P3M A;  3X1T A;  2NQB B;  5AVC D;  1M1A A;  3REK A;  2CV5 B;  4YM6 C;  4M6B A;  2YFV A;  4YS3 B;  1KU5 A;  1P34 B;  4X23 B;  4QLC C;  3W98 C;  5AV9 C;  3KFU G;  4CSR B;  4J8V D;  3WAA B;  3IP4 C;  5AVC C;  1P3K A;  3O62 A;  4J8W B;  3LJA C;  5AV6 D;  1U35 A;  4J8U A;  5AV5 A;  4R8P A;  4LD9 D;  3AFA A;  3C1B B;  3EPJ A;  2BYM A;  5GT0 A;  4J8V C;  3MGQ A;  4KUD B;  5JRG D;  3AZF B;  5GXQ B;  1BH8 B;  4HGA B;  1P3L A;  4G92 B;  3AZE A;  5AV6 C;  2NZD B;  3TU4 B;  4LD9 C;  3B6G D;  4WU9 D;  3UT9 B;  2ARO D;  1M18 D;  2HIO A;  3MGS A;  5BO0 B;  2PYO D;  1P3B A;  1P3P D;  3B6G C;  3AZJ B;  4WU9 C;  3V9R B;  5CPK A;  1AOI B;  2DQN C;  3WTP E;  3WKJ A;  4XUJ A;  2ARO C;  1M18 C;  2ZM5 A;  4Z66 D;  3AZH A;  3REL B;  1P3P C;  1KX5 A;  5B2J B;  1M19 B;  3AV2 A;  3AZK A;  4H9P B;  4KHA B;  4Z66 C;  5B32 D;  1T3U A;  4NE6 A;  3WTP D;  5AY8 D;  3AYW B;  3LZ1 D;  4YM6 A;  1ZLA D;  5CPJ B;  4QLC A;  5B32 C;  5AV9 A;  1P3I D;  3WTP C;  3W99 D;  5GSU A;  5B1L D;  5AY8 C;  1KX4 B;  1P3F D;  3LZ1 C;  3P5J B;  3X1S D;  4XZQ D;  1P3G B;  2FFF B;  3B0D C;  1P3O B;  3REK D;  1F66 B;  1ZLA C;  2HUE C;  3REI D;  4UUZ A;  2F8N B;  1P3I C;  3W99 C;  4J8V A;  1HQ3 D;  5B1L C;  1P3F C;  5CPI D;  3H0M C;  4AWL C;  3X1S C;  4XZQ C;  4WU8 B;  4H9R B;  3AV1 B;  5C3I B;  5AV6 A;  3REK C;  2RIQ A;  4Z5T D;  5AVB D;  3REI C;  5B0Y B;  5B33 B;  1HQ3 C;  5JRG A;  1H3O A;  2G5I C;  3NQJ A;  5CPI C;  4E44 A;  4H9O B;  2F8N G;  4Z5T C;  3B0C W;  5AVB C;  3X1T B;  4WU9 A;  1M1A B;  5FUG A;  3KUY D;  2J8P A;  4R8P C;  5B1M D;  2ARO A;  5B24 B;  4E45 A;  2PYO A;  2Y2I A;  3MNN D;  1KX3 B;  5B31 B;  3KUY C;  1P3B D;  5B1M C;  3VH6 T;  5DNM B;  1U35 B;  4Z66 A;  4NE5 A;  5AV5 B;  3LZ0 A;  4J8U B;  3AFA B;  3X1V B;  3MNN C;  3AN2 D;  5GT0 B;  3VH5 A;  2XD1 A;  3A1K A;  1P3A B;  5BNX A;  1P3B C;  3AZE B;  3R45 B;  1WWI A;  2IO5 B;  3AN2 C;  3REH D;  5B31 G;  3W96 A;  3AZL D;  5DNN D;  3MGS B;  4ZBJ B;  3VH5 W;  3MGP B;  3REJ B;  3LEL B;  3REH C;  3W99 A;  4XUJ B;  2F2A C;  4H9S A;  5B0Z B;  4J8X D;  3AZL C;  3X1S A;  4XZQ A;  5DNN C;  5GSU D;  3AZH B;  3REI A;  2CV5 D;  3AV2 B;  4YS3 D;  1HQ3 A;  4X23 D;  5CPI A;  4J8X C;  5KDM A;  5GSU C;  3UTB A;  3WA9 B;  4J8W D;  4Z5T A;  5AVB A;  1EQZ B;  4YS3 C;  4X23 C;  4QLC B;  3W98 B;  4J8W C;  1S32 B;  1BH9 A;  5AV8 A;  3AZM A;  3W97 B;  5AVC B;  3KUY A;  5B1M A;  3LJA B;  1ID3 D;  5F99 D;  3H0L C;  4UUZ B;  5JRG C;  3MNN A;  4HGA C;  1B6W A;  2JE5 A;  4DRB A;  5JA4 B;  4NE3 A;  4H9Q A;  2F8N H;  3KXB D;  4KGC B;  3AZJ D;  1ID3 C;  5AV6 B;  5B40 D;  5F99 C;  4LD9 B;  3MGR B;  3B6F D;  5B2I A;  3AN2 A;  4WNN A;  3LZ0 D;  2PYO C;  3KXB C;  3A6N A;  3AZJ C;  2Y2H A;  3UTA B;  5B40 C;  4JJN B;  5CP6 D;  3MVD A;  3AZN A;  3B6G B;  3B6F C;  3REH A;  1Q9C A;  3NQU A;  3B0B A;  3LZ0 C;  1M18 B;  2ARO B;  3AZG A;  3AZL A;  5DNN A;  3FDD A;  1TAF A;  3W96 D;  5CP6 C;  5G49 B;  1P3P B;  3X1U D;  5CPJ D;  3EPK A;  4ZUX B;  4J8X A;  4Z66 B;  4H9N A;  3W96 C;  2CV5 A;  2YFW B;  3X1U C;  4YS3 A;  3AL0 C;  2BYK B;  5CPJ C;  4X23 A;  4EO5 B;  2F8N D;  1F1E A;  1A7W A;  5B32 B;  4J8W A;  4H9S C;  3WTP B;  3AV1 D;  4WU8 D;  5AY8 B;  3C1C B;  3UTB D;  3LZ1 B;  4WZS B;  1N1J B;  1ZLA B;  2HUE B;  3AZF A;  1JFI B;  5GXQ A;  3AZI D;  2LY8 A;  1BH8 A;  1P3I B;  1B67 A;  3AV1 C;  2RVQ D;  5B1L B;  5C3I C;  4WU8 C;  2Y2J A;  1P3F B;  3UTB C;  1P3M B;  4AWL B;  3X1S B;  1ID3 A;  5AV8 D;  5BNV A;  3AZM D;  2ZY4 A;  5F99 A;  3REK B;  3UT9 A;  4CAY A;  5B24 D;  3AZI C;  2YFV B;  2RVQ C;  1HQ3 B;  1KX3 D;  3KXB A;  3AZJ A;  5AV8 C;  3AZM C;  5B40 A;  1P3K B;  5B31 D;  3O62 B;  5AVB B;  3B6F A;  5CHL B;  5BT1 D;  5B24 C;  1TZY D;  3KWQ D;  2ZY3 A;  4R8P B;  3VH6 A;  5GT3 D;  3X1V D;  3REL A;  4G91 B;  5B2I D;  1KX3 C;  2FJ7 D;  2BYM B;  3MGQ B;  5CP6 A;  2Y2G A;  5B31 C;  1P3A D;  1BH9 B;  4KHA A;  1P3L B;  5BT1 C;  3A6N D;  1TZY C;  3KWQ C;  3MVD D;  3AZN D;  5GT3 C;  3X1V C;  5E5A D;  1W2E A;  5B2I C;  2FJ7 C;  5BS7 A;  4NFT A;  3VH6 W;  2JSS A;  3MNN B;  3AZG D;  2F8N K;  2HIO B;  1P3A C;  3A6N C;  3X1U A;  3MVD C;  3AZN C;  5CPJ A;  1P3B B;  3LEL D;  2IO5 C;  5E5A C;  5CPK B;  3WKJ B;  3AZG C;  3AN2 B;  2NQB D;  1KX5 B;  3LEL C;  2F8N A;  3AZK B;  1P34 D;  4Z2M G;  1WWS A;  3REH B;  4WU8 A;  4H9R A;  3AV1 A;  2NQB C;  3WAA D;  3WA9 D;  5DNN B;  1EQZ D;  1TAF B;  2CV5 C;  5B33 A;  1P34 C;  2L5A A;  2BG1 A;  4YM6 B;  3C1B D;  3AZI A;  3WAA C;  4H9O A;  4KUD D;  5AV9 B;  4J8X B;  3EPL A;  5GXQ D;  3AZF D;  1S32 D;  3WA9 C;  4H9N B;  4UPK A;  1EQZ C;  5GSU B;  2XD5 A;  3W97 D;  2NZD D;  3LJA D;  3TU4 D;  5B24 A;  3C1B C;  3UT9 D;  1KX3 A;  3AZF C;  4KUD C;  5GXQ C;  1S32 C;  4J8V B;  4G92 C;  3W97 C;  5B31 A;  4KGC D;  2NZD C;  3TU4 C;  5DNM A;  1TZY A;  3KWQ A;  1AOI D;  3MGR D;  5GT3 A;  3X1V A;  3UT9 C;  2FJ7 A;  5JRG B;  1H3O B;  3NQJ B;  3REL D;  1P3A A;  4KGC C;  5B2J D;  3UTA D;  1M19 D;  4JJN D;  1AOI C;  3R45 A;  3MGR C;  1ID3 B;  4DQY B;  5BNV B;  5E5A A;  4WU9 B;  5F99 B;  5FUG B;  2Y2N A;  4CAY B;  3REL C;  5B2J C;  3EPH A;  3UTA C;  2Y2Q A;  3MGP A;  4JJN C;  3REJ A;  3AYW D;  1M19 C;  2PYO B;  3KXB B;  3LEL A;  3H0R C;  5B40 B;  1ULY A;  2UWX A;  3B6F B;  4ZUX D;  2CWE A;  5B0Z A;  5BS7 C;  3LZ0 B;  2NQB A;  1KX4 D;  3AYW C;  1P3G D;  5CP6 B;  1P3O D;  1P34 A;  1F66 D;  5BNX B;  4ZUX C;  4CSR A;  1Z2C B;  3WAA A;  1KX4 C;  3WA9 A;  1EQZ A;  1P3G C;  3C1C D;  3W96 B;  1P3O C;  1F66 C;  3B0D B;  4EO5 C;  3C1B A;  5B0Y D;  3X1U B;  2W8S A;  5B33 D;  2DF4 C;  3W98 A;  4KUD A;  4DRA A;  4Z2M H;  3KSY A;  1S32 A;  3W99 B;  3W97 A;  5AVC A;  3C1C C;  2ZY5 A;  1P3M D;  2Y2M A;  2NZD A;  3LJA A;  3TU4 A;  1R4V A;  4XZQ B;  3X1T D;  5B0Y C;  1M1A D;  5B32 G;  5B33 C;  4WV4 B;  3REI B;  3B0C T;  5BO0 A;  1PZR A;  1HTA A;  5JA4 A;  5CPI B;  1P3M C;  4KGC A;  2Y2L A;  3X1T C;  3V9R A;  5KDM B;  3UTB B;  1M1A C;  1AOI A;  1P3K D;  4LD9 A;  3O62 D;  3MGR A;  4Z5T B;  5DNM D;  1U35 D;  4J8U D;  5AV5 D;  4R8P D;  3AFA D;  3AZI B;  5B2J A;  5GT0 D;  3UTA A;  3MGQ D;  1M19 A;  4JJN A;  1P3K C;  3O62 C;  4H9P A;  3B6G A;  2Y2K A;  5AV8 B;  5DNM C;  3AZM B;  3AZE D;  1P3L D;  1U35 C;  2VQR A;  3KUY B;  4J8U C;  5AV5 C;  5B1M B;  2Y2O A;  1M18 A;  3AFA C;  4G91 C;  3EG5 B;  5GT0 C;  3A1I A;  3MGQ C;  3AYW A;  5G49 A;  1P3P A;  2HIO D;  3MGS D;  1P3L C;  3AZE C;  3MGP D;  3REJ D;  4H9Q B;  4ZUX A;  1TZY B;  3KWQ B;  5CPK D;  2ZY2 A;  3VH5 T;  5GT3 B;  1KX4 A;  3WKJ D;  4XUJ D;  5B2I B;  5B0Z D;  2HIO C;  2FJ7 B;  3MGS C;  4WNN B;  2G5H C;  1P3G A;  2YFW A;  4ZBJ C;  1P3O A;  2JCH A;  3MGP C;  3REJ C;  3AZH D;  2BYK A;  1F66 A;  1KX5 D;  4WJ3 C;  3A6N B;  3AV2 D;  1BFM A;  3AZK D;  5CPK C;  3MVD B;  3AZN B;  5B32 A;  3WKJ C;  5E5A B;  4XUJ C;  5B0Z C;  3WTP A;  5AY8 A;  3NQU B;  3C1C A;  3LZ1 A;  2Y2P A;  3AZL B;  3AZH C;  3AZG B;  1N1J A;  1KX5 C;  5B0Y A;  3AV2 C;  3AZK C;  1ZLA A;  1JFI A;  4YM6 D;  1P3I A; 
#chains in the Genus database with same CATH homology
 5B1L A;  1P3F A;  4QLC D;  3W98 D;  3F6T A;  5AV9 D;  1P3M A;  3X1T A;  2NQB B;  5AVC D;  1M1A A;  3REK A;  2CV5 B;  4YM6 C;  4M6B A;  2YFV A;  4YS3 B;  1KU5 A;  1P34 B;  4X23 B;  4QLC C;  3W98 C;  5AV9 C;  3KFU G;  4CSR B;  4J8V D;  3WAA B;  3IP4 C;  5AVC C;  1P3K A;  3O62 A;  4J8W B;  3LJA C;  5AV6 D;  1U35 A;  4J8U A;  5AV5 A;  4R8P A;  4LD9 D;  3AFA A;  3C1B B;  3EPJ A;  2BYM A;  5GT0 A;  4J8V C;  3MGQ A;  4KUD B;  5JRG D;  3AZF B;  5GXQ B;  1BH8 B;  4HGA B;  1P3L A;  4G92 B;  3AZE A;  5AV6 C;  2NZD B;  3TU4 B;  4LD9 C;  3B6G D;  4WU9 D;  3UT9 B;  2ARO D;  1M18 D;  2HIO A;  3MGS A;  5BO0 B;  2PYO D;  1P3B A;  1P3P D;  3B6G C;  3AZJ B;  4WU9 C;  3V9R B;  5CPK A;  1AOI B;  2DQN C;  3WTP E;  3WKJ A;  4XUJ A;  2ARO C;  1M18 C;  2ZM5 A;  4Z66 D;  3AZH A;  3REL B;  1P3P C;  1KX5 A;  5B2J B;  1M19 B;  3AV2 A;  3AZK A;  4H9P B;  4KHA B;  4Z66 C;  5B32 D;  1T3U A;  4NE6 A;  3WTP D;  5AY8 D;  3AYW B;  3LZ1 D;  4YM6 A;  1ZLA D;  5CPJ B;  4QLC A;  5B32 C;  5AV9 A;  1P3I D;  3WTP C;  3W99 D;  5GSU A;  5B1L D;  5AY8 C;  1KX4 B;  1P3F D;  3LZ1 C;  3P5J B;  3X1S D;  4XZQ D;  1P3G B;  2FFF B;  3B0D C;  1P3O B;  3REK D;  1F66 B;  1ZLA C;  2HUE C;  3REI D;  4UUZ A;  2F8N B;  1P3I C;  3W99 C;  4J8V A;  1HQ3 D;  5B1L C;  1P3F C;  5CPI D;  3H0M C;  4AWL C;  3X1S C;  4XZQ C;  4WU8 B;  4H9R B;  3AV1 B;  5C3I B;  5AV6 A;  3REK C;  2RIQ A;  4Z5T D;  5AVB D;  3REI C;  5B0Y B;  5B33 B;  1HQ3 C;  5JRG A;  1H3O A;  2G5I C;  3NQJ A;  5CPI C;  4E44 A;  4H9O B;  2F8N G;  4Z5T C;  3B0C W;  5AVB C;  3X1T B;  4WU9 A;  1M1A B;  5FUG A;  3KUY D;  2J8P A;  4R8P C;  5B1M D;  2ARO A;  5B24 B;  4E45 A;  2PYO A;  2Y2I A;  3MNN D;  1KX3 B;  5B31 B;  3KUY C;  1P3B D;  5B1M C;  3VH6 T;  5DNM B;  1U35 B;  4Z66 A;  4NE5 A;  5AV5 B;  3LZ0 A;  4J8U B;  3AFA B;  3X1V B;  3MNN C;  3AN2 D;  5GT0 B;  3VH5 A;  2XD1 A;  3A1K A;  1P3A B;  5BNX A;  1P3B C;  3AZE B;  3R45 B;  1WWI A;  2IO5 B;  3AN2 C;  3REH D;  5B31 G;  3W96 A;  3AZL D;  5DNN D;  3MGS B;  4ZBJ B;  3VH5 W;  3MGP B;  3REJ B;  3LEL B;  3REH C;  3W99 A;  4XUJ B;  2F2A C;  4H9S A;  5B0Z B;  4J8X D;  3AZL C;  3X1S A;  4XZQ A;  5DNN C;  5GSU D;  3AZH B;  3REI A;  2CV5 D;  3AV2 B;  4YS3 D;  1HQ3 A;  4X23 D;  5CPI A;  4J8X C;  5KDM A;  5GSU C;  3UTB A;  3WA9 B;  4J8W D;  4Z5T A;  5AVB A;  1EQZ B;  4YS3 C;  4X23 C;  4QLC B;  3W98 B;  4J8W C;  1S32 B;  1BH9 A;  5AV8 A;  3AZM A;  3W97 B;  5AVC B;  3KUY A;  5B1M A;  3LJA B;  1ID3 D;  5F99 D;  3H0L C;  4UUZ B;  5JRG C;  3MNN A;  4HGA C;  1B6W A;  2JE5 A;  4DRB A;  5JA4 B;  4NE3 A;  4H9Q A;  2F8N H;  3KXB D;  4KGC B;  3AZJ D;  1ID3 C;  5AV6 B;  5B40 D;  5F99 C;  4LD9 B;  3MGR B;  3B6F D;  5B2I A;  3AN2 A;  4WNN A;  3LZ0 D;  2PYO C;  3KXB C;  3A6N A;  3AZJ C;  2Y2H A;  3UTA B;  5B40 C;  4JJN B;  5CP6 D;  3MVD A;  3AZN A;  3B6G B;  3B6F C;  3REH A;  1Q9C A;  3NQU A;  3B0B A;  3LZ0 C;  1M18 B;  2ARO B;  3AZG A;  3AZL A;  5DNN A;  3FDD A;  1TAF A;  3W96 D;  5CP6 C;  5G49 B;  1P3P B;  3X1U D;  5CPJ D;  3EPK A;  4ZUX B;  4J8X A;  4Z66 B;  4H9N A;  3W96 C;  2CV5 A;  2YFW B;  3X1U C;  4YS3 A;  3AL0 C;  2BYK B;  5CPJ C;  4X23 A;  4EO5 B;  2F8N D;  1F1E A;  1A7W A;  5B32 B;  4J8W A;  4H9S C;  3WTP B;  3AV1 D;  4WU8 D;  5AY8 B;  3C1C B;  3UTB D;  3LZ1 B;  4WZS B;  1N1J B;  1ZLA B;  2HUE B;  3AZF A;  1JFI B;  5GXQ A;  3AZI D;  2LY8 A;  1BH8 A;  1P3I B;  1B67 A;  3AV1 C;  2RVQ D;  5B1L B;  5C3I C;  4WU8 C;  2Y2J A;  1P3F B;  3UTB C;  1P3M B;  4AWL B;  3X1S B;  1ID3 A;  5AV8 D;  5BNV A;  3AZM D;  2ZY4 A;  5F99 A;  3REK B;  3UT9 A;  4CAY A;  5B24 D;  3AZI C;  2YFV B;  2RVQ C;  1HQ3 B;  1KX3 D;  3KXB A;  3AZJ A;  5AV8 C;  3AZM C;  5B40 A;  1P3K B;  5B31 D;  3O62 B;  5AVB B;  3B6F A;  5CHL B;  5BT1 D;  5B24 C;  1TZY D;  3KWQ D;  2ZY3 A;  4R8P B;  3VH6 A;  5GT3 D;  3X1V D;  3REL A;  4G91 B;  5B2I D;  1KX3 C;  2FJ7 D;  2BYM B;  3MGQ B;  5CP6 A;  2Y2G A;  5B31 C;  1P3A D;  1BH9 B;  4KHA A;  1P3L B;  5BT1 C;  3A6N D;  1TZY C;  3KWQ C;  3MVD D;  3AZN D;  5GT3 C;  3X1V C;  5E5A D;  1W2E A;  5B2I C;  2FJ7 C;  5BS7 A;  4NFT A;  3VH6 W;  2JSS A;  3MNN B;  3AZG D;  2F8N K;  2HIO B;  1P3A C;  3A6N C;  3X1U A;  3MVD C;  3AZN C;  5CPJ A;  1P3B B;  3LEL D;  2IO5 C;  5E5A C;  5CPK B;  3WKJ B;  3AZG C;  3AN2 B;  2NQB D;  1KX5 B;  3LEL C;  2F8N A;  3AZK B;  1P34 D;  4Z2M G;  1WWS A;  3REH B;  4WU8 A;  4H9R A;  3AV1 A;  2NQB C;  3WAA D;  3WA9 D;  5DNN B;  1EQZ D;  1TAF B;  2CV5 C;  5B33 A;  1P34 C;  2L5A A;  2BG1 A;  4YM6 B;  3C1B D;  3AZI A;  3WAA C;  4H9O A;  4KUD D;  5AV9 B;  4J8X B;  3EPL A;  5GXQ D;  3AZF D;  1S32 D;  3WA9 C;  4H9N B;  4UPK A;  1EQZ C;  5GSU B;  2XD5 A;  3W97 D;  2NZD D;  3LJA D;  3TU4 D;  5B24 A;  3C1B C;  3UT9 D;  1KX3 A;  3AZF C;  4KUD C;  5GXQ C;  1S32 C;  4J8V B;  4G92 C;  3W97 C;  5B31 A;  4KGC D;  2NZD C;  3TU4 C;  5DNM A;  1TZY A;  3KWQ A;  1AOI D;  3MGR D;  5GT3 A;  3X1V A;  3UT9 C;  2FJ7 A;  5JRG B;  1H3O B;  3NQJ B;  3REL D;  1P3A A;  4KGC C;  5B2J D;  3UTA D;  1M19 D;  4JJN D;  1AOI C;  3R45 A;  3MGR C;  1ID3 B;  4DQY B;  5BNV B;  5E5A A;  4WU9 B;  5F99 B;  5FUG B;  2Y2N A;  4CAY B;  3REL C;  5B2J C;  3EPH A;  3UTA C;  2Y2Q A;  3MGP A;  4JJN C;  3REJ A;  3AYW D;  1M19 C;  2PYO B;  3KXB B;  3LEL A;  3H0R C;  5B40 B;  1ULY A;  2UWX A;  3B6F B;  4ZUX D;  2CWE A;  5B0Z A;  5BS7 C;  3LZ0 B;  2NQB A;  1KX4 D;  3AYW C;  1P3G D;  5CP6 B;  1P3O D;  1P34 A;  1F66 D;  5BNX B;  4ZUX C;  4CSR A;  1Z2C B;  3WAA A;  1KX4 C;  3WA9 A;  1EQZ A;  1P3G C;  3C1C D;  3W96 B;  1P3O C;  1F66 C;  3B0D B;  4EO5 C;  3C1B A;  5B0Y D;  3X1U B;  2W8S A;  5B33 D;  2DF4 C;  3W98 A;  4KUD A;  4DRA A;  4Z2M H;  3KSY A;  1S32 A;  3W99 B;  3W97 A;  5AVC A;  3C1C C;  2ZY5 A;  1P3M D;  2Y2M A;  2NZD A;  3LJA A;  3TU4 A;  1R4V A;  4XZQ B;  3X1T D;  5B0Y C;  1M1A D;  5B32 G;  5B33 C;  4WV4 B;  3REI B;  3B0C T;  5BO0 A;  1PZR A;  1HTA A;  5JA4 A;  5CPI B;  1P3M C;  4KGC A;  2Y2L A;  3X1T C;  3V9R A;  5KDM B;  3UTB B;  1M1A C;  1AOI A;  1P3K D;  4LD9 A;  3O62 D;  3MGR A;  4Z5T B;  5DNM D;  1U35 D;  4J8U D;  5AV5 D;  4R8P D;  3AFA D;  3AZI B;  5B2J A;  5GT0 D;  3UTA A;  3MGQ D;  1M19 A;  4JJN A;  1P3K C;  3O62 C;  4H9P A;  3B6G A;  2Y2K A;  5AV8 B;  5DNM C;  3AZM B;  3AZE D;  1P3L D;  1U35 C;  2VQR A;  3KUY B;  4J8U C;  5AV5 C;  5B1M B;  2Y2O A;  1M18 A;  3AFA C;  4G91 C;  3EG5 B;  5GT0 C;  3A1I A;  3MGQ C;  3AYW A;  5G49 A;  1P3P A;  2HIO D;  3MGS D;  1P3L C;  3AZE C;  3MGP D;  3REJ D;  4H9Q B;  4ZUX A;  1TZY B;  3KWQ B;  5CPK D;  2ZY2 A;  3VH5 T;  5GT3 B;  1KX4 A;  3WKJ D;  4XUJ D;  5B2I B;  5B0Z D;  2HIO C;  2FJ7 B;  3MGS C;  4WNN B;  2G5H C;  1P3G A;  2YFW A;  4ZBJ C;  1P3O A;  2JCH A;  3MGP C;  3REJ C;  3AZH D;  2BYK A;  1F66 A;  1KX5 D;  4WJ3 C;  3A6N B;  3AV2 D;  1BFM A;  3AZK D;  5CPK C;  3MVD B;  3AZN B;  5B32 A;  3WKJ C;  5E5A B;  4XUJ C;  5B0Z C;  3WTP A;  5AY8 A;  3NQU B;  3C1C A;  3LZ1 A;  2Y2P A;  3AZL B;  3AZH C;  3AZG B;  1N1J A;  1KX5 C;  5B0Y A;  3AV2 C;  3AZK C;  1ZLA A;  1JFI A;  4YM6 D;  1P3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...