5DNNB

Nucleosome core particle containing adducts of gold(i)-triethylphosphane and ruthenium(ii)-toluene pta complexes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnnB00
5AY8D 4J8XA 3B6FC 5B2IB 4Z66B 3UT9D 3X1UD 4Z5TD 1P3LB 4J8XD 5JRGC 3KXBC 5B32C 4YS3C 4YM6B 3LZ1C 3AZEC 3X1SA 3VH5W 3RELB 3AZKB 4HGAB 3V9RA 4ZUXA 4JJNA 2AROC 5GT3C 3AYWC 4ZUXD 4JJND 3AZFB 1P3BC 4G91B 3LELC 1P3OB 5B0YA 4EO5B 5BNVA 4J8WC 2CV5C 1S32A 1KU5A 5GSUC 1F66A 5B0YD 5B2JA 3REID 3REJC 3WTPC 2NQBC 5G49B 5AV9C 3R45B 4KGCA 1F66D 5B2JD 5B1LB 3AZIA 5B40A 3X1VA 4KGCD 5DNMC 4M6BA 4XZQC 3MNNB 3AZID 3X1VD 5B40D 2NZDC 3B6FA 1P3KB 3REHA 4WU8C 5BNXA 3LZ0B 2F8NA 5AV5C 3AV1C 3B6FD 3REHD 3KXBA 5B32A 3AZGA 1TZYC 2F8ND 3C1CB 5JRGD 3AZEA 3W99A 5GXQB 3KXBD 5B32D 3AZGD 4NE3A 4H9PB 3W99D 3AZED 1AOIA 4G92B 5B2IC 4Z66C 2AROA 2PYOC 5GT3A 1P3LC 1AOID 4CSRA 5DNNB 1P3PB 2AROD 1P3MA 5GT3D 3AYWD 3LELA 4YM6C 3X1TB 5CPKB 1P3MD 3W96A 3RELC 5GSUA 3LELD 3AZKC 2NQBA 3WTPA 5E5AA 3B0CT 3W96D 5GSUD 3AZJB 2NQBD 3WTPD 5E5AD 3AZFC 4G91C 1P3OC 1N1JA 5DNMA 4XZQA 5B31G 3REKB 2F8NH 3LJAB 2L5AA 5DNMD 4XZQD 1BH9B 5AV5A 3MGSC 3AV1A 1P3GC 5AV5D 5JA4B 3AZNB 4CAYB 5B1LC 3LZ1B 3AV1D 3MNNC 5CP6B 5B2IA 1P3KC 4Z66A 1M18B 1P3LA 5B24C 5B2ID 4Z66D 1M1AB 1P3LD 4YM6A 1P3IA 4LD9C 5AV8C 5GXQC 1HQ3B 4J8WB 3AZKA 4YM6D 2CV5B 3AFAC 1P3ID 3REJB 1KX5B 3KUYB 4G92C 3AZKD 4WV4B 1ULYA 5BO0A 5DNNC 1P3PC 1P3OA 5CPKC 3AZFD 2F8NK 1P3OD 3B6GB 2NZDB 4WU8B 5G49A 3AZMB 3R45A 1BH8B 4J8UB 5B1MA 1TZYB 3B0CW 5B1LA 5B1MD 5B31B 3MNNA 3MGPB 5B1LD 3LJAC 4Z5TA 1P3KA 3MNND 3LZ0A 3A6NB 2PYOB 3WKJB 5C3IB 1P3KD 3VH6W 5AV6C 3LZ0D 3AZNC 3C1CA 2RVQC 4X23B 5GXQA 1P34B 3C1CD 5CP6C 4XUJC 2HUEB 5GXQD 1BFMA 1M18C 3B0DB 4H9SC 2BYKB 5DNNA 1B67A 1P3PA 1M1AC 4KUDB 3MVDC 1U35B 5DNND 3REIA 2BYMB 3X1TA 5CPKA 1P3PD 1HQ3C 3AZHB 5F99A 3UTBB 3X1TD 5CPKD 1KX5C 3MGSB 3KUYC 3AZJA 5F99D 1P3GB 3AZJD 4WU9B 5B0ZB 1EQZA 3KSYA 3REKA 3LJAA 3TU4B 1EQZD 3B6GC 3REKD 1BH9A 4QLCC 3AZLB 3AZMC 5B33C 3LJAD 3VH6A 5JRGA 4J8UC 5CPJB 5B24B 4H9RB 3AZNA 5JA4A 5GT0B 4YS3A 4CAYA 3LZ1A 3VH5A 4E45A 5AV8B 4LD9B 5B31C 3AZND 3MGPC 5CP6A 4YS3D 4Z2MG 3LZ1D 3AFAB 1M18A 5CP6D 3A6NC 4H9SA 3AYWA 3WKJC 5C3IC 4WNNB 1M18D 2YFVB 1P3BA 3X1UB 4X23C 1HQ3A 1P34C 4J8WA 2CV5A 1P3BD 5BT1C 2HUEC 3REJA 1KX5A 1HQ3D 5AV9A 3KUYA 4J8WD 2CV5D 3B0DC 3REJD 1KX5D 4ZBJB 5AV9D 3KUYD 4KUDC 3X1SB 1P3AB 2IO5C 1U35C 2FJ7B 3MGRC 3AZHC 4JJNB 3B6GA 2NZDA 4KHAB 1H3OB 4WU8A 3UTBC 4J8UA 3B6GD 2NZDD 4WU8D 5AV6B 1TZYA 4H9NB 4UUZB 4J8UD 4H9QB 4WU9C 5B0ZC 1S32B 5B31A 4H9OB 3MGPA 1P3FB 1TZYD 4J8VC 1M19B 2HIOB 3TU4C 4XUJB 5B31D 3MGPD 3A6NA 3AZLC 2PYOA 3WKJA 3AZIB 5CPJC 1JFIB 1ID3C 1A7WA 5AVCB 3A6ND 2PYOD 1WWSA 3WKJD 5CPIC 5GT0C 3MVDB 1P34A 5BNXB 3RELA 3WAAB 1P34D 3AZGB 3RELD 2BYKA 4E44A 1KX3B 4KUDA 3UT9C 3X1UC 3AZFA 3AN2B 1U35A 1KX4B 4J8XC 2BYMA 1AOIB 4KUDD 3AV2B 3AZHA 3W97B 3UTBA 1U35D 4QLCB 3MGSA 3AZHD 5B33B 1P3MB 3UTBD 1P3GA 3W98B 3MGSD 4ZBJC 1TAFB 3X1SC 5B0ZA 3W96B 1P3AC 1P3GD 5E5AB 3TU4A 2FJ7C 5B0ZD 4AWLB 4JJNC 3NQUB 3NQJB 3TU4D 5CPJA 5B24A 4H9RA 3KWQB 5GT0A 5CPJD 5B24D 3UTAB 1S32C 5AV8A 4LD9A 1F66C 1P3FC 1M19C 5GT0D 2HIOC 1B6WA 4H9PA 3AFAA 4LD9D 5AV8D 3WTPE 3AFAD 3O62B 4WNNA 3AZIC 5B40C 5AVBB 5AVCC 2YFVA 4DRAA 5KDMB 2IO5B 3MGRB 3REHC 3WAAC 3AZGC 3W99C 1P3IB 1KX3C 1P3AA 3AN2C 1KX4C 1AOIC 2FJ7A 4J8VB 3AV2C 3X1SD 5BS7C 4KHAA 1R4VA 1H3OA 1P3AD 2YFWB 3W97C 2FJ7D 5BO0B 1P3MC 4R8PB 5AV6A 1ID3B 3W98C 3WA9B 3B0BA 4H9NA 4UUZA 5CPIB 4H9QA 3W96C 5AV6D 4H9OA 3MGQB 1P3FA 1M19A 2HIOA 5E5AC 2RVQD 4XUJA 1S32D 3C1BB 4AWLC 2F8NG 5CHLB 1P3FD 1M19D 5B1MB 2HIOD 1ZLAB 5B32G 4XUJD 1JFIA 5AY8B 5AVCA 3KWQC 1M1AA 3MVDA 3UT9B 5FUGB 4Z5TB 3UTAC 4J8XB 5AVCD 1M1AD 3WAAA 3MVDD 2LY8A 3WAAD 1KX3A 3O62C 5AVBC 3AN2A 1KX4A 1KX3D 3AV2A 5BS7A 1WWIA 3V9RB 3W97A 3AN2D 4ZUXB 1KX4D 4NE6A 4QLCA 3AV2D 3AZMA 5B33A 1BH8A 3W97D 4WZSB 3W98A 4QLCD 1P3IC 3AZMD 1HTAA 5B33D 5B0YB 1TAFA 3REIB 5BNVB 3W98D 5F99B 1F66B 4HGAC 5B2JB 4KGCB 3NQUA 3NQJA 2CWEA 3X1VB 5B40B 3KWQA 4R8PC 1EQZB 3WA9C 4EO5C 4Z2MH 4X23A 3UTAA 3VH6T 3KWQD 3MGQC 3B6FB 3REHB 4NFTA 4X23D 3UTAD 2F8NB 5JRGB 3C1BC 5B1MC 3VH5T 5B32B 3KXBB 5BT1D 1ZLAC 4YS3B 3O62A 3AZEB 3W99B 4DRBA 5AY8C 5AVBA 1Q9CA 1F1EA 5KDMA 3O62D 4Z5TC 5AVBD 3MGRA 3LZ0C 2AROB 5GT3B 3AYWB 4CSRB 3MGRD 3C1CC 1P3BB 3LELB 4WU9A 5GSUB 4J8VA 2NQBB 3WTPB 5AV9B 4WU9D 4ZUXC 2YFWA 4J8VD 3AZLA 4R8PA 1ID3A 3WA9A 3AZLD 5FUGA 1N1JB 5B0YC 4XZQB 5DNMB 3REIC 2JSSA 3X1TC 5CPIA 4R8PD 1ID3D 3MGQA 3WA9D 5F99C 5B2JC 5CPID 5AV5B 3C1BA 3AZJC 3MGQD 3AV1B 4KGCC 1ZLAA 3C1BD 4NE5A 5AY8A 3X1VC 1EQZC 1ZLAD 3REKC 3UT9A 3X1UA
chains in the Genus database with same CATH superfamily
5AY8D 4J8XA 3B6FC 5B2IB 4Z66B 3UT9D 3X1UD 4Z5TD 1P3LB 4J8XD 5JRGC 2Y2MA 3KFUG 3KXBC 5B32C 4YS3C 4YM6B 3LZ1C 3AZEC 2BG1A 3X1SA 3VH5W 3RELB 3AZKB 4HGAB 3V9RA 2RIQA 4ZUXA 4JJNA 2AROC 3IP4C 5GT3C 3AYWC 4ZUXD 4JJND 3AZFB 1P3BC 4G91B 3LELC 1P3OB 5B0YA 4EO5B 5BNVA 4J8WC 2CV5C 1W2EA 1S32A 1KU5A 5GSUC 1F66A 5B0YD 5B2JA 3REID 3REJC 3WTPC 2NQBC 5G49B 5AV9C 3R45B 4KGCA 1F66D 5B2JD 5B1LB 2UWXA 5B40A 3AZIA 3X1VA 4KGCD 5DNMC 4M6BA 4XZQC 3MNNB 3AZID 3X1VD 5B40D 2NZDC 3B6FA 1P3KB 3REHA 4WU8C 5BNXA 3LZ0B 2F8NA 5AV5C 3AV1C 3B6FD 3REHD 3KXBA 5B32A 3AZGA 1TZYC 2F8ND 3C1CB 5JRGD 3AZEA 3W99A 5GXQB 3KXBD 5B32D 3AZGD 2W8SA 4NE3A 4H9PB 3W99D 3AZED 1AOIA 4G92B 5B2IC 4Z66C 2AROA 2PYOC 2Y2KA 5GT3A 1P3LC 1AOID 4CSRA 5DNNB 1P3PB 2AROD 1P3MA 5GT3D 3AYWD 3LELA 4YM6C 3X1TB 5CPKB 1P3MD 3W96A 3RELC 5GSUA 3LELD 3AZKC 2NQBA 3WTPA 5E5AA 3B0CT 2Y2IA 3W96D 3EPJA 5GSUD 3AZJB 2NQBD 3WTPD 5E5AD 2VQRA 3AZFC 4G91C 1P3OC 1N1JA 5DNMA 4XZQA 5B31G 3REKB 2F8NH 3LJAB 2L5AA 5DNMD 4XZQD 1BH9B 5AV5A 3MGSC 2XD1A 3AV1A 1P3GC 5AV5D 5JA4B 3AZNB 4CAYB 5B1LC 3LZ1B 3AV1D 3MNNC 5CP6B 5B2IA 1P3KC 4Z66A 1M18B 1P3LA 5B24C 5B2ID 3A1KA 4Z66D 1M1AB 1P3LD 4YM6A 2Y2JA 1P3IA 4LD9C 5AV8C 5GXQC 1HQ3B 4J8WB 3AZKA 4YM6D 2CV5B 3AFAC 1P3ID 3REJB 1KX5B 3KUYB 4G92C 3AZKD 4WV4B 1ULYA 5BO0A 5DNNC 1P3PC 1P3OA 5CPKC 3AZFD 2F8NK 1P3OD 3B6GB 2NZDB 4WU8B 5G49A 3AZMB 3R45A 1BH8B 4J8UB 5B1MA 1TZYB 3B0CW 5B1LA 5B1MD 3EG5B 5B31B 3MNNA 3MGPB 2ZY4A 2JE5A 5B1LD 3LJAC 4Z5TA 1P3KA 3MNND 3LZ0A 3A6NB 2PYOB 3WKJB 4WJ3C 5C3IB 1P3KD 3VH6W 5AV6C 3LZ0D 3AZNC 3C1CA 2RVQC 4X23B 5GXQA 1P34B 3C1CD 5CP6C 4XUJC 2HUEB 5GXQD 1BFMA 1M18C 3B0DB 4H9SC 2BYKB 5DNNA 1B67A 1P3PA 1M1AC 4KUDB 3MVDC 1U35B 5DNND 3REIA 2BYMB 3X1TA 5CPKA 1P3PD 1HQ3C 2Y2QA 3AZHB 5F99A 3UTBB 3X1TD 5CPKD 1KX5C 3MGSB 3KUYC 3AZJA 5F99D 1P3GB 3AZJD 4WU9B 5B0ZB 2G5HC 1EQZA 3KSYA 3REKA 3LJAA 3TU4B 1EQZD 3B6GC 3REKD 1BH9A 4QLCC 3AZLB 3AZMC 5B33C 3LJAD 2ZM5A 3VH6A 3FDDA 5JRGA 4J8UC 5CPJB 5B24B 4H9RB 3AZNA 5JA4A 2DF4C 5GT0B 4YS3A 4CAYA 3LZ1A 3VH5A 4UPKA 5AV8B 4E45A 5B31C 3AZND 4LD9B 3MGPC 5CP6A 4YS3D 4Z2MG 3LZ1D 3AFAB 1M18A 5CP6D 3A6NC 4H9SA 3AYWA 3WKJC 5C3IC 4WNNB 1M18D 2YFVB 1P3BA 3X1UB 4X23C 2ZY3A 1HQ3A 1P34C 4J8WA 2CV5A 1P3BD 5BT1C 2HUEC 3REJA 1KX5A 1HQ3D 5AV9A 3KUYA 4J8WD 2CV5D 3B0DC 3REJD 1KX5D 4ZBJB 5AV9D 3KUYD 4KUDC 3X1SB 2ZY5A 1P3AB 2IO5C 1U35C 2FJ7B 3MGRC 3AZHC 4JJNB 3B6GA 2NZDA 4KHAB 1H3OB 4WU8A 3UTBC 4J8UA 3B6GD 2NZDD 4WU8D 5AV6B 2XD5A 1TZYA 4H9NB 4UUZB 4J8UD 4H9QB 4WU9C 5B0ZC 1S32B 5B31A 4H9OB 3MGPA 1P3FB 1TZYD 4J8VC 1M19B 2HIOB 3EPHA 3TU4C 3EPLA 4XUJB 5B31D 3MGPD 3A6NA 3AZLC 2PYOA 3WKJA 3AZIB 5CPJC 1JFIB 1ID3C 1A7WA 2Y2HA 5AVCB 3A6ND 2PYOD 1WWSA 3WKJD 5CPIC 5GT0C 3MVDB 1P34A 5BNXB 3RELA 3WAAB 1P34D 3P5JB 3AZGB 3RELD 2BYKA 4E44A 1KX3B 4KUDA 2F2AC 3X1UC 3UT9C 3AZFA 3AN2B 1U35A 1KX4B 4J8XC 2BYMA 1AOIB 4KUDD 3AV2B 3AZHA 3W97B 3UTBA 1U35D 4QLCB 3MGSA 3AZHD 5B33B 1P3MB 3UTBD 1P3GA 3W98B 2Y2PA 3MGSD 4ZBJC 2JCHA 1TAFB 3X1UA 3X1SC 2Y2OA 5B0ZA 3W96B 1P3AC 1P3GD 5E5AB 3TU4A 2FJ7C 5B0ZD 4AWLB 4JJNC 3NQUB 3NQJB 3TU4D 5CPJA 5B24A 4H9RA 3KWQB 5GT0A 5CPJD 5B24D 3UTAB 1S32C 5AV8A 4LD9A 1F66C 1P3FC 1M19C 5GT0D 2HIOC 1B6WA 4H9PA 3AFAA 3EPKA 4LD9D 5AV8D 1T3UA 3WTPE 3AFAD 3O62B 4WNNA 3AZIC 5B40C 5AVBB 5AVCC 2YFVA 1Z2CB 4DRAA 5KDMB 2IO5B 3MGRB 3REHC 3WAAC 3AZGC 3W99C 1P3IB 1KX3C 1P3AA 3AN2C 1KX4C 1AOIC 2FJ7A 4J8VB 3AV2C 3X1SD 5BS7C 4KHAA 1R4VA 1H3OA 1P3AD 2YFWB 3W97C 2FJ7D 5BO0B 1P3MC 5AV6A 4R8PB 1ID3B 3W98C 3WA9B 3B0BA 4H9NA 4UUZA 2Y2NA 3H0RC 5CPIB 4H9QA 3W96C 2Y2GA 4H9OA 2ZY2A 5AV6D 3MGQB 1P3FA 1M19A 2HIOA 5E5AC 2RVQD 4XUJA 1S32D 3C1BB 4AWLC 2F8NG 5CHLB 1P3FD 1M19D 5B1MB 2HIOD 1ZLAB 5B32G 4XUJD 1JFIA 5AY8B 5AVCA 3KWQC 1M1AA 2G5IC 3MVDA 3UT9B 5FUGB 3F6TA 4Z5TB 3UTAC 4J8XB 5AVCD 1M1AD 3WAAA 3MVDD 2LY8A 3WAAD 1KX3A 3O62C 5AVBC 3AN2A 1KX4A 1KX3D 3AV2A 5BS7A 1WWIA 3V9RB 3W97A 3AN2D 4ZUXB 1KX4D 4NE6A 4QLCA 3AV2D 3AZMA 5B33A 1BH8A 3W97D 4WZSB 4DQYB 3W98A 3A1IA 4QLCD 1P3IC 3AZMD 2Y2LA 1HTAA 5B33D 5B0YB 1TAFA 3REIB 5BNVB 2FFFB 3W98D 5F99B 1F66B 4HGAC 5B2JB 4KGCB 3NQUA 3NQJA 2DQNC 2CWEA 3X1VB 5B40B 3KWQA 4R8PC 1EQZB 3WA9C 4EO5C 4Z2MH 4X23A 3UTAA 3VH6T 3KWQD 2J8PA 3MGQC 3B6FB 3REHB 4NFTA 4X23D 3UTAD 2F8NB 5JRGB 3C1BC 5B1MC 3VH5T 5B32B 3KXBB 5BT1D 1ZLAC 4YS3B 3O62A 3AZEB 3W99B 4DRBA 5AY8C 5AVBA 1F1EA 1Q9CA 5KDMA 3O62D 4Z5TC 5AVBD 3MGRA 3LZ0C 2AROB 5GT3B 3AYWB 4CSRB 3MGRD 3C1CC 1P3BB 3LELB 4WU9A 1PZRA 5GSUB 4J8VA 2NQBB 3WTPB 5AV9B 4WU9D 4ZUXC 2YFWA 4J8VD 3AZLA 4R8PA 1ID3A 3WA9A 3AL0C 3AZLD 1N1JB 5B0YC 4XZQB 5DNMB 3REIC 2JSSA 3X1TC 5CPIA 3H0LC 4R8PD 1ID3D 3MGQA 3WA9D 5F99C 5B2JC 5CPID 5AV5B 3C1BA 3AZJC 3MGQD 3AV1B 3H0MC 4KGCC 1ZLAA 3C1BD 4NE5A 5AY8A 3X1VC 1EQZC 1ZLAD 3REKC 3UT9A 5FUGA
chains in the Genus database with same CATH topology
5AY8D 4J8XA 3B6FC 5B2IB 4Z66B 3UT9D 3X1UD 4Z5TD 1P3LB 4J8XD 5JRGC 2Y2MA 3KFUG 3KXBC 5B32C 4YS3C 4YM6B 3LZ1C 3AZEC 2BG1A 3X1SA 3VH5W 3RELB 3AZKB 4HGAB 3V9RA 2RIQA 4ZUXA 4JJNA 2AROC 3IP4C 5GT3C 3AYWC 4ZUXD 4JJND 3AZFB 1P3BC 4G91B 3LELC 1P3OB 5B0YA 4EO5B 5BNVA 4J8WC 2CV5C 1W2EA 1S32A 1KU5A 5GSUC 1F66A 5B0YD 5B2JA 3REID 3REJC 3WTPC 2NQBC 5G49B 5AV9C 3R45B 4KGCA 1F66D 5B2JD 5B1LB 2UWXA 5B40A 3AZIA 3X1VA 4KGCD 5DNMC 4M6BA 4XZQC 3MNNB 3AZID 3X1VD 5B40D 2NZDC 3B6FA 1P3KB 3REHA 4WU8C 5BNXA 3LZ0B 2F8NA 5AV5C 3AV1C 3B6FD 3REHD 3KXBA 5B32A 3AZGA 1TZYC 2F8ND 3C1CB 5JRGD 3AZEA 3W99A 5GXQB 3KXBD 5B32D 3AZGD 2W8SA 4NE3A 4H9PB 3W99D 3AZED 1AOIA 4G92B 5B2IC 4Z66C 2AROA 2PYOC 2Y2KA 5GT3A 1P3LC 1AOID 4CSRA 5DNNB 1P3PB 2AROD 1P3MA 5GT3D 3AYWD 3LELA 4YM6C 3X1TB 5CPKB 1P3MD 3W96A 3RELC 5GSUA 3LELD 3AZKC 2NQBA 3WTPA 5E5AA 3B0CT 2Y2IA 3W96D 3EPJA 5GSUD 3AZJB 2NQBD 3WTPD 5E5AD 2VQRA 3AZFC 4G91C 1P3OC 1N1JA 5DNMA 4XZQA 5B31G 3REKB 2F8NH 3LJAB 2L5AA 5DNMD 4XZQD 1BH9B 5AV5A 3MGSC 2XD1A 3AV1A 1P3GC 5AV5D 5JA4B 3AZNB 4CAYB 5B1LC 3LZ1B 3AV1D 3MNNC 5CP6B 5B2IA 1P3KC 4Z66A 1M18B 1P3LA 5B24C 5B2ID 3A1KA 4Z66D 1M1AB 1P3LD 4YM6A 2Y2JA 1P3IA 4LD9C 5AV8C 5GXQC 1HQ3B 4J8WB 3AZKA 4YM6D 2CV5B 3AFAC 1P3ID 3REJB 1KX5B 3KUYB 4G92C 3AZKD 4WV4B 1ULYA 5BO0A 5DNNC 1P3PC 1P3OA 5CPKC 3AZFD 2F8NK 1P3OD 3B6GB 2NZDB 4WU8B 5G49A 3AZMB 3R45A 1BH8B 4J8UB 5B1MA 1TZYB 3B0CW 5B1LA 5B1MD 3EG5B 5B31B 3MNNA 3MGPB 2ZY4A 2JE5A 5B1LD 3LJAC 4Z5TA 1P3KA 3MNND 3LZ0A 3A6NB 2PYOB 3WKJB 4WJ3C 5C3IB 1P3KD 3VH6W 5AV6C 3LZ0D 3AZNC 3C1CA 2RVQC 4X23B 5GXQA 1P34B 3C1CD 5CP6C 4XUJC 2HUEB 5GXQD 1BFMA 1M18C 3B0DB 4H9SC 2BYKB 5DNNA 1B67A 1P3PA 1M1AC 4KUDB 3MVDC 1U35B 5DNND 3REIA 2BYMB 3X1TA 5CPKA 1P3PD 1HQ3C 2Y2QA 3AZHB 5F99A 3UTBB 3X1TD 5CPKD 1KX5C 3MGSB 3KUYC 3AZJA 5F99D 1P3GB 3AZJD 4WU9B 5B0ZB 2G5HC 1EQZA 3KSYA 3REKA 3LJAA 3TU4B 1EQZD 3B6GC 3REKD 1BH9A 4QLCC 3AZLB 3AZMC 5B33C 3LJAD 2ZM5A 3VH6A 3FDDA 5JRGA 4J8UC 5CPJB 5B24B 4H9RB 3AZNA 5JA4A 2DF4C 5GT0B 4YS3A 4CAYA 3LZ1A 3VH5A 4UPKA 5AV8B 4E45A 5B31C 3AZND 4LD9B 3MGPC 5CP6A 4YS3D 4Z2MG 3LZ1D 3AFAB 1M18A 5CP6D 3A6NC 4H9SA 3AYWA 3WKJC 5C3IC 4WNNB 1M18D 2YFVB 1P3BA 3X1UB 4X23C 2ZY3A 1HQ3A 1P34C 4J8WA 2CV5A 1P3BD 5BT1C 2HUEC 3REJA 1KX5A 1HQ3D 5AV9A 3KUYA 4J8WD 2CV5D 3B0DC 3REJD 1KX5D 4ZBJB 5AV9D 3KUYD 4KUDC 3X1SB 2ZY5A 1P3AB 2IO5C 1U35C 2FJ7B 3MGRC 3AZHC 4JJNB 3B6GA 2NZDA 4KHAB 1H3OB 4WU8A 3UTBC 4J8UA 3B6GD 2NZDD 4WU8D 5AV6B 2XD5A 1TZYA 4H9NB 4UUZB 4J8UD 4H9QB 4WU9C 5B0ZC 1S32B 5B31A 4H9OB 3MGPA 1P3FB 1TZYD 4J8VC 1M19B 2HIOB 3EPHA 3TU4C 3EPLA 4XUJB 5B31D 3MGPD 3A6NA 3AZLC 2PYOA 3WKJA 3AZIB 5CPJC 1JFIB 1ID3C 1A7WA 2Y2HA 5AVCB 3A6ND 2PYOD 1WWSA 3WKJD 5CPIC 5GT0C 3MVDB 1P34A 5BNXB 3RELA 3WAAB 1P34D 3P5JB 3AZGB 3RELD 2BYKA 4E44A 1KX3B 4KUDA 2F2AC 3X1UC 3UT9C 3AZFA 3AN2B 1U35A 1KX4B 4J8XC 2BYMA 1AOIB 4KUDD 3AV2B 3AZHA 3W97B 3UTBA 1U35D 4QLCB 3MGSA 3AZHD 5B33B 1P3MB 3UTBD 1P3GA 3W98B 2Y2PA 3MGSD 4ZBJC 2JCHA 1TAFB 3X1UA 3X1SC 2Y2OA 5B0ZA 3W96B 1P3AC 1P3GD 5E5AB 3TU4A 2FJ7C 5B0ZD 4AWLB 4JJNC 3NQUB 3NQJB 3TU4D 5CPJA 5B24A 4H9RA 3KWQB 5GT0A 5CPJD 5B24D 3UTAB 1S32C 5AV8A 4LD9A 1F66C 1P3FC 1M19C 5GT0D 2HIOC 1B6WA 4H9PA 3AFAA 3EPKA 4LD9D 5AV8D 1T3UA 3WTPE 3AFAD 3O62B 4WNNA 3AZIC 5B40C 5AVBB 5AVCC 2YFVA 1Z2CB 4DRAA 5KDMB 2IO5B 3MGRB 3REHC 3WAAC 3AZGC 3W99C 1P3IB 1KX3C 1P3AA 3AN2C 1KX4C 1AOIC 2FJ7A 4J8VB 3AV2C 3X1SD 5BS7C 4KHAA 1R4VA 1H3OA 1P3AD 2YFWB 3W97C 2FJ7D 5BO0B 1P3MC 5AV6A 4R8PB 1ID3B 3W98C 3WA9B 3B0BA 4H9NA 4UUZA 2Y2NA 3H0RC 5CPIB 4H9QA 3W96C 2Y2GA 4H9OA 2ZY2A 5AV6D 3MGQB 1P3FA 1M19A 2HIOA 5E5AC 2RVQD 4XUJA 1S32D 3C1BB 4AWLC 2F8NG 5CHLB 1P3FD 1M19D 5B1MB 2HIOD 1ZLAB 5B32G 4XUJD 1JFIA 5AY8B 5AVCA 3KWQC 1M1AA 2G5IC 3MVDA 3UT9B 5FUGB 3F6TA 4Z5TB 3UTAC 4J8XB 5AVCD 1M1AD 3WAAA 3MVDD 2LY8A 3WAAD 1KX3A 3O62C 5AVBC 3AN2A 1KX4A 1KX3D 3AV2A 5BS7A 1WWIA 3V9RB 3W97A 3AN2D 4ZUXB 1KX4D 4NE6A 4QLCA 3AV2D 3AZMA 5B33A 1BH8A 3W97D 4WZSB 4DQYB 3W98A 3A1IA 4QLCD 1P3IC 3AZMD 2Y2LA 1HTAA 5B33D 5B0YB 1TAFA 3REIB 5BNVB 2FFFB 3W98D 5F99B 1F66B 4HGAC 5B2JB 4KGCB 3NQUA 3NQJA 2DQNC 2CWEA 3X1VB 5B40B 3KWQA 4R8PC 1EQZB 3WA9C 4EO5C 4Z2MH 4X23A 3UTAA 3VH6T 3KWQD 2J8PA 3MGQC 3B6FB 3REHB 4NFTA 4X23D 3UTAD 2F8NB 5JRGB 3C1BC 5B1MC 3VH5T 5B32B 3KXBB 5BT1D 1ZLAC 4YS3B 3O62A 3AZEB 3W99B 4DRBA 5AY8C 5AVBA 1F1EA 1Q9CA 5KDMA 3O62D 4Z5TC 5AVBD 3MGRA 3LZ0C 2AROB 5GT3B 3AYWB 4CSRB 3MGRD 3C1CC 1P3BB 3LELB 4WU9A 1PZRA 5GSUB 4J8VA 2NQBB 3WTPB 5AV9B 4WU9D 4ZUXC 2YFWA 4J8VD 3AZLA 4R8PA 1ID3A 3WA9A 3AL0C 3AZLD 1N1JB 5B0YC 4XZQB 5DNMB 3REIC 2JSSA 3X1TC 5CPIA 3H0LC 4R8PD 1ID3D 3MGQA 3WA9D 5F99C 5B2JC 5CPID 5AV5B 3C1BA 3AZJC 3MGQD 3AV1B 3H0MC 4KGCC 1ZLAA 3C1BD 4NE5A 5AY8A 3X1VC 1EQZC 1ZLAD 3REKC 3UT9A 5FUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 D;  4J8X A;  3B6F C;  5B2I B;  4Z66 B;  3UT9 D;  3X1U D;  4Z5T D;  1P3L B;  4J8X D;  5JRG C;  3KXB C;  5B32 C;  4YS3 C;  4YM6 B;  3LZ1 C;  3AZE C;  3X1S A;  3VH5 W;  3REL B;  3AZK B;  4HGA B;  3V9R A;  4ZUX A;  4JJN A;  2ARO C;  5GT3 C;  3AYW C;  4ZUX D;  4JJN D;  3AZF B;  1P3B C;  4G91 B;  3LEL C;  1P3O B;  5B0Y A;  4EO5 B;  5BNV A;  4J8W C;  2CV5 C;  1S32 A;  1KU5 A;  5GSU C;  1F66 A;  5B0Y D;  5B2J A;  3REI D;  3REJ C;  3WTP C;  2NQB C;  5G49 B;  5AV9 C;  3R45 B;  4KGC A;  1F66 D;  5B2J D;  5B1L B;  3AZI A;  5B40 A;  3X1V A;  4KGC D;  5DNM C;  4M6B A;  4XZQ C;  3MNN B;  3AZI D;  3X1V D;  5B40 D;  2NZD C;  3B6F A;  1P3K B;  3REH A;  4WU8 C;  5BNX A;  3LZ0 B;  2F8N A;  5AV5 C;  3AV1 C;  3B6F D;  3REH D;  3KXB A;  5B32 A;  3AZG A;  1TZY C;  2F8N D;  3C1C B;  5JRG D;  3AZE A;  3W99 A;  5GXQ B;  3KXB D;  5B32 D;  3AZG D;  4NE3 A;  4H9P B;  3W99 D;  3AZE D;  1AOI A;  4G92 B;  5B2I C;  4Z66 C;  2ARO A;  2PYO C;  5GT3 A;  1P3L C;  1AOI D;  4CSR A;  5DNN B;  1P3P B;  2ARO D;  1P3M A;  5GT3 D;  3AYW D;  3LEL A;  4YM6 C;  3X1T B;  5CPK B;  1P3M D;  3W96 A;  3REL C;  5GSU A;  3LEL D;  3AZK C;  2NQB A;  3WTP A;  5E5A A;  3B0C T;  3W96 D;  5GSU D;  3AZJ B;  2NQB D;  3WTP D;  5E5A D;  3AZF C;  4G91 C;  1P3O C;  1N1J A;  5DNM A;  4XZQ A;  5B31 G;  3REK B;  2F8N H;  3LJA B;  2L5A A;  5DNM D;  4XZQ D;  1BH9 B;  5AV5 A;  3MGS C;  3AV1 A;  1P3G C;  5AV5 D;  5JA4 B;  3AZN B;  4CAY B;  5B1L C;  3LZ1 B;  3AV1 D;  3MNN C;  5CP6 B;  5B2I A;  1P3K C;  4Z66 A;  1M18 B;  1P3L A;  5B24 C;  5B2I D;  4Z66 D;  1M1A B;  1P3L D;  4YM6 A;  1P3I A;  4LD9 C;  5AV8 C;  5GXQ C;  1HQ3 B;  4J8W B;  3AZK A;  4YM6 D;  2CV5 B;  3AFA C;  1P3I D;  3REJ B;  1KX5 B;  3KUY B;  4G92 C;  3AZK D;  4WV4 B;  1ULY A;  5BO0 A;  5DNN C;  1P3P C;  1P3O A;  5CPK C;  3AZF D;  2F8N K;  1P3O D;  3B6G B;  2NZD B;  4WU8 B;  5G49 A;  3AZM B;  3R45 A;  1BH8 B;  4J8U B;  5B1M A;  1TZY B;  3B0C W;  5B1L A;  5B1M D;  5B31 B;  3MNN A;  3MGP B;  5B1L D;  3LJA C;  4Z5T A;  1P3K A;  3MNN D;  3LZ0 A;  3A6N B;  2PYO B;  3WKJ B;  5C3I B;  1P3K D;  3VH6 W;  5AV6 C;  3LZ0 D;  3AZN C;  3C1C A;  2RVQ C;  4X23 B;  5GXQ A;  1P34 B;  3C1C D;  5CP6 C;  4XUJ C;  2HUE B;  5GXQ D;  1BFM A;  1M18 C;  3B0D B;  4H9S C;  2BYK B;  5DNN A;  1B67 A;  1P3P A;  1M1A C;  4KUD B;  3MVD C;  1U35 B;  5DNN D;  3REI A;  2BYM B;  3X1T A;  5CPK A;  1P3P D;  1HQ3 C;  3AZH B;  5F99 A;  3UTB B;  3X1T D;  5CPK D;  1KX5 C;  3MGS B;  3KUY C;  3AZJ A;  5F99 D;  1P3G B;  3AZJ D;  4WU9 B;  5B0Z B;  1EQZ A;  3KSY A;  3REK A;  3LJA A;  3TU4 B;  1EQZ D;  3B6G C;  3REK D;  1BH9 A;  4QLC C;  3AZL B;  3AZM C;  5B33 C;  3LJA D;  3VH6 A;  5JRG A;  4J8U C;  5CPJ B;  5B24 B;  4H9R B;  3AZN A;  5JA4 A;  5GT0 B;  4YS3 A;  4CAY A;  3LZ1 A;  3VH5 A;  4E45 A;  5AV8 B;  4LD9 B;  5B31 C;  3AZN D;  3MGP C;  5CP6 A;  4YS3 D;  4Z2M G;  3LZ1 D;  3AFA B;  1M18 A;  5CP6 D;  3A6N C;  4H9S A;  3AYW A;  3WKJ C;  5C3I C;  4WNN B;  1M18 D;  2YFV B;  1P3B A;  3X1U B;  4X23 C;  1HQ3 A;  1P34 C;  4J8W A;  2CV5 A;  1P3B D;  5BT1 C;  2HUE C;  3REJ A;  1KX5 A;  1HQ3 D;  5AV9 A;  3KUY A;  4J8W D;  2CV5 D;  3B0D C;  3REJ D;  1KX5 D;  4ZBJ B;  5AV9 D;  3KUY D;  4KUD C;  3X1S B;  1P3A B;  2IO5 C;  1U35 C;  2FJ7 B;  3MGR C;  3AZH C;  4JJN B;  3B6G A;  2NZD A;  4KHA B;  1H3O B;  4WU8 A;  3UTB C;  4J8U A;  3B6G D;  2NZD D;  4WU8 D;  5AV6 B;  1TZY A;  4H9N B;  4UUZ B;  4J8U D;  4H9Q B;  4WU9 C;  5B0Z C;  1S32 B;  5B31 A;  4H9O B;  3MGP A;  1P3F B;  1TZY D;  4J8V C;  1M19 B;  2HIO B;  3TU4 C;  4XUJ B;  5B31 D;  3MGP D;  3A6N A;  3AZL C;  2PYO A;  3WKJ A;  3AZI B;  5CPJ C;  1JFI B;  1ID3 C;  1A7W A;  5AVC B;  3A6N D;  2PYO D;  1WWS A;  3WKJ D;  5CPI C;  5GT0 C;  3MVD B;  1P34 A;  5BNX B;  3REL A;  3WAA B;  1P34 D;  3AZG B;  3REL D;  2BYK A;  4E44 A;  1KX3 B;  4KUD A;  3UT9 C;  3X1U C;  3AZF A;  3AN2 B;  1U35 A;  1KX4 B;  4J8X C;  2BYM A;  1AOI B;  4KUD D;  3AV2 B;  3AZH A;  3W97 B;  3UTB A;  1U35 D;  4QLC B;  3MGS A;  3AZH D;  5B33 B;  1P3M B;  3UTB D;  1P3G A;  3W98 B;  3MGS D;  4ZBJ C;  1TAF B;  3X1S C;  5B0Z A;  3W96 B;  1P3A C;  1P3G D;  5E5A B;  3TU4 A;  2FJ7 C;  5B0Z D;  4AWL B;  4JJN C;  3NQU B;  3NQJ B;  3TU4 D;  5CPJ A;  5B24 A;  4H9R A;  3KWQ B;  5GT0 A;  5CPJ D;  5B24 D;  3UTA B;  1S32 C;  5AV8 A;  4LD9 A;  1F66 C;  1P3F C;  1M19 C;  5GT0 D;  2HIO C;  1B6W A;  4H9P A;  3AFA A;  4LD9 D;  5AV8 D;  3WTP E;  3AFA D;  3O62 B;  4WNN A;  3AZI C;  5B40 C;  5AVB B;  5AVC C;  2YFV A;  4DRA A;  5KDM B;  2IO5 B;  3MGR B;  3REH C;  3WAA C;  3AZG C;  3W99 C;  1P3I B;  1KX3 C;  1P3A A;  3AN2 C;  1KX4 C;  1AOI C;  2FJ7 A;  4J8V B;  3AV2 C;  3X1S D;  5BS7 C;  4KHA A;  1R4V A;  1H3O A;  1P3A D;  2YFW B;  3W97 C;  2FJ7 D;  5BO0 B;  1P3M C;  4R8P B;  5AV6 A;  1ID3 B;  3W98 C;  3WA9 B;  3B0B A;  4H9N A;  4UUZ A;  5CPI B;  4H9Q A;  3W96 C;  5AV6 D;  4H9O A;  3MGQ B;  1P3F A;  1M19 A;  2HIO A;  5E5A C;  2RVQ D;  4XUJ A;  1S32 D;  3C1B B;  4AWL C;  2F8N G;  5CHL B;  1P3F D;  1M19 D;  5B1M B;  2HIO D;  1ZLA B;  5B32 G;  4XUJ D;  1JFI A;  5AY8 B;  5AVC A;  3KWQ C;  1M1A A;  3MVD A;  3UT9 B;  5FUG B;  4Z5T B;  3UTA C;  4J8X B;  5AVC D;  1M1A D;  3WAA A;  3MVD D;  2LY8 A;  3WAA D;  1KX3 A;  3O62 C;  5AVB C;  3AN2 A;  1KX4 A;  1KX3 D;  3AV2 A;  5BS7 A;  1WWI A;  3V9R B;  3W97 A;  3AN2 D;  4ZUX B;  1KX4 D;  4NE6 A;  4QLC A;  3AV2 D;  3AZM A;  5B33 A;  1BH8 A;  3W97 D;  4WZS B;  3W98 A;  4QLC D;  1P3I C;  3AZM D;  1HTA A;  5B33 D;  5B0Y B;  1TAF A;  3REI B;  5BNV B;  3W98 D;  5F99 B;  1F66 B;  4HGA C;  5B2J B;  4KGC B;  3NQU A;  3NQJ A;  2CWE A;  3X1V B;  5B40 B;  3KWQ A;  4R8P C;  1EQZ B;  3WA9 C;  4EO5 C;  4Z2M H;  4X23 A;  3UTA A;  3VH6 T;  3KWQ D;  3MGQ C;  3B6F B;  3REH B;  4NFT A;  4X23 D;  3UTA D;  2F8N B;  5JRG B;  3C1B C;  5B1M C;  3VH5 T;  5B32 B;  3KXB B;  5BT1 D;  1ZLA C;  4YS3 B;  3O62 A;  3AZE B;  3W99 B;  4DRB A;  5AY8 C;  5AVB A;  1Q9C A;  1F1E A;  5KDM A;  3O62 D;  4Z5T C;  5AVB D;  3MGR A;  3LZ0 C;  2ARO B;  5GT3 B;  3AYW B;  4CSR B;  3MGR D;  3C1C C;  1P3B B;  3LEL B;  4WU9 A;  5GSU B;  4J8V A;  2NQB B;  3WTP B;  5AV9 B;  4WU9 D;  4ZUX C;  2YFW A;  4J8V D;  3AZL A;  4R8P A;  1ID3 A;  3WA9 A;  3AZL D;  5FUG A;  1N1J B;  5B0Y C;  4XZQ B;  5DNM B;  3REI C;  2JSS A;  3X1T C;  5CPI A;  4R8P D;  1ID3 D;  3MGQ A;  3WA9 D;  5F99 C;  5B2J C;  5CPI D;  5AV5 B;  3C1B A;  3AZJ C;  3MGQ D;  3AV1 B;  4KGC C;  1ZLA A;  3C1B D;  4NE5 A;  5AY8 A;  3X1V C;  1EQZ C;  1ZLA D;  3REK C;  3UT9 A;  3X1U A; 
#chains in the Genus database with same CATH topology
 5AY8 D;  4J8X A;  3B6F C;  5B2I B;  4Z66 B;  3UT9 D;  3X1U D;  4Z5T D;  1P3L B;  4J8X D;  5JRG C;  2Y2M A;  3KFU G;  3KXB C;  5B32 C;  4YS3 C;  4YM6 B;  3LZ1 C;  3AZE C;  2BG1 A;  3X1S A;  3VH5 W;  3REL B;  3AZK B;  4HGA B;  3V9R A;  2RIQ A;  4ZUX A;  4JJN A;  2ARO C;  3IP4 C;  5GT3 C;  3AYW C;  4ZUX D;  4JJN D;  3AZF B;  1P3B C;  4G91 B;  3LEL C;  1P3O B;  5B0Y A;  4EO5 B;  5BNV A;  4J8W C;  2CV5 C;  1W2E A;  1S32 A;  1KU5 A;  5GSU C;  1F66 A;  5B0Y D;  5B2J A;  3REI D;  3REJ C;  3WTP C;  2NQB C;  5G49 B;  5AV9 C;  3R45 B;  4KGC A;  1F66 D;  5B2J D;  5B1L B;  2UWX A;  5B40 A;  3AZI A;  3X1V A;  4KGC D;  5DNM C;  4M6B A;  4XZQ C;  3MNN B;  3AZI D;  3X1V D;  5B40 D;  2NZD C;  3B6F A;  1P3K B;  3REH A;  4WU8 C;  5BNX A;  3LZ0 B;  2F8N A;  5AV5 C;  3AV1 C;  3B6F D;  3REH D;  3KXB A;  5B32 A;  3AZG A;  1TZY C;  2F8N D;  3C1C B;  5JRG D;  3AZE A;  3W99 A;  5GXQ B;  3KXB D;  5B32 D;  3AZG D;  2W8S A;  4NE3 A;  4H9P B;  3W99 D;  3AZE D;  1AOI A;  4G92 B;  5B2I C;  4Z66 C;  2ARO A;  2PYO C;  2Y2K A;  5GT3 A;  1P3L C;  1AOI D;  4CSR A;  5DNN B;  1P3P B;  2ARO D;  1P3M A;  5GT3 D;  3AYW D;  3LEL A;  4YM6 C;  3X1T B;  5CPK B;  1P3M D;  3W96 A;  3REL C;  5GSU A;  3LEL D;  3AZK C;  2NQB A;  3WTP A;  5E5A A;  3B0C T;  2Y2I A;  3W96 D;  3EPJ A;  5GSU D;  3AZJ B;  2NQB D;  3WTP D;  5E5A D;  2VQR A;  3AZF C;  4G91 C;  1P3O C;  1N1J A;  5DNM A;  4XZQ A;  5B31 G;  3REK B;  2F8N H;  3LJA B;  2L5A A;  5DNM D;  4XZQ D;  1BH9 B;  5AV5 A;  3MGS C;  2XD1 A;  3AV1 A;  1P3G C;  5AV5 D;  5JA4 B;  3AZN B;  4CAY B;  5B1L C;  3LZ1 B;  3AV1 D;  3MNN C;  5CP6 B;  5B2I A;  1P3K C;  4Z66 A;  1M18 B;  1P3L A;  5B24 C;  5B2I D;  3A1K A;  4Z66 D;  1M1A B;  1P3L D;  4YM6 A;  2Y2J A;  1P3I A;  4LD9 C;  5AV8 C;  5GXQ C;  1HQ3 B;  4J8W B;  3AZK A;  4YM6 D;  2CV5 B;  3AFA C;  1P3I D;  3REJ B;  1KX5 B;  3KUY B;  4G92 C;  3AZK D;  4WV4 B;  1ULY A;  5BO0 A;  5DNN C;  1P3P C;  1P3O A;  5CPK C;  3AZF D;  2F8N K;  1P3O D;  3B6G B;  2NZD B;  4WU8 B;  5G49 A;  3AZM B;  3R45 A;  1BH8 B;  4J8U B;  5B1M A;  1TZY B;  3B0C W;  5B1L A;  5B1M D;  3EG5 B;  5B31 B;  3MNN A;  3MGP B;  2ZY4 A;  2JE5 A;  5B1L D;  3LJA C;  4Z5T A;  1P3K A;  3MNN D;  3LZ0 A;  3A6N B;  2PYO B;  3WKJ B;  4WJ3 C;  5C3I B;  1P3K D;  3VH6 W;  5AV6 C;  3LZ0 D;  3AZN C;  3C1C A;  2RVQ C;  4X23 B;  5GXQ A;  1P34 B;  3C1C D;  5CP6 C;  4XUJ C;  2HUE B;  5GXQ D;  1BFM A;  1M18 C;  3B0D B;  4H9S C;  2BYK B;  5DNN A;  1B67 A;  1P3P A;  1M1A C;  4KUD B;  3MVD C;  1U35 B;  5DNN D;  3REI A;  2BYM B;  3X1T A;  5CPK A;  1P3P D;  1HQ3 C;  2Y2Q A;  3AZH B;  5F99 A;  3UTB B;  3X1T D;  5CPK D;  1KX5 C;  3MGS B;  3KUY C;  3AZJ A;  5F99 D;  1P3G B;  3AZJ D;  4WU9 B;  5B0Z B;  2G5H C;  1EQZ A;  3KSY A;  3REK A;  3LJA A;  3TU4 B;  1EQZ D;  3B6G C;  3REK D;  1BH9 A;  4QLC C;  3AZL B;  3AZM C;  5B33 C;  3LJA D;  2ZM5 A;  3VH6 A;  3FDD A;  5JRG A;  4J8U C;  5CPJ B;  5B24 B;  4H9R B;  3AZN A;  5JA4 A;  2DF4 C;  5GT0 B;  4YS3 A;  4CAY A;  3LZ1 A;  3VH5 A;  4UPK A;  5AV8 B;  4E45 A;  5B31 C;  3AZN D;  4LD9 B;  3MGP C;  5CP6 A;  4YS3 D;  4Z2M G;  3LZ1 D;  3AFA B;  1M18 A;  5CP6 D;  3A6N C;  4H9S A;  3AYW A;  3WKJ C;  5C3I C;  4WNN B;  1M18 D;  2YFV B;  1P3B A;  3X1U B;  4X23 C;  2ZY3 A;  1HQ3 A;  1P34 C;  4J8W A;  2CV5 A;  1P3B D;  5BT1 C;  2HUE C;  3REJ A;  1KX5 A;  1HQ3 D;  5AV9 A;  3KUY A;  4J8W D;  2CV5 D;  3B0D C;  3REJ D;  1KX5 D;  4ZBJ B;  5AV9 D;  3KUY D;  4KUD C;  3X1S B;  2ZY5 A;  1P3A B;  2IO5 C;  1U35 C;  2FJ7 B;  3MGR C;  3AZH C;  4JJN B;  3B6G A;  2NZD A;  4KHA B;  1H3O B;  4WU8 A;  3UTB C;  4J8U A;  3B6G D;  2NZD D;  4WU8 D;  5AV6 B;  2XD5 A;  1TZY A;  4H9N B;  4UUZ B;  4J8U D;  4H9Q B;  4WU9 C;  5B0Z C;  1S32 B;  5B31 A;  4H9O B;  3MGP A;  1P3F B;  1TZY D;  4J8V C;  1M19 B;  2HIO B;  3EPH A;  3TU4 C;  3EPL A;  4XUJ B;  5B31 D;  3MGP D;  3A6N A;  3AZL C;  2PYO A;  3WKJ A;  3AZI B;  5CPJ C;  1JFI B;  1ID3 C;  1A7W A;  2Y2H A;  5AVC B;  3A6N D;  2PYO D;  1WWS A;  3WKJ D;  5CPI C;  5GT0 C;  3MVD B;  1P34 A;  5BNX B;  3REL A;  3WAA B;  1P34 D;  3P5J B;  3AZG B;  3REL D;  2BYK A;  4E44 A;  1KX3 B;  4KUD A;  2F2A C;  3X1U C;  3UT9 C;  3AZF A;  3AN2 B;  1U35 A;  1KX4 B;  4J8X C;  2BYM A;  1AOI B;  4KUD D;  3AV2 B;  3AZH A;  3W97 B;  3UTB A;  1U35 D;  4QLC B;  3MGS A;  3AZH D;  5B33 B;  1P3M B;  3UTB D;  1P3G A;  3W98 B;  2Y2P A;  3MGS D;  4ZBJ C;  2JCH A;  1TAF B;  3X1U A;  3X1S C;  2Y2O A;  5B0Z A;  3W96 B;  1P3A C;  1P3G D;  5E5A B;  3TU4 A;  2FJ7 C;  5B0Z D;  4AWL B;  4JJN C;  3NQU B;  3NQJ B;  3TU4 D;  5CPJ A;  5B24 A;  4H9R A;  3KWQ B;  5GT0 A;  5CPJ D;  5B24 D;  3UTA B;  1S32 C;  5AV8 A;  4LD9 A;  1F66 C;  1P3F C;  1M19 C;  5GT0 D;  2HIO C;  1B6W A;  4H9P A;  3AFA A;  3EPK A;  4LD9 D;  5AV8 D;  1T3U A;  3WTP E;  3AFA D;  3O62 B;  4WNN A;  3AZI C;  5B40 C;  5AVB B;  5AVC C;  2YFV A;  1Z2C B;  4DRA A;  5KDM B;  2IO5 B;  3MGR B;  3REH C;  3WAA C;  3AZG C;  3W99 C;  1P3I B;  1KX3 C;  1P3A A;  3AN2 C;  1KX4 C;  1AOI C;  2FJ7 A;  4J8V B;  3AV2 C;  3X1S D;  5BS7 C;  4KHA A;  1R4V A;  1H3O A;  1P3A D;  2YFW B;  3W97 C;  2FJ7 D;  5BO0 B;  1P3M C;  5AV6 A;  4R8P B;  1ID3 B;  3W98 C;  3WA9 B;  3B0B A;  4H9N A;  4UUZ A;  2Y2N A;  3H0R C;  5CPI B;  4H9Q A;  3W96 C;  2Y2G A;  4H9O A;  2ZY2 A;  5AV6 D;  3MGQ B;  1P3F A;  1M19 A;  2HIO A;  5E5A C;  2RVQ D;  4XUJ A;  1S32 D;  3C1B B;  4AWL C;  2F8N G;  5CHL B;  1P3F D;  1M19 D;  5B1M B;  2HIO D;  1ZLA B;  5B32 G;  4XUJ D;  1JFI A;  5AY8 B;  5AVC A;  3KWQ C;  1M1A A;  2G5I C;  3MVD A;  3UT9 B;  5FUG B;  3F6T A;  4Z5T B;  3UTA C;  4J8X B;  5AVC D;  1M1A D;  3WAA A;  3MVD D;  2LY8 A;  3WAA D;  1KX3 A;  3O62 C;  5AVB C;  3AN2 A;  1KX4 A;  1KX3 D;  3AV2 A;  5BS7 A;  1WWI A;  3V9R B;  3W97 A;  3AN2 D;  4ZUX B;  1KX4 D;  4NE6 A;  4QLC A;  3AV2 D;  3AZM A;  5B33 A;  1BH8 A;  3W97 D;  4WZS B;  4DQY B;  3W98 A;  3A1I A;  4QLC D;  1P3I C;  3AZM D;  2Y2L A;  1HTA A;  5B33 D;  5B0Y B;  1TAF A;  3REI B;  5BNV B;  2FFF B;  3W98 D;  5F99 B;  1F66 B;  4HGA C;  5B2J B;  4KGC B;  3NQU A;  3NQJ A;  2DQN C;  2CWE A;  3X1V B;  5B40 B;  3KWQ A;  4R8P C;  1EQZ B;  3WA9 C;  4EO5 C;  4Z2M H;  4X23 A;  3UTA A;  3VH6 T;  3KWQ D;  2J8P A;  3MGQ C;  3B6F B;  3REH B;  4NFT A;  4X23 D;  3UTA D;  2F8N B;  5JRG B;  3C1B C;  5B1M C;  3VH5 T;  5B32 B;  3KXB B;  5BT1 D;  1ZLA C;  4YS3 B;  3O62 A;  3AZE B;  3W99 B;  4DRB A;  5AY8 C;  5AVB A;  1F1E A;  1Q9C A;  5KDM A;  3O62 D;  4Z5T C;  5AVB D;  3MGR A;  3LZ0 C;  2ARO B;  5GT3 B;  3AYW B;  4CSR B;  3MGR D;  3C1C C;  1P3B B;  3LEL B;  4WU9 A;  1PZR A;  5GSU B;  4J8V A;  2NQB B;  3WTP B;  5AV9 B;  4WU9 D;  4ZUX C;  2YFW A;  4J8V D;  3AZL A;  4R8P A;  1ID3 A;  3WA9 A;  3AL0 C;  3AZL D;  1N1J B;  5B0Y C;  4XZQ B;  5DNM B;  3REI C;  2JSS A;  3X1T C;  5CPI A;  3H0L C;  4R8P D;  1ID3 D;  3MGQ A;  3WA9 D;  5F99 C;  5B2J C;  5CPI D;  5AV5 B;  3C1B A;  3AZJ C;  3MGQ D;  3AV1 B;  3H0M C;  4KGC C;  1ZLA A;  3C1B D;  4NE5 A;  5AY8 A;  3X1V C;  1EQZ C;  1ZLA D;  3REK C;  3UT9 A;  5FUG A; 
#chains in the Genus database with same CATH homology
 5AY8 D;  4J8X A;  3B6F C;  5B2I B;  4Z66 B;  3UT9 D;  3X1U D;  4Z5T D;  1P3L B;  4J8X D;  5JRG C;  2Y2M A;  3KFU G;  3KXB C;  5B32 C;  4YS3 C;  4YM6 B;  3LZ1 C;  3AZE C;  2BG1 A;  3X1S A;  3VH5 W;  3REL B;  3AZK B;  4HGA B;  3V9R A;  2RIQ A;  4ZUX A;  4JJN A;  2ARO C;  3IP4 C;  5GT3 C;  3AYW C;  4ZUX D;  4JJN D;  3AZF B;  1P3B C;  4G91 B;  3LEL C;  1P3O B;  5B0Y A;  4EO5 B;  5BNV A;  4J8W C;  2CV5 C;  1W2E A;  1S32 A;  1KU5 A;  5GSU C;  1F66 A;  5B0Y D;  5B2J A;  3REI D;  3REJ C;  3WTP C;  2NQB C;  5G49 B;  5AV9 C;  3R45 B;  4KGC A;  1F66 D;  5B2J D;  5B1L B;  2UWX A;  5B40 A;  3AZI A;  3X1V A;  4KGC D;  5DNM C;  4M6B A;  4XZQ C;  3MNN B;  3AZI D;  3X1V D;  5B40 D;  2NZD C;  3B6F A;  1P3K B;  3REH A;  4WU8 C;  5BNX A;  3LZ0 B;  2F8N A;  5AV5 C;  3AV1 C;  3B6F D;  3REH D;  3KXB A;  5B32 A;  3AZG A;  1TZY C;  2F8N D;  3C1C B;  5JRG D;  3AZE A;  3W99 A;  5GXQ B;  3KXB D;  5B32 D;  3AZG D;  2W8S A;  4NE3 A;  4H9P B;  3W99 D;  3AZE D;  1AOI A;  4G92 B;  5B2I C;  4Z66 C;  2ARO A;  2PYO C;  2Y2K A;  5GT3 A;  1P3L C;  1AOI D;  4CSR A;  5DNN B;  1P3P B;  2ARO D;  1P3M A;  5GT3 D;  3AYW D;  3LEL A;  4YM6 C;  3X1T B;  5CPK B;  1P3M D;  3W96 A;  3REL C;  5GSU A;  3LEL D;  3AZK C;  2NQB A;  3WTP A;  5E5A A;  3B0C T;  2Y2I A;  3W96 D;  3EPJ A;  5GSU D;  3AZJ B;  2NQB D;  3WTP D;  5E5A D;  2VQR A;  3AZF C;  4G91 C;  1P3O C;  1N1J A;  5DNM A;  4XZQ A;  5B31 G;  3REK B;  2F8N H;  3LJA B;  2L5A A;  5DNM D;  4XZQ D;  1BH9 B;  5AV5 A;  3MGS C;  2XD1 A;  3AV1 A;  1P3G C;  5AV5 D;  5JA4 B;  3AZN B;  4CAY B;  5B1L C;  3LZ1 B;  3AV1 D;  3MNN C;  5CP6 B;  5B2I A;  1P3K C;  4Z66 A;  1M18 B;  1P3L A;  5B24 C;  5B2I D;  3A1K A;  4Z66 D;  1M1A B;  1P3L D;  4YM6 A;  2Y2J A;  1P3I A;  4LD9 C;  5AV8 C;  5GXQ C;  1HQ3 B;  4J8W B;  3AZK A;  4YM6 D;  2CV5 B;  3AFA C;  1P3I D;  3REJ B;  1KX5 B;  3KUY B;  4G92 C;  3AZK D;  4WV4 B;  1ULY A;  5BO0 A;  5DNN C;  1P3P C;  1P3O A;  5CPK C;  3AZF D;  2F8N K;  1P3O D;  3B6G B;  2NZD B;  4WU8 B;  5G49 A;  3AZM B;  3R45 A;  1BH8 B;  4J8U B;  5B1M A;  1TZY B;  3B0C W;  5B1L A;  5B1M D;  3EG5 B;  5B31 B;  3MNN A;  3MGP B;  2ZY4 A;  2JE5 A;  5B1L D;  3LJA C;  4Z5T A;  1P3K A;  3MNN D;  3LZ0 A;  3A6N B;  2PYO B;  3WKJ B;  4WJ3 C;  5C3I B;  1P3K D;  3VH6 W;  5AV6 C;  3LZ0 D;  3AZN C;  3C1C A;  2RVQ C;  4X23 B;  5GXQ A;  1P34 B;  3C1C D;  5CP6 C;  4XUJ C;  2HUE B;  5GXQ D;  1BFM A;  1M18 C;  3B0D B;  4H9S C;  2BYK B;  5DNN A;  1B67 A;  1P3P A;  1M1A C;  4KUD B;  3MVD C;  1U35 B;  5DNN D;  3REI A;  2BYM B;  3X1T A;  5CPK A;  1P3P D;  1HQ3 C;  2Y2Q A;  3AZH B;  5F99 A;  3UTB B;  3X1T D;  5CPK D;  1KX5 C;  3MGS B;  3KUY C;  3AZJ A;  5F99 D;  1P3G B;  3AZJ D;  4WU9 B;  5B0Z B;  2G5H C;  1EQZ A;  3KSY A;  3REK A;  3LJA A;  3TU4 B;  1EQZ D;  3B6G C;  3REK D;  1BH9 A;  4QLC C;  3AZL B;  3AZM C;  5B33 C;  3LJA D;  2ZM5 A;  3VH6 A;  3FDD A;  5JRG A;  4J8U C;  5CPJ B;  5B24 B;  4H9R B;  3AZN A;  5JA4 A;  2DF4 C;  5GT0 B;  4YS3 A;  4CAY A;  3LZ1 A;  3VH5 A;  4UPK A;  5AV8 B;  4E45 A;  5B31 C;  3AZN D;  4LD9 B;  3MGP C;  5CP6 A;  4YS3 D;  4Z2M G;  3LZ1 D;  3AFA B;  1M18 A;  5CP6 D;  3A6N C;  4H9S A;  3AYW A;  3WKJ C;  5C3I C;  4WNN B;  1M18 D;  2YFV B;  1P3B A;  3X1U B;  4X23 C;  2ZY3 A;  1HQ3 A;  1P34 C;  4J8W A;  2CV5 A;  1P3B D;  5BT1 C;  2HUE C;  3REJ A;  1KX5 A;  1HQ3 D;  5AV9 A;  3KUY A;  4J8W D;  2CV5 D;  3B0D C;  3REJ D;  1KX5 D;  4ZBJ B;  5AV9 D;  3KUY D;  4KUD C;  3X1S B;  2ZY5 A;  1P3A B;  2IO5 C;  1U35 C;  2FJ7 B;  3MGR C;  3AZH C;  4JJN B;  3B6G A;  2NZD A;  4KHA B;  1H3O B;  4WU8 A;  3UTB C;  4J8U A;  3B6G D;  2NZD D;  4WU8 D;  5AV6 B;  2XD5 A;  1TZY A;  4H9N B;  4UUZ B;  4J8U D;  4H9Q B;  4WU9 C;  5B0Z C;  1S32 B;  5B31 A;  4H9O B;  3MGP A;  1P3F B;  1TZY D;  4J8V C;  1M19 B;  2HIO B;  3EPH A;  3TU4 C;  3EPL A;  4XUJ B;  5B31 D;  3MGP D;  3A6N A;  3AZL C;  2PYO A;  3WKJ A;  3AZI B;  5CPJ C;  1JFI B;  1ID3 C;  1A7W A;  2Y2H A;  5AVC B;  3A6N D;  2PYO D;  1WWS A;  3WKJ D;  5CPI C;  5GT0 C;  3MVD B;  1P34 A;  5BNX B;  3REL A;  3WAA B;  1P34 D;  3P5J B;  3AZG B;  3REL D;  2BYK A;  4E44 A;  1KX3 B;  4KUD A;  2F2A C;  3X1U C;  3UT9 C;  3AZF A;  3AN2 B;  1U35 A;  1KX4 B;  4J8X C;  2BYM A;  1AOI B;  4KUD D;  3AV2 B;  3AZH A;  3W97 B;  3UTB A;  1U35 D;  4QLC B;  3MGS A;  3AZH D;  5B33 B;  1P3M B;  3UTB D;  1P3G A;  3W98 B;  2Y2P A;  3MGS D;  4ZBJ C;  2JCH A;  1TAF B;  3X1U A;  3X1S C;  2Y2O A;  5B0Z A;  3W96 B;  1P3A C;  1P3G D;  5E5A B;  3TU4 A;  2FJ7 C;  5B0Z D;  4AWL B;  4JJN C;  3NQU B;  3NQJ B;  3TU4 D;  5CPJ A;  5B24 A;  4H9R A;  3KWQ B;  5GT0 A;  5CPJ D;  5B24 D;  3UTA B;  1S32 C;  5AV8 A;  4LD9 A;  1F66 C;  1P3F C;  1M19 C;  5GT0 D;  2HIO C;  1B6W A;  4H9P A;  3AFA A;  3EPK A;  4LD9 D;  5AV8 D;  1T3U A;  3WTP E;  3AFA D;  3O62 B;  4WNN A;  3AZI C;  5B40 C;  5AVB B;  5AVC C;  2YFV A;  1Z2C B;  4DRA A;  5KDM B;  2IO5 B;  3MGR B;  3REH C;  3WAA C;  3AZG C;  3W99 C;  1P3I B;  1KX3 C;  1P3A A;  3AN2 C;  1KX4 C;  1AOI C;  2FJ7 A;  4J8V B;  3AV2 C;  3X1S D;  5BS7 C;  4KHA A;  1R4V A;  1H3O A;  1P3A D;  2YFW B;  3W97 C;  2FJ7 D;  5BO0 B;  1P3M C;  5AV6 A;  4R8P B;  1ID3 B;  3W98 C;  3WA9 B;  3B0B A;  4H9N A;  4UUZ A;  2Y2N A;  3H0R C;  5CPI B;  4H9Q A;  3W96 C;  2Y2G A;  4H9O A;  2ZY2 A;  5AV6 D;  3MGQ B;  1P3F A;  1M19 A;  2HIO A;  5E5A C;  2RVQ D;  4XUJ A;  1S32 D;  3C1B B;  4AWL C;  2F8N G;  5CHL B;  1P3F D;  1M19 D;  5B1M B;  2HIO D;  1ZLA B;  5B32 G;  4XUJ D;  1JFI A;  5AY8 B;  5AVC A;  3KWQ C;  1M1A A;  2G5I C;  3MVD A;  3UT9 B;  5FUG B;  3F6T A;  4Z5T B;  3UTA C;  4J8X B;  5AVC D;  1M1A D;  3WAA A;  3MVD D;  2LY8 A;  3WAA D;  1KX3 A;  3O62 C;  5AVB C;  3AN2 A;  1KX4 A;  1KX3 D;  3AV2 A;  5BS7 A;  1WWI A;  3V9R B;  3W97 A;  3AN2 D;  4ZUX B;  1KX4 D;  4NE6 A;  4QLC A;  3AV2 D;  3AZM A;  5B33 A;  1BH8 A;  3W97 D;  4WZS B;  4DQY B;  3W98 A;  3A1I A;  4QLC D;  1P3I C;  3AZM D;  2Y2L A;  1HTA A;  5B33 D;  5B0Y B;  1TAF A;  3REI B;  5BNV B;  2FFF B;  3W98 D;  5F99 B;  1F66 B;  4HGA C;  5B2J B;  4KGC B;  3NQU A;  3NQJ A;  2DQN C;  2CWE A;  3X1V B;  5B40 B;  3KWQ A;  4R8P C;  1EQZ B;  3WA9 C;  4EO5 C;  4Z2M H;  4X23 A;  3UTA A;  3VH6 T;  3KWQ D;  2J8P A;  3MGQ C;  3B6F B;  3REH B;  4NFT A;  4X23 D;  3UTA D;  2F8N B;  5JRG B;  3C1B C;  5B1M C;  3VH5 T;  5B32 B;  3KXB B;  5BT1 D;  1ZLA C;  4YS3 B;  3O62 A;  3AZE B;  3W99 B;  4DRB A;  5AY8 C;  5AVB A;  1F1E A;  1Q9C A;  5KDM A;  3O62 D;  4Z5T C;  5AVB D;  3MGR A;  3LZ0 C;  2ARO B;  5GT3 B;  3AYW B;  4CSR B;  3MGR D;  3C1C C;  1P3B B;  3LEL B;  4WU9 A;  1PZR A;  5GSU B;  4J8V A;  2NQB B;  3WTP B;  5AV9 B;  4WU9 D;  4ZUX C;  2YFW A;  4J8V D;  3AZL A;  4R8P A;  1ID3 A;  3WA9 A;  3AL0 C;  3AZL D;  1N1J B;  5B0Y C;  4XZQ B;  5DNM B;  3REI C;  2JSS A;  3X1T C;  5CPI A;  3H0L C;  4R8P D;  1ID3 D;  3MGQ A;  3WA9 D;  5F99 C;  5B2J C;  5CPI D;  5AV5 B;  3C1B A;  3AZJ C;  3MGQ D;  3AV1 B;  3H0M C;  4KGC C;  1ZLA A;  3C1B D;  4NE5 A;  5AY8 A;  3X1V C;  1EQZ C;  1ZLA D;  3REK C;  3UT9 A;  5FUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...