4J8UB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uB00
4LD9C 1P3PC 3W97D 1F66B 4XZQC 3WA9C 3AZJB 3AZGD 3REKB 1KX3A 3X1VC 1M1AB 5BT1C 4X23A 1P3AA 4WU8C 5GT3A 3REJC 5E5AA 3AZKC 5CPKB 1M18B 4J8XC 2PYOC 4CAYB 5B24C 3LJAB 5CPID 3MGPB 1KX4B 3KUYB 1U35D 1P3FC 2BYMA 1P3MC 3W96A 5B1LB 3W98C 2F8NB 3AZJD 4WZSB 2BYKB 4H9RB 5AVBA 4H9SC 5AV8B 3REKD 1ULYA 1P3OD 1TZYC 3B0DB 3WAAB 1TAFB 3TU4B 5B1MA 2LY8A 5BNXB 5CPKD 5B2JB 3AYWC 3LELC 5B33B 5GSUA 3MNNC 2FJ7A 3MGPD 3AN2C 3NQJB 3X1UD 4JJNA 2YFWA 1EQZA 3KXBC 3AZLD 2NQBB 4Z5TB 5GXQB 3B0CW 3WTPA 4Z66A 4XUJD 1P34B 4R8PC 1P3BB 3AZFC 1BH8A 3AZMD 3X1SB 3UTAB 5AV9C 4QLCC 2AROD 3AZIC 3B6FD 5CP6A 3C1CD 4J8VD 5DNND 1Q9CA 3V9RA 5AVCA 3MGQC 1M19A 4KUDB 5GXQD 1P3IC 5GT0C 5DNMA 3AZEB 1N1JB 5B32A 3A6NB 1P34D 5B32G 1HQ3A 1P3KA 3X1TC 5GT3C 4WNNB 1KX5B 1P3LC 4ZUXD 3AV2B 5B0YC 5AV6C 3WTPE 5B0ZB 3WKJD 2CV5C 4E44A 3AZHB 2CWEA 3VH6T 3R45A 3KSYA 3MGRC 4J8WD 4NE6A 3UT9D 1JFIB 4LD9A 5AV5B 4XZQA 1P3GB 3WA9A 3W99B 3LZ0C 3MGSD 3MVDC 5B31B 5B2IC 5KDMA 3REHC 1ZLAB 3AV2D 2FJ7C 3AZKA 5B0ZD 4Z2MG 3B6GB 3O62B 4J8XA 1EQZC 2HIOB 5B24A 1KX3D 1P3FA 1WWIA 5BO0A 4EO5C 1AOIB 4X23D 3WTPC 1P3AD 5AV5D 1ID3B 2JSSA 5JRGB 3AFAB 5E5AD 4ZBJC 2NZDC 3LZ1B 5C3IB 4KGCB 1BFMA 3W96D 5AY8B 3MNNA 1TAFA 1S32A 1M19C 5AVBD 1WWSA 5DNMC 5JA4B 3NQJA 5F99B 3AFAD 3AZGB 5B1MD 4R8PA 4AWLB 3AV1C 2NQBA 5G49B 4YM6C 3AZFA 4JJND 5AY8D 5AV9A 4QLCA 4H9OA 4E45A 1A7WA 3REIB 3X1SA 5CPIB 4WU9C 3VH5W 1U35B 4Z66D 4YS3C 3RELA 3MGQA 5F99D 3KWQC 1P3IA 5GT0A 3C1BB 1F66C 3AZJC 3REKC 3AZEA 1N1JA 1P3OB 1M1AC 3X1TA 3UTBB 5CP6D 1H3OB 1P3LA 5B0YA 3REID 5AV6A 1KX5A 1M18C 2CV5A 5B32D 3X1UB 3LJAC 3VH6A 3MGPC 1KX4C 1HQ3D 3KUYC 3AZLB 1P3KD 2IO5B 5B1LC 3MGRA 3C1BD 5CPJD 4XUJB 4HGAB 3NQUA 3AZHA 4G92B 5AV8C 3LZ0A 1JFIA 3MVDA 3UTBD 2RVQD 3AZND 1BH9A 1P3GA 3AZMB 5B2IA 3WAAC 3B0DC 3REHA 4M6BA 2AROB 3TU4C 4H9PA 1S32C 3B6FB 5B2JC 4J8UD 3C1CB 4J8VB 4LD9D 5B33C 1P3PD 5DNNB 3W98B 4XZQD 4KHAB 3WA9D 3X1VD 5BT1D 4UUZB 4WU8D 4G91B 4Z5TC 2NQBC 1AOIA 2YFVA 1P34C 1HTAA 3REJD 3AZKD 2NZDA 5BNVB 3AYWB 4J8XD 5JRGA 1P3BC 2PYOD 5B24D 5CHLB 4ZUXB 3X1SC 1P3FD 3WKJB 3UTAC 1P3MD 3RELC 3W98D 3UT9B 4J8WB 4KUDC 3VH5A 1TZYD 3AZEC 5B40B 4H9QA 3A6NC 3MGSB 3W97A 3AYWD 3AV1A 3LELD 3MNND 3AZIB 4YM6A 3AN2D 1KX5C 4NFTA 3AV2C 4NE3A 3KXBD 5B0ZC 4WU9A 1KX3B 4X23B 4R8PD 4YS3A 1P3AB 3AZHC 3KWQA 4CSRB 5B40D 5E5AB 1F66A 1P3GC 3AZJA 3W99C 5AV9D 3REKA 4QLCD 3AZID 1M1AA 5B31C 2HUEC 4WV4B 1ZLAC 3W96B 3MGQD 3B6GC 5CPKA 5GT0D 5AVBB 1P3ID 4Z2MH 3O62C 1M18A 2HIOC 4CAYA 3LJAA 3MGPA 1KX4A 3KUYA 3X1UA 1AOIC 3B0BA 5B1LA 3X1TD 5GT3D 5B1MB 2F8NA 2F8NG 2BYKA 4H9RA 1ID3C 5JRGC 5AV8A 1P3LD 5GSUB 5B0YD 3LZ1C 2CV5D 5C3IC 4JJNB 3WAAA 2YFWB 4KGCC 3TU4A 5BNXA 5B2JA 5B33A 3WTPB 4Z66B 4DRAA 5DNNA 3MVDD 3VH5T 3W97C 1BH8B 4Z5TA 5B2ID 5F99C 5GXQA 3AZGC 5GSUD 2FJ7D 1P34A 4AWLC 5CP6B 1P3BA 1EQZD 5AVCB 1M19B 3UTAA 5B32B 3WTPD 4ZUXA 5CPIC 1HQ3B 1U35C 1P3KB 5FUGB 5CPJB 2NZDD 4KUDA 3A6NA 1KU5A 1B6WA 3AZNB 1P3OC 5AVCD 4WNNA 3UTBC 1M19D 5CPKC 5DNMD 4J8UB 4LD9B 1P3PB 3AV2A 5B0ZA 4XZQB 3WA9B 1R4VA 3X1UC 3X1VB 4WU8B 3AV1D 3AZLC 2IO5C 5KDMB 4YM6D 4XUJC 4HGAC 3REJB 5AV5A 3AZKB 4G92C 3B0CT 4CSRA 3W99A 1F1EA 4J8XB 2PYOB 5B31A 5B24B 5B31G 4WU9D 3AZMC 1P3FB 5BO0B 1P3MB 1ZLAA 2AROC 4YS3D 3B6FC 3KWQD 3B6GA 3C1CC 4J8VC 3O62A 5DNNC 2HIOA 1F66D 5GXQC 1M1AD 1TZYB 4G91C 1ID3A 3AFAA 3LELB 3MNNB 1S32B 3AN2B 1M18D 3LZ1A 4KGCA 3LJAD 4ZUXC 1KX4D 3KXBB 3KUYD 3WKJC 5BS7C 5B1LD 5AY8A 2F8ND 4R8PB 2F8NK 4H9NB 5AV8D 3UT9C 4J8WC 3AZFB 5JA4A 5F99A 3WAAD 3AZGA 5AV9B 5B40C 4QLCB 3MGSC 2L5AA 3TU4D 4H9OB 1S32D 5B2JD 5G49A 5B33D 1B67A 4DRBA 3RELB 3MGQB 1P3IB 5GT0B 3REIA 5CPIA 2NQBD 4Z5TD 1KX3C 1U35A 4X23C 3AZFD 5GT3B 3X1TB 1P3AC 4NE5A 5AV5C 1P3BD 5FUGA 1P3LB 3C1BA 5CPJA 5B0YB 5E5AC 5AV6B 3X1SD 3UTAD 2CV5B 1P3OA 2BYMB 3RELD 3UTBA 3AZNA 3W96C 1H3OA 3MGRB 3NQUB 4KUDD 5AVBC 4J8UA 3AZED 3A6ND 3LZ0B 1P3PA 3MVDB 1BH9B 3AZLA 5B2IB 3AFAC 3REHB 3X1VA 2FJ7B 2HUEB 4H9PB 4XUJA 5B1MC 5AV6D 4WU8A 1KX5D 2F8NH 5GSUC 3VH6W 1EQZB 3REJA 3AZMA 4JJNC 4EO5B 5AY8C 3MGRD 2AROA 2PYOA 3AZHD 3B6FA 3C1CA 4J8VA 2YFVB 3LZ0D 1P3MA 4Z66C 3W98A 4ZBJB 1P3GD 4KHAA 2NZDB 3W99D 4H9SA 3REHD 4UUZA 5B31D 1TZYA 1ZLAD 3V9RB 3B6GD 5BNVA 5CP6C 3AYWA 3O62D 3LELA 5DNMB 2HIOD 5AVCC 3REIC 3AN2A 3WKJA 5BS7A 1AOID 5B32C 4H9QB 3W97B 3KXBA 3AV1B 1ID3D 1HQ3C 5JRGD 1P3KC 3UT9A 4YM6B 3C1BC 4J8WA 5CPJC 3LZ1D 4H9NA 5B40A 4KGCD 3MGSA 2RVQC 3AZNC 4WU9B 3AZIA 3R45B 4YS3B 3KWQB 4J8UC
chains in the Genus database with same CATH superfamily
4LD9C 1P3PC 3W97D 1F66B 4XZQC 3WA9C 3AZJB 3AZGD 3REKB 1KX3A 3X1VC 1M1AB 5BT1C 4X23A 1P3AA 4WU8C 2ZY5A 5GT3A 3REJC 5E5AA 3AZKC 5CPKB 1M18B 4J8XC 2PYOC 4CAYB 5B24C 3LJAB 5CPID 3MGPB 1KX4B 3KUYB 1U35D 1P3FC 2BYMA 1P3MC 3W96A 5B1LB 3W98C 2F8NB 3AZJD 2BYKB 4H9RB 5AVBA 4WZSB 4H9SC 5AV8B 3REKD 1ULYA 2Y2GA 1P3OD 1TZYC 3B0DB 3WAAB 1TAFB 2Y2IA 3TU4B 5B1MA 2LY8A 5BNXB 5CPKD 5B2JB 3AYWC 3LELC 5B33B 5GSUA 3MNNC 2FJ7A 3MGPD 3AN2C 3NQJB 3X1UD 4JJNA 2YFWA 1EQZA 3KXBC 3AZLD 2NQBB 4Z5TB 5GXQB 3AL0C 3B0CW 3WTPA 4Z66A 4XUJD 1P34B 4R8PC 2G5HC 1P3BB 3AZFC 1BH8A 3AZMD 3X1SB 3UTAB 3A1IA 5AV9C 4QLCC 2AROD 3AZIC 3B6FD 5CP6A 3C1CD 4J8VD 5DNND 1Q9CA 3V9RA 5AVCA 3MGQC 2Y2JA 1M19A 4KUDB 5GXQD 1P3IC 2Y2HA 5DNMA 5GT0C 1N1JB 3AZEB 5B32A 2ZY4A 3A6NB 1P34D 5B32G 3EPJA 1HQ3A 1P3KA 3X1TC 5GT3C 4WNNB 1KX5B 1P3LC 4ZUXD 3AV2B 5B0YC 5AV6C 3WTPE 5B0ZB 3WKJD 2CV5C 4E44A 3AZHB 2CWEA 3VH6T 3KSYA 3R45A 3MGRC 4J8WD 4NE6A 3UT9D 1JFIB 4LD9A 5AV5B 4XZQA 1P3GB 3WA9A 3W99B 3LZ0C 3MGSD 3MVDC 5B31B 3FDDA 5B2IC 2XD5A 5KDMA 3REHC 1ZLAB 3AV2D 2FJ7C 2Y2MA 3AZKA 5B0ZD 4Z2MG 3B6GB 3O62B 4J8XA 1EQZC 2HIOB 5B24A 2FFFB 1W2EA 1KX3D 1P3FA 1WWIA 5BO0A 4EO5C 1AOIB 4X23D 3WTPC 3F6TA 1P3AD 5AV5D 1ID3B 2JSSA 5JRGB 3AFAB 5E5AD 4ZBJC 2NZDC 3LZ1B 5C3IB 4KGCB 2XD1A 3P5JB 3H0LC 1BFMA 3W96D 5AY8B 3MNNA 1TAFA 1S32A 2ZY2A 1M19C 5AVBD 2RIQA 1WWSA 5DNMC 5JA4B 3NQJA 5F99B 3AFAD 3AZGB 5B1MD 4R8PA 4AWLB 3AV1C 2NQBA 5G49B 4YM6C 3AZFA 2Y2KA 4JJND 5AY8D 5AV9A 4QLCA 4H9OA 4E45A 3H0RC 1A7WA 3REIB 3X1SA 5CPIB 4WU9C 3VH5W 1U35B 4Z66D 4YS3C 3RELA 3MGQA 5F99D 3KWQC 1P3IA 5GT0A 3C1BB 4UPKA 1F66C 3AZJC 3REKC 3AZEA 1N1JA 1P3OB 1M1AC 3X1TA 3UTBB 5CP6D 1H3OB 1P3LA 5B0YA 2JCHA 3REID 5AV6A 1KX5A 1M18C 2CV5A 5B32D 3X1UB 3LJAC 3VH6A 3MGPC 1KX4C 1HQ3D 3KUYC 3AZLB 1P3KD 2IO5B 5B1LC 3MGRA 3C1BD 5CPJD 4XUJB 4HGAB 3NQUA 3AZHA 4G92B 5AV8C 3LZ0A 1JFIA 3MVDA 2DF4C 3UTBD 2RVQD 3AZND 1BH9A 1P3GA 3AZMB 5B2IA 3WAAC 3B0DC 3REHA 4M6BA 2AROB 3TU4C 4H9PA 1S32C 3B6FB 5B2JC 4J8UD 3C1CB 4J8VB 4LD9D 5B33C 1P3PD 2VQRA 5DNNB 3W98B 4XZQD 4KHAB 3WA9D 3X1VD 5BT1D 4UUZB 4WU8D 4G91B 4Z5TC 2NQBC 1AOIA 2YFVA 1P34C 1HTAA 3REJD 3AZKD 2NZDA 5BNVB 3AYWB 4J8XD 5JRGA 1P3BC 3A1KA 2PYOD 5B24D 5CHLB 4ZUXB 3X1SC 1P3FD 3WKJB 3UTAC 1P3MD 2J8PA 3RELC 3W98D 3UT9B 4J8WB 4KUDC 3VH5A 1TZYD 3AZEC 5B40B 4H9QA 3A6NC 3MGSB 3W97A 3AYWD 3AV1A 3LELD 3MNND 3AZIB 4YM6A 3AN2D 1KX5C 4NFTA 3AV2C 4NE3A 3KXBD 5B0ZC 2Y2NA 4WU9A 1KX3B 4X23B 4R8PD 4YS3A 1P3AB 3AZHC 3KWQA 4CSRB 5B40D 5E5AB 1F66A 1P3GC 3AZJA 3W99C 5AV9D 3REKA 4QLCD 3AZID 1M1AA 5B31C 2HUEC 4WV4B 3EPKA 1ZLAC 3W96B 3MGQD 3B6GC 5CPKA 5GT0D 5AVBB 1P3ID 4Z2MH 3O62C 1M18A 2HIOC 4CAYA 3LJAA 3MGPA 1KX4A 3KUYA 3X1UA 1AOIC 3B0BA 5B1LA 3X1TD 5GT3D 2ZY3A 5B1MB 2F8NA 2F8NG 2BYKA 4H9RA 1ID3C 5JRGC 5AV8A 1P3LD 5GSUB 5B0YD 2ZM5A 3LZ1C 2CV5D 5C3IC 4JJNB 3WAAA 2YFWB 4KGCC 3TU4A 5BNXA 5B2JA 5B33A 3WTPB 4Z66B 4DRAA 5DNNA 3MVDD 3VH5T 3W97C 1BH8B 4Z5TA 5B2ID 5F99C 5GXQA 3AZGC 5GSUD 2FJ7D 1P34A 4AWLC 5CP6B 1P3BA 1EQZD 5AVCB 1M19B 2G5IC 3UTAA 5B32B 3WTPD 4ZUXA 5CPIC 1HQ3B 1U35C 1P3KB 5FUGB 3EPHA 5CPJB 2NZDD 4KUDA 3A6NA 1KU5A 1B6WA 3AZNB 1P3OC 3KFUG 5AVCD 2JE5A 4WNNA 3UTBC 1M19D 4DQYB 5CPKC 5DNMD 4J8UB 4LD9B 1P3PB 3AV2A 5B0ZA 4XZQB 3WA9B 1R4VA 3X1UC 3X1VB 4WU8B 3AV1D 3AZLC 2IO5C 5KDMB 4YM6D 4XUJC 4HGAC 3REJB 5AV5A 3AZKB 4G92C 3B0CT 4CSRA 3W99A 1F1EA 4J8XB 2PYOB 5B31A 5B24B 5B31G 4WU9D 3AZMC 1P3FB 5BO0B 1P3MB 1ZLAA 2AROC 2Y2PA 4YS3D 3B6FC 3IP4C 3KWQD 3B6GA 3C1CC 4J8VC 3O62A 3H0MC 5DNNC 2HIOA 1F66D 5GXQC 1M1AD 1TZYB 4G91C 1ID3A 3AFAA 3LELB 3MNNB 1S32B 2Y2OA 3AN2B 1M18D 3LZ1A 4KGCA 3LJAD 4ZUXC 2BG1A 1KX4D 3KXBB 3KUYD 3WKJC 5BS7C 5B1LD 5AY8A 2Y2QA 2F8ND 4R8PB 2F8NK 4H9NB 5AV8D 3UT9C 4J8WC 3AZFB 5JA4A 5F99A 3WAAD 3AZGA 5AV9B 5B40C 4QLCB 3MGSC 2L5AA 3TU4D 4H9OB 1S32D 5B2JD 5G49A 5B33D 3EPLA 1B67A 4DRBA 3RELB 3MGQB 1P3IB 5GT0B 3EG5B 3REIA 5CPIA 2NQBD 4Z5TD 1KX3C 1U35A 1PZRA 4X23C 3AZFD 5GT3B 3X1TB 1P3AC 4NE5A 5AV5C 1P3BD 1T3UA 5FUGA 1P3LB 3C1BA 5CPJA 5B0YB 5E5AC 5AV6B 3X1SD 3UTAD 2CV5B 1P3OA 2BYMB 3RELD 3UTBA 3AZNA 4WJ3C 3W96C 1H3OA 3MGRB 3NQUB 4KUDD 5AVBC 4J8UA 3AZED 3A6ND 3LZ0B 1P3PA 3MVDB 2Y2LA 1BH9B 3AZLA 5B2IB 3AFAC 3REHB 3X1VA 2FJ7B 2HUEB 4H9PB 4XUJA 5B1MC 2DQNC 5AV6D 4WU8A 1KX5D 2F8NH 5GSUC 3VH6W 1EQZB 2W8SA 3REJA 2F2AC 3AZMA 4JJNC 4EO5B 5AY8C 3MGRD 2AROA 2PYOA 3AZHD 3B6FA 3C1CA 4J8VA 2YFVB 3LZ0D 1P3MA 4Z66C 3W98A 1Z2CB 4ZBJB 4KHAA 1P3GD 2NZDB 3W99D 4H9SA 3REHD 4UUZA 5B31D 2UWXA 1TZYA 1ZLAD 3V9RB 3B6GD 5BNVA 5CP6C 3AYWA 3O62D 3LELA 5DNMB 2HIOD 5AVCC 3REIC 3AN2A 3WKJA 5BS7A 1AOID 5B32C 4H9QB 3W97B 3KXBA 3AV1B 1ID3D 1HQ3C 5JRGD 1P3KC 3UT9A 4YM6B 3C1BC 4J8WA 5CPJC 3LZ1D 4H9NA 5B40A 4KGCD 3MGSA 2RVQC 3AZNC 4WU9B 3AZIA 3R45B 4YS3B 3KWQB 4J8UC
chains in the Genus database with same CATH topology
4LD9C 1P3PC 3W97D 1F66B 4XZQC 3WA9C 3AZJB 3AZGD 3REKB 1KX3A 3X1VC 1M1AB 5BT1C 4X23A 1P3AA 4WU8C 2ZY5A 5GT3A 3REJC 5E5AA 3AZKC 5CPKB 1M18B 4J8XC 2PYOC 4CAYB 5B24C 3LJAB 5CPID 3MGPB 1KX4B 3KUYB 1U35D 1P3FC 2BYMA 1P3MC 3W96A 5B1LB 3W98C 2F8NB 3AZJD 2BYKB 4H9RB 5AVBA 4WZSB 4H9SC 5AV8B 3REKD 1ULYA 2Y2GA 1P3OD 1TZYC 3B0DB 3WAAB 1TAFB 2Y2IA 3TU4B 5B1MA 2LY8A 5BNXB 5CPKD 5B2JB 3AYWC 3LELC 5B33B 5GSUA 3MNNC 2FJ7A 3MGPD 3AN2C 3NQJB 3X1UD 4JJNA 2YFWA 1EQZA 3KXBC 3AZLD 2NQBB 4Z5TB 5GXQB 3AL0C 3B0CW 3WTPA 4Z66A 4XUJD 1P34B 4R8PC 2G5HC 1P3BB 3AZFC 1BH8A 3AZMD 3X1SB 3UTAB 3A1IA 5AV9C 4QLCC 2AROD 3AZIC 3B6FD 5CP6A 3C1CD 4J8VD 5DNND 1Q9CA 3V9RA 5AVCA 3MGQC 2Y2JA 1M19A 4KUDB 5GXQD 1P3IC 2Y2HA 5DNMA 5GT0C 1N1JB 3AZEB 5B32A 2ZY4A 3A6NB 1P34D 5B32G 3EPJA 1HQ3A 1P3KA 3X1TC 5GT3C 4WNNB 1KX5B 1P3LC 4ZUXD 3AV2B 5B0YC 5AV6C 3WTPE 5B0ZB 3WKJD 2CV5C 4E44A 3AZHB 2CWEA 3VH6T 3KSYA 3R45A 3MGRC 4J8WD 4NE6A 3UT9D 1JFIB 4LD9A 5AV5B 4XZQA 1P3GB 3WA9A 3W99B 3LZ0C 3MGSD 3MVDC 5B31B 3FDDA 5B2IC 2XD5A 5KDMA 3REHC 1ZLAB 3AV2D 2FJ7C 2Y2MA 3AZKA 5B0ZD 4Z2MG 3B6GB 3O62B 4J8XA 1EQZC 2HIOB 5B24A 2FFFB 1W2EA 1KX3D 1P3FA 1WWIA 5BO0A 4EO5C 1AOIB 4X23D 3WTPC 3F6TA 1P3AD 5AV5D 1ID3B 2JSSA 5JRGB 3AFAB 5E5AD 4ZBJC 2NZDC 3LZ1B 5C3IB 4KGCB 2XD1A 3P5JB 3H0LC 1BFMA 3W96D 5AY8B 3MNNA 1TAFA 1S32A 2ZY2A 1M19C 5AVBD 2RIQA 1WWSA 5DNMC 5JA4B 3NQJA 5F99B 3AFAD 3AZGB 5B1MD 4R8PA 4AWLB 3AV1C 2NQBA 5G49B 4YM6C 3AZFA 2Y2KA 4JJND 5AY8D 5AV9A 4QLCA 4H9OA 4E45A 3H0RC 1A7WA 3REIB 3X1SA 5CPIB 4WU9C 3VH5W 1U35B 4Z66D 4YS3C 3RELA 3MGQA 5F99D 3KWQC 1P3IA 5GT0A 3C1BB 4UPKA 1F66C 3AZJC 3REKC 3AZEA 1N1JA 1P3OB 1M1AC 3X1TA 3UTBB 5CP6D 1H3OB 1P3LA 5B0YA 2JCHA 3REID 5AV6A 1KX5A 1M18C 2CV5A 5B32D 3X1UB 3LJAC 3VH6A 3MGPC 1KX4C 1HQ3D 3KUYC 3AZLB 1P3KD 2IO5B 5B1LC 3MGRA 3C1BD 5CPJD 4XUJB 4HGAB 3NQUA 3AZHA 4G92B 5AV8C 3LZ0A 1JFIA 3MVDA 2DF4C 3UTBD 2RVQD 3AZND 1BH9A 1P3GA 3AZMB 5B2IA 3WAAC 3B0DC 3REHA 4M6BA 2AROB 3TU4C 4H9PA 1S32C 3B6FB 5B2JC 4J8UD 3C1CB 4J8VB 4LD9D 5B33C 1P3PD 2VQRA 5DNNB 3W98B 4XZQD 4KHAB 3WA9D 3X1VD 5BT1D 4UUZB 4WU8D 4G91B 4Z5TC 2NQBC 1AOIA 2YFVA 1P34C 1HTAA 3REJD 3AZKD 2NZDA 5BNVB 3AYWB 4J8XD 5JRGA 1P3BC 3A1KA 2PYOD 5B24D 5CHLB 4ZUXB 3X1SC 1P3FD 3WKJB 3UTAC 1P3MD 2J8PA 3RELC 3W98D 3UT9B 4J8WB 4KUDC 3VH5A 1TZYD 3AZEC 5B40B 4H9QA 3A6NC 3MGSB 3W97A 3AYWD 3AV1A 3LELD 3MNND 3AZIB 4YM6A 3AN2D 1KX5C 4NFTA 3AV2C 4NE3A 3KXBD 5B0ZC 2Y2NA 4WU9A 1KX3B 4X23B 4R8PD 4YS3A 1P3AB 3AZHC 3KWQA 4CSRB 5B40D 5E5AB 1F66A 1P3GC 3AZJA 3W99C 5AV9D 3REKA 4QLCD 3AZID 1M1AA 5B31C 2HUEC 4WV4B 3EPKA 1ZLAC 3W96B 3MGQD 3B6GC 5CPKA 5GT0D 5AVBB 1P3ID 4Z2MH 3O62C 1M18A 2HIOC 4CAYA 3LJAA 3MGPA 1KX4A 3KUYA 3X1UA 1AOIC 3B0BA 5B1LA 3X1TD 5GT3D 2ZY3A 5B1MB 2F8NA 2F8NG 2BYKA 4H9RA 1ID3C 5JRGC 5AV8A 1P3LD 5GSUB 5B0YD 2ZM5A 3LZ1C 2CV5D 5C3IC 4JJNB 3WAAA 2YFWB 4KGCC 3TU4A 5BNXA 5B2JA 5B33A 3WTPB 4Z66B 4DRAA 5DNNA 3MVDD 3VH5T 3W97C 1BH8B 4Z5TA 5B2ID 5F99C 5GXQA 3AZGC 5GSUD 2FJ7D 1P34A 4AWLC 5CP6B 1P3BA 1EQZD 5AVCB 1M19B 2G5IC 3UTAA 5B32B 3WTPD 4ZUXA 5CPIC 1HQ3B 1U35C 1P3KB 5FUGB 3EPHA 5CPJB 2NZDD 4KUDA 3A6NA 1KU5A 1B6WA 3AZNB 1P3OC 3KFUG 5AVCD 2JE5A 4WNNA 3UTBC 1M19D 4DQYB 5CPKC 5DNMD 4J8UB 4LD9B 1P3PB 3AV2A 5B0ZA 4XZQB 3WA9B 1R4VA 3X1UC 3X1VB 4WU8B 3AV1D 3AZLC 2IO5C 5KDMB 4YM6D 4XUJC 4HGAC 3REJB 5AV5A 3AZKB 4G92C 3B0CT 4CSRA 3W99A 1F1EA 4J8XB 2PYOB 5B31A 5B24B 5B31G 4WU9D 3AZMC 1P3FB 5BO0B 1P3MB 1ZLAA 2AROC 2Y2PA 4YS3D 3B6FC 3IP4C 3KWQD 3B6GA 3C1CC 4J8VC 3O62A 3H0MC 5DNNC 2HIOA 1F66D 5GXQC 1M1AD 1TZYB 4G91C 1ID3A 3AFAA 3LELB 3MNNB 1S32B 2Y2OA 3AN2B 1M18D 3LZ1A 4KGCA 3LJAD 4ZUXC 2BG1A 1KX4D 3KXBB 3KUYD 3WKJC 5BS7C 5B1LD 5AY8A 2Y2QA 2F8ND 4R8PB 2F8NK 4H9NB 5AV8D 3UT9C 4J8WC 3AZFB 5JA4A 5F99A 3WAAD 3AZGA 5AV9B 5B40C 4QLCB 3MGSC 2L5AA 3TU4D 4H9OB 1S32D 5B2JD 5G49A 5B33D 3EPLA 1B67A 4DRBA 3RELB 3MGQB 1P3IB 5GT0B 3EG5B 3REIA 5CPIA 2NQBD 4Z5TD 1KX3C 1U35A 1PZRA 4X23C 3AZFD 5GT3B 3X1TB 1P3AC 4NE5A 5AV5C 1P3BD 1T3UA 5FUGA 1P3LB 3C1BA 5CPJA 5B0YB 5E5AC 5AV6B 3X1SD 3UTAD 2CV5B 1P3OA 2BYMB 3RELD 3UTBA 3AZNA 4WJ3C 3W96C 1H3OA 3MGRB 3NQUB 4KUDD 5AVBC 4J8UA 3AZED 3A6ND 3LZ0B 1P3PA 3MVDB 2Y2LA 1BH9B 3AZLA 5B2IB 3AFAC 3REHB 3X1VA 2FJ7B 2HUEB 4H9PB 4XUJA 5B1MC 2DQNC 5AV6D 4WU8A 1KX5D 2F8NH 5GSUC 3VH6W 1EQZB 2W8SA 3REJA 2F2AC 3AZMA 4JJNC 4EO5B 5AY8C 3MGRD 2AROA 2PYOA 3AZHD 3B6FA 3C1CA 4J8VA 2YFVB 3LZ0D 1P3MA 4Z66C 3W98A 1Z2CB 4ZBJB 4KHAA 1P3GD 2NZDB 3W99D 4H9SA 3REHD 4UUZA 5B31D 2UWXA 1TZYA 1ZLAD 3V9RB 3B6GD 5BNVA 5CP6C 3AYWA 3O62D 3LELA 5DNMB 2HIOD 5AVCC 3REIC 3AN2A 3WKJA 5BS7A 1AOID 5B32C 4H9QB 3W97B 3KXBA 3AV1B 1ID3D 1HQ3C 5JRGD 1P3KC 3UT9A 4YM6B 3C1BC 4J8WA 5CPJC 3LZ1D 4H9NA 5B40A 4KGCD 3MGSA 2RVQC 3AZNC 4WU9B 3AZIA 3R45B 4YS3B 3KWQB 4J8UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 C;  1P3P C;  3W97 D;  1F66 B;  4XZQ C;  3WA9 C;  3AZJ B;  3AZG D;  3REK B;  1KX3 A;  3X1V C;  1M1A B;  5BT1 C;  4X23 A;  1P3A A;  4WU8 C;  5GT3 A;  3REJ C;  5E5A A;  3AZK C;  5CPK B;  1M18 B;  4J8X C;  2PYO C;  4CAY B;  5B24 C;  3LJA B;  5CPI D;  3MGP B;  1KX4 B;  3KUY B;  1U35 D;  1P3F C;  2BYM A;  1P3M C;  3W96 A;  5B1L B;  3W98 C;  2F8N B;  3AZJ D;  4WZS B;  2BYK B;  4H9R B;  5AVB A;  4H9S C;  5AV8 B;  3REK D;  1ULY A;  1P3O D;  1TZY C;  3B0D B;  3WAA B;  1TAF B;  3TU4 B;  5B1M A;  2LY8 A;  5BNX B;  5CPK D;  5B2J B;  3AYW C;  3LEL C;  5B33 B;  5GSU A;  3MNN C;  2FJ7 A;  3MGP D;  3AN2 C;  3NQJ B;  3X1U D;  4JJN A;  2YFW A;  1EQZ A;  3KXB C;  3AZL D;  2NQB B;  4Z5T B;  5GXQ B;  3B0C W;  3WTP A;  4Z66 A;  4XUJ D;  1P34 B;  4R8P C;  1P3B B;  3AZF C;  1BH8 A;  3AZM D;  3X1S B;  3UTA B;  5AV9 C;  4QLC C;  2ARO D;  3AZI C;  3B6F D;  5CP6 A;  3C1C D;  4J8V D;  5DNN D;  1Q9C A;  3V9R A;  5AVC A;  3MGQ C;  1M19 A;  4KUD B;  5GXQ D;  1P3I C;  5GT0 C;  5DNM A;  3AZE B;  1N1J B;  5B32 A;  3A6N B;  1P34 D;  5B32 G;  1HQ3 A;  1P3K A;  3X1T C;  5GT3 C;  4WNN B;  1KX5 B;  1P3L C;  4ZUX D;  3AV2 B;  5B0Y C;  5AV6 C;  3WTP E;  5B0Z B;  3WKJ D;  2CV5 C;  4E44 A;  3AZH B;  2CWE A;  3VH6 T;  3R45 A;  3KSY A;  3MGR C;  4J8W D;  4NE6 A;  3UT9 D;  1JFI B;  4LD9 A;  5AV5 B;  4XZQ A;  1P3G B;  3WA9 A;  3W99 B;  3LZ0 C;  3MGS D;  3MVD C;  5B31 B;  5B2I C;  5KDM A;  3REH C;  1ZLA B;  3AV2 D;  2FJ7 C;  3AZK A;  5B0Z D;  4Z2M G;  3B6G B;  3O62 B;  4J8X A;  1EQZ C;  2HIO B;  5B24 A;  1KX3 D;  1P3F A;  1WWI A;  5BO0 A;  4EO5 C;  1AOI B;  4X23 D;  3WTP C;  1P3A D;  5AV5 D;  1ID3 B;  2JSS A;  5JRG B;  3AFA B;  5E5A D;  4ZBJ C;  2NZD C;  3LZ1 B;  5C3I B;  4KGC B;  1BFM A;  3W96 D;  5AY8 B;  3MNN A;  1TAF A;  1S32 A;  1M19 C;  5AVB D;  1WWS A;  5DNM C;  5JA4 B;  3NQJ A;  5F99 B;  3AFA D;  3AZG B;  5B1M D;  4R8P A;  4AWL B;  3AV1 C;  2NQB A;  5G49 B;  4YM6 C;  3AZF A;  4JJN D;  5AY8 D;  5AV9 A;  4QLC A;  4H9O A;  4E45 A;  1A7W A;  3REI B;  3X1S A;  5CPI B;  4WU9 C;  3VH5 W;  1U35 B;  4Z66 D;  4YS3 C;  3REL A;  3MGQ A;  5F99 D;  3KWQ C;  1P3I A;  5GT0 A;  3C1B B;  1F66 C;  3AZJ C;  3REK C;  3AZE A;  1N1J A;  1P3O B;  1M1A C;  3X1T A;  3UTB B;  5CP6 D;  1H3O B;  1P3L A;  5B0Y A;  3REI D;  5AV6 A;  1KX5 A;  1M18 C;  2CV5 A;  5B32 D;  3X1U B;  3LJA C;  3VH6 A;  3MGP C;  1KX4 C;  1HQ3 D;  3KUY C;  3AZL B;  1P3K D;  2IO5 B;  5B1L C;  3MGR A;  3C1B D;  5CPJ D;  4XUJ B;  4HGA B;  3NQU A;  3AZH A;  4G92 B;  5AV8 C;  3LZ0 A;  1JFI A;  3MVD A;  3UTB D;  2RVQ D;  3AZN D;  1BH9 A;  1P3G A;  3AZM B;  5B2I A;  3WAA C;  3B0D C;  3REH A;  4M6B A;  2ARO B;  3TU4 C;  4H9P A;  1S32 C;  3B6F B;  5B2J C;  4J8U D;  3C1C B;  4J8V B;  4LD9 D;  5B33 C;  1P3P D;  5DNN B;  3W98 B;  4XZQ D;  4KHA B;  3WA9 D;  3X1V D;  5BT1 D;  4UUZ B;  4WU8 D;  4G91 B;  4Z5T C;  2NQB C;  1AOI A;  2YFV A;  1P34 C;  1HTA A;  3REJ D;  3AZK D;  2NZD A;  5BNV B;  3AYW B;  4J8X D;  5JRG A;  1P3B C;  2PYO D;  5B24 D;  5CHL B;  4ZUX B;  3X1S C;  1P3F D;  3WKJ B;  3UTA C;  1P3M D;  3REL C;  3W98 D;  3UT9 B;  4J8W B;  4KUD C;  3VH5 A;  1TZY D;  3AZE C;  5B40 B;  4H9Q A;  3A6N C;  3MGS B;  3W97 A;  3AYW D;  3AV1 A;  3LEL D;  3MNN D;  3AZI B;  4YM6 A;  3AN2 D;  1KX5 C;  4NFT A;  3AV2 C;  4NE3 A;  3KXB D;  5B0Z C;  4WU9 A;  1KX3 B;  4X23 B;  4R8P D;  4YS3 A;  1P3A B;  3AZH C;  3KWQ A;  4CSR B;  5B40 D;  5E5A B;  1F66 A;  1P3G C;  3AZJ A;  3W99 C;  5AV9 D;  3REK A;  4QLC D;  3AZI D;  1M1A A;  5B31 C;  2HUE C;  4WV4 B;  1ZLA C;  3W96 B;  3MGQ D;  3B6G C;  5CPK A;  5GT0 D;  5AVB B;  1P3I D;  4Z2M H;  3O62 C;  1M18 A;  2HIO C;  4CAY A;  3LJA A;  3MGP A;  1KX4 A;  3KUY A;  3X1U A;  1AOI C;  3B0B A;  5B1L A;  3X1T D;  5GT3 D;  5B1M B;  2F8N A;  2F8N G;  2BYK A;  4H9R A;  1ID3 C;  5JRG C;  5AV8 A;  1P3L D;  5GSU B;  5B0Y D;  3LZ1 C;  2CV5 D;  5C3I C;  4JJN B;  3WAA A;  2YFW B;  4KGC C;  3TU4 A;  5BNX A;  5B2J A;  5B33 A;  3WTP B;  4Z66 B;  4DRA A;  5DNN A;  3MVD D;  3VH5 T;  3W97 C;  1BH8 B;  4Z5T A;  5B2I D;  5F99 C;  5GXQ A;  3AZG C;  5GSU D;  2FJ7 D;  1P34 A;  4AWL C;  5CP6 B;  1P3B A;  1EQZ D;  5AVC B;  1M19 B;  3UTA A;  5B32 B;  3WTP D;  4ZUX A;  5CPI C;  1HQ3 B;  1U35 C;  1P3K B;  5FUG B;  5CPJ B;  2NZD D;  4KUD A;  3A6N A;  1KU5 A;  1B6W A;  3AZN B;  1P3O C;  5AVC D;  4WNN A;  3UTB C;  1M19 D;  5CPK C;  5DNM D;  4J8U B;  4LD9 B;  1P3P B;  3AV2 A;  5B0Z A;  4XZQ B;  3WA9 B;  1R4V A;  3X1U C;  3X1V B;  4WU8 B;  3AV1 D;  3AZL C;  2IO5 C;  5KDM B;  4YM6 D;  4XUJ C;  4HGA C;  3REJ B;  5AV5 A;  3AZK B;  4G92 C;  3B0C T;  4CSR A;  3W99 A;  1F1E A;  4J8X B;  2PYO B;  5B31 A;  5B24 B;  5B31 G;  4WU9 D;  3AZM C;  1P3F B;  5BO0 B;  1P3M B;  1ZLA A;  2ARO C;  4YS3 D;  3B6F C;  3KWQ D;  3B6G A;  3C1C C;  4J8V C;  3O62 A;  5DNN C;  2HIO A;  1F66 D;  5GXQ C;  1M1A D;  1TZY B;  4G91 C;  1ID3 A;  3AFA A;  3LEL B;  3MNN B;  1S32 B;  3AN2 B;  1M18 D;  3LZ1 A;  4KGC A;  3LJA D;  4ZUX C;  1KX4 D;  3KXB B;  3KUY D;  3WKJ C;  5BS7 C;  5B1L D;  5AY8 A;  2F8N D;  4R8P B;  2F8N K;  4H9N B;  5AV8 D;  3UT9 C;  4J8W C;  3AZF B;  5JA4 A;  5F99 A;  3WAA D;  3AZG A;  5AV9 B;  5B40 C;  4QLC B;  3MGS C;  2L5A A;  3TU4 D;  4H9O B;  1S32 D;  5B2J D;  5G49 A;  5B33 D;  1B67 A;  4DRB A;  3REL B;  3MGQ B;  1P3I B;  5GT0 B;  3REI A;  5CPI A;  2NQB D;  4Z5T D;  1KX3 C;  1U35 A;  4X23 C;  3AZF D;  5GT3 B;  3X1T B;  1P3A C;  4NE5 A;  5AV5 C;  1P3B D;  5FUG A;  1P3L B;  3C1B A;  5CPJ A;  5B0Y B;  5E5A C;  5AV6 B;  3X1S D;  3UTA D;  2CV5 B;  1P3O A;  2BYM B;  3REL D;  3UTB A;  3AZN A;  3W96 C;  1H3O A;  3MGR B;  3NQU B;  4KUD D;  5AVB C;  4J8U A;  3AZE D;  3A6N D;  3LZ0 B;  1P3P A;  3MVD B;  1BH9 B;  3AZL A;  5B2I B;  3AFA C;  3REH B;  3X1V A;  2FJ7 B;  2HUE B;  4H9P B;  4XUJ A;  5B1M C;  5AV6 D;  4WU8 A;  1KX5 D;  2F8N H;  5GSU C;  3VH6 W;  1EQZ B;  3REJ A;  3AZM A;  4JJN C;  4EO5 B;  5AY8 C;  3MGR D;  2ARO A;  2PYO A;  3AZH D;  3B6F A;  3C1C A;  4J8V A;  2YFV B;  3LZ0 D;  1P3M A;  4Z66 C;  3W98 A;  4ZBJ B;  1P3G D;  4KHA A;  2NZD B;  3W99 D;  4H9S A;  3REH D;  4UUZ A;  5B31 D;  1TZY A;  1ZLA D;  3V9R B;  3B6G D;  5BNV A;  5CP6 C;  3AYW A;  3O62 D;  3LEL A;  5DNM B;  2HIO D;  5AVC C;  3REI C;  3AN2 A;  3WKJ A;  5BS7 A;  1AOI D;  5B32 C;  4H9Q B;  3W97 B;  3KXB A;  3AV1 B;  1ID3 D;  1HQ3 C;  5JRG D;  1P3K C;  3UT9 A;  4YM6 B;  3C1B C;  4J8W A;  5CPJ C;  3LZ1 D;  4H9N A;  5B40 A;  4KGC D;  3MGS A;  2RVQ C;  3AZN C;  4WU9 B;  3AZI A;  3R45 B;  4YS3 B;  3KWQ B;  4J8U C; 
#chains in the Genus database with same CATH topology
 4LD9 C;  1P3P C;  3W97 D;  1F66 B;  4XZQ C;  3WA9 C;  3AZJ B;  3AZG D;  3REK B;  1KX3 A;  3X1V C;  1M1A B;  5BT1 C;  4X23 A;  1P3A A;  4WU8 C;  2ZY5 A;  5GT3 A;  3REJ C;  5E5A A;  3AZK C;  5CPK B;  1M18 B;  4J8X C;  2PYO C;  4CAY B;  5B24 C;  3LJA B;  5CPI D;  3MGP B;  1KX4 B;  3KUY B;  1U35 D;  1P3F C;  2BYM A;  1P3M C;  3W96 A;  5B1L B;  3W98 C;  2F8N B;  3AZJ D;  2BYK B;  4H9R B;  5AVB A;  4WZS B;  4H9S C;  5AV8 B;  3REK D;  1ULY A;  2Y2G A;  1P3O D;  1TZY C;  3B0D B;  3WAA B;  1TAF B;  2Y2I A;  3TU4 B;  5B1M A;  2LY8 A;  5BNX B;  5CPK D;  5B2J B;  3AYW C;  3LEL C;  5B33 B;  5GSU A;  3MNN C;  2FJ7 A;  3MGP D;  3AN2 C;  3NQJ B;  3X1U D;  4JJN A;  2YFW A;  1EQZ A;  3KXB C;  3AZL D;  2NQB B;  4Z5T B;  5GXQ B;  3AL0 C;  3B0C W;  3WTP A;  4Z66 A;  4XUJ D;  1P34 B;  4R8P C;  2G5H C;  1P3B B;  3AZF C;  1BH8 A;  3AZM D;  3X1S B;  3UTA B;  3A1I A;  5AV9 C;  4QLC C;  2ARO D;  3AZI C;  3B6F D;  5CP6 A;  3C1C D;  4J8V D;  5DNN D;  1Q9C A;  3V9R A;  5AVC A;  3MGQ C;  2Y2J A;  1M19 A;  4KUD B;  5GXQ D;  1P3I C;  2Y2H A;  5DNM A;  5GT0 C;  1N1J B;  3AZE B;  5B32 A;  2ZY4 A;  3A6N B;  1P34 D;  5B32 G;  3EPJ A;  1HQ3 A;  1P3K A;  3X1T C;  5GT3 C;  4WNN B;  1KX5 B;  1P3L C;  4ZUX D;  3AV2 B;  5B0Y C;  5AV6 C;  3WTP E;  5B0Z B;  3WKJ D;  2CV5 C;  4E44 A;  3AZH B;  2CWE A;  3VH6 T;  3KSY A;  3R45 A;  3MGR C;  4J8W D;  4NE6 A;  3UT9 D;  1JFI B;  4LD9 A;  5AV5 B;  4XZQ A;  1P3G B;  3WA9 A;  3W99 B;  3LZ0 C;  3MGS D;  3MVD C;  5B31 B;  3FDD A;  5B2I C;  2XD5 A;  5KDM A;  3REH C;  1ZLA B;  3AV2 D;  2FJ7 C;  2Y2M A;  3AZK A;  5B0Z D;  4Z2M G;  3B6G B;  3O62 B;  4J8X A;  1EQZ C;  2HIO B;  5B24 A;  2FFF B;  1W2E A;  1KX3 D;  1P3F A;  1WWI A;  5BO0 A;  4EO5 C;  1AOI B;  4X23 D;  3WTP C;  3F6T A;  1P3A D;  5AV5 D;  1ID3 B;  2JSS A;  5JRG B;  3AFA B;  5E5A D;  4ZBJ C;  2NZD C;  3LZ1 B;  5C3I B;  4KGC B;  2XD1 A;  3P5J B;  3H0L C;  1BFM A;  3W96 D;  5AY8 B;  3MNN A;  1TAF A;  1S32 A;  2ZY2 A;  1M19 C;  5AVB D;  2RIQ A;  1WWS A;  5DNM C;  5JA4 B;  3NQJ A;  5F99 B;  3AFA D;  3AZG B;  5B1M D;  4R8P A;  4AWL B;  3AV1 C;  2NQB A;  5G49 B;  4YM6 C;  3AZF A;  2Y2K A;  4JJN D;  5AY8 D;  5AV9 A;  4QLC A;  4H9O A;  4E45 A;  3H0R C;  1A7W A;  3REI B;  3X1S A;  5CPI B;  4WU9 C;  3VH5 W;  1U35 B;  4Z66 D;  4YS3 C;  3REL A;  3MGQ A;  5F99 D;  3KWQ C;  1P3I A;  5GT0 A;  3C1B B;  4UPK A;  1F66 C;  3AZJ C;  3REK C;  3AZE A;  1N1J A;  1P3O B;  1M1A C;  3X1T A;  3UTB B;  5CP6 D;  1H3O B;  1P3L A;  5B0Y A;  2JCH A;  3REI D;  5AV6 A;  1KX5 A;  1M18 C;  2CV5 A;  5B32 D;  3X1U B;  3LJA C;  3VH6 A;  3MGP C;  1KX4 C;  1HQ3 D;  3KUY C;  3AZL B;  1P3K D;  2IO5 B;  5B1L C;  3MGR A;  3C1B D;  5CPJ D;  4XUJ B;  4HGA B;  3NQU A;  3AZH A;  4G92 B;  5AV8 C;  3LZ0 A;  1JFI A;  3MVD A;  2DF4 C;  3UTB D;  2RVQ D;  3AZN D;  1BH9 A;  1P3G A;  3AZM B;  5B2I A;  3WAA C;  3B0D C;  3REH A;  4M6B A;  2ARO B;  3TU4 C;  4H9P A;  1S32 C;  3B6F B;  5B2J C;  4J8U D;  3C1C B;  4J8V B;  4LD9 D;  5B33 C;  1P3P D;  2VQR A;  5DNN B;  3W98 B;  4XZQ D;  4KHA B;  3WA9 D;  3X1V D;  5BT1 D;  4UUZ B;  4WU8 D;  4G91 B;  4Z5T C;  2NQB C;  1AOI A;  2YFV A;  1P34 C;  1HTA A;  3REJ D;  3AZK D;  2NZD A;  5BNV B;  3AYW B;  4J8X D;  5JRG A;  1P3B C;  3A1K A;  2PYO D;  5B24 D;  5CHL B;  4ZUX B;  3X1S C;  1P3F D;  3WKJ B;  3UTA C;  1P3M D;  2J8P A;  3REL C;  3W98 D;  3UT9 B;  4J8W B;  4KUD C;  3VH5 A;  1TZY D;  3AZE C;  5B40 B;  4H9Q A;  3A6N C;  3MGS B;  3W97 A;  3AYW D;  3AV1 A;  3LEL D;  3MNN D;  3AZI B;  4YM6 A;  3AN2 D;  1KX5 C;  4NFT A;  3AV2 C;  4NE3 A;  3KXB D;  5B0Z C;  2Y2N A;  4WU9 A;  1KX3 B;  4X23 B;  4R8P D;  4YS3 A;  1P3A B;  3AZH C;  3KWQ A;  4CSR B;  5B40 D;  5E5A B;  1F66 A;  1P3G C;  3AZJ A;  3W99 C;  5AV9 D;  3REK A;  4QLC D;  3AZI D;  1M1A A;  5B31 C;  2HUE C;  4WV4 B;  3EPK A;  1ZLA C;  3W96 B;  3MGQ D;  3B6G C;  5CPK A;  5GT0 D;  5AVB B;  1P3I D;  4Z2M H;  3O62 C;  1M18 A;  2HIO C;  4CAY A;  3LJA A;  3MGP A;  1KX4 A;  3KUY A;  3X1U A;  1AOI C;  3B0B A;  5B1L A;  3X1T D;  5GT3 D;  2ZY3 A;  5B1M B;  2F8N A;  2F8N G;  2BYK A;  4H9R A;  1ID3 C;  5JRG C;  5AV8 A;  1P3L D;  5GSU B;  5B0Y D;  2ZM5 A;  3LZ1 C;  2CV5 D;  5C3I C;  4JJN B;  3WAA A;  2YFW B;  4KGC C;  3TU4 A;  5BNX A;  5B2J A;  5B33 A;  3WTP B;  4Z66 B;  4DRA A;  5DNN A;  3MVD D;  3VH5 T;  3W97 C;  1BH8 B;  4Z5T A;  5B2I D;  5F99 C;  5GXQ A;  3AZG C;  5GSU D;  2FJ7 D;  1P34 A;  4AWL C;  5CP6 B;  1P3B A;  1EQZ D;  5AVC B;  1M19 B;  2G5I C;  3UTA A;  5B32 B;  3WTP D;  4ZUX A;  5CPI C;  1HQ3 B;  1U35 C;  1P3K B;  5FUG B;  3EPH A;  5CPJ B;  2NZD D;  4KUD A;  3A6N A;  1KU5 A;  1B6W A;  3AZN B;  1P3O C;  3KFU G;  5AVC D;  2JE5 A;  4WNN A;  3UTB C;  1M19 D;  4DQY B;  5CPK C;  5DNM D;  4J8U B;  4LD9 B;  1P3P B;  3AV2 A;  5B0Z A;  4XZQ B;  3WA9 B;  1R4V A;  3X1U C;  3X1V B;  4WU8 B;  3AV1 D;  3AZL C;  2IO5 C;  5KDM B;  4YM6 D;  4XUJ C;  4HGA C;  3REJ B;  5AV5 A;  3AZK B;  4G92 C;  3B0C T;  4CSR A;  3W99 A;  1F1E A;  4J8X B;  2PYO B;  5B31 A;  5B24 B;  5B31 G;  4WU9 D;  3AZM C;  1P3F B;  5BO0 B;  1P3M B;  1ZLA A;  2ARO C;  2Y2P A;  4YS3 D;  3B6F C;  3IP4 C;  3KWQ D;  3B6G A;  3C1C C;  4J8V C;  3O62 A;  3H0M C;  5DNN C;  2HIO A;  1F66 D;  5GXQ C;  1M1A D;  1TZY B;  4G91 C;  1ID3 A;  3AFA A;  3LEL B;  3MNN B;  1S32 B;  2Y2O A;  3AN2 B;  1M18 D;  3LZ1 A;  4KGC A;  3LJA D;  4ZUX C;  2BG1 A;  1KX4 D;  3KXB B;  3KUY D;  3WKJ C;  5BS7 C;  5B1L D;  5AY8 A;  2Y2Q A;  2F8N D;  4R8P B;  2F8N K;  4H9N B;  5AV8 D;  3UT9 C;  4J8W C;  3AZF B;  5JA4 A;  5F99 A;  3WAA D;  3AZG A;  5AV9 B;  5B40 C;  4QLC B;  3MGS C;  2L5A A;  3TU4 D;  4H9O B;  1S32 D;  5B2J D;  5G49 A;  5B33 D;  3EPL A;  1B67 A;  4DRB A;  3REL B;  3MGQ B;  1P3I B;  5GT0 B;  3EG5 B;  3REI A;  5CPI A;  2NQB D;  4Z5T D;  1KX3 C;  1U35 A;  1PZR A;  4X23 C;  3AZF D;  5GT3 B;  3X1T B;  1P3A C;  4NE5 A;  5AV5 C;  1P3B D;  1T3U A;  5FUG A;  1P3L B;  3C1B A;  5CPJ A;  5B0Y B;  5E5A C;  5AV6 B;  3X1S D;  3UTA D;  2CV5 B;  1P3O A;  2BYM B;  3REL D;  3UTB A;  3AZN A;  4WJ3 C;  3W96 C;  1H3O A;  3MGR B;  3NQU B;  4KUD D;  5AVB C;  4J8U A;  3AZE D;  3A6N D;  3LZ0 B;  1P3P A;  3MVD B;  2Y2L A;  1BH9 B;  3AZL A;  5B2I B;  3AFA C;  3REH B;  3X1V A;  2FJ7 B;  2HUE B;  4H9P B;  4XUJ A;  5B1M C;  2DQN C;  5AV6 D;  4WU8 A;  1KX5 D;  2F8N H;  5GSU C;  3VH6 W;  1EQZ B;  2W8S A;  3REJ A;  2F2A C;  3AZM A;  4JJN C;  4EO5 B;  5AY8 C;  3MGR D;  2ARO A;  2PYO A;  3AZH D;  3B6F A;  3C1C A;  4J8V A;  2YFV B;  3LZ0 D;  1P3M A;  4Z66 C;  3W98 A;  1Z2C B;  4ZBJ B;  4KHA A;  1P3G D;  2NZD B;  3W99 D;  4H9S A;  3REH D;  4UUZ A;  5B31 D;  2UWX A;  1TZY A;  1ZLA D;  3V9R B;  3B6G D;  5BNV A;  5CP6 C;  3AYW A;  3O62 D;  3LEL A;  5DNM B;  2HIO D;  5AVC C;  3REI C;  3AN2 A;  3WKJ A;  5BS7 A;  1AOI D;  5B32 C;  4H9Q B;  3W97 B;  3KXB A;  3AV1 B;  1ID3 D;  1HQ3 C;  5JRG D;  1P3K C;  3UT9 A;  4YM6 B;  3C1B C;  4J8W A;  5CPJ C;  3LZ1 D;  4H9N A;  5B40 A;  4KGC D;  3MGS A;  2RVQ C;  3AZN C;  4WU9 B;  3AZI A;  3R45 B;  4YS3 B;  3KWQ B;  4J8U C; 
#chains in the Genus database with same CATH homology
 4LD9 C;  1P3P C;  3W97 D;  1F66 B;  4XZQ C;  3WA9 C;  3AZJ B;  3AZG D;  3REK B;  1KX3 A;  3X1V C;  1M1A B;  5BT1 C;  4X23 A;  1P3A A;  4WU8 C;  2ZY5 A;  5GT3 A;  3REJ C;  5E5A A;  3AZK C;  5CPK B;  1M18 B;  4J8X C;  2PYO C;  4CAY B;  5B24 C;  3LJA B;  5CPI D;  3MGP B;  1KX4 B;  3KUY B;  1U35 D;  1P3F C;  2BYM A;  1P3M C;  3W96 A;  5B1L B;  3W98 C;  2F8N B;  3AZJ D;  2BYK B;  4H9R B;  5AVB A;  4WZS B;  4H9S C;  5AV8 B;  3REK D;  1ULY A;  2Y2G A;  1P3O D;  1TZY C;  3B0D B;  3WAA B;  1TAF B;  2Y2I A;  3TU4 B;  5B1M A;  2LY8 A;  5BNX B;  5CPK D;  5B2J B;  3AYW C;  3LEL C;  5B33 B;  5GSU A;  3MNN C;  2FJ7 A;  3MGP D;  3AN2 C;  3NQJ B;  3X1U D;  4JJN A;  2YFW A;  1EQZ A;  3KXB C;  3AZL D;  2NQB B;  4Z5T B;  5GXQ B;  3AL0 C;  3B0C W;  3WTP A;  4Z66 A;  4XUJ D;  1P34 B;  4R8P C;  2G5H C;  1P3B B;  3AZF C;  1BH8 A;  3AZM D;  3X1S B;  3UTA B;  3A1I A;  5AV9 C;  4QLC C;  2ARO D;  3AZI C;  3B6F D;  5CP6 A;  3C1C D;  4J8V D;  5DNN D;  1Q9C A;  3V9R A;  5AVC A;  3MGQ C;  2Y2J A;  1M19 A;  4KUD B;  5GXQ D;  1P3I C;  2Y2H A;  5DNM A;  5GT0 C;  1N1J B;  3AZE B;  5B32 A;  2ZY4 A;  3A6N B;  1P34 D;  5B32 G;  3EPJ A;  1HQ3 A;  1P3K A;  3X1T C;  5GT3 C;  4WNN B;  1KX5 B;  1P3L C;  4ZUX D;  3AV2 B;  5B0Y C;  5AV6 C;  3WTP E;  5B0Z B;  3WKJ D;  2CV5 C;  4E44 A;  3AZH B;  2CWE A;  3VH6 T;  3KSY A;  3R45 A;  3MGR C;  4J8W D;  4NE6 A;  3UT9 D;  1JFI B;  4LD9 A;  5AV5 B;  4XZQ A;  1P3G B;  3WA9 A;  3W99 B;  3LZ0 C;  3MGS D;  3MVD C;  5B31 B;  3FDD A;  5B2I C;  2XD5 A;  5KDM A;  3REH C;  1ZLA B;  3AV2 D;  2FJ7 C;  2Y2M A;  3AZK A;  5B0Z D;  4Z2M G;  3B6G B;  3O62 B;  4J8X A;  1EQZ C;  2HIO B;  5B24 A;  2FFF B;  1W2E A;  1KX3 D;  1P3F A;  1WWI A;  5BO0 A;  4EO5 C;  1AOI B;  4X23 D;  3WTP C;  3F6T A;  1P3A D;  5AV5 D;  1ID3 B;  2JSS A;  5JRG B;  3AFA B;  5E5A D;  4ZBJ C;  2NZD C;  3LZ1 B;  5C3I B;  4KGC B;  2XD1 A;  3P5J B;  3H0L C;  1BFM A;  3W96 D;  5AY8 B;  3MNN A;  1TAF A;  1S32 A;  2ZY2 A;  1M19 C;  5AVB D;  2RIQ A;  1WWS A;  5DNM C;  5JA4 B;  3NQJ A;  5F99 B;  3AFA D;  3AZG B;  5B1M D;  4R8P A;  4AWL B;  3AV1 C;  2NQB A;  5G49 B;  4YM6 C;  3AZF A;  2Y2K A;  4JJN D;  5AY8 D;  5AV9 A;  4QLC A;  4H9O A;  4E45 A;  3H0R C;  1A7W A;  3REI B;  3X1S A;  5CPI B;  4WU9 C;  3VH5 W;  1U35 B;  4Z66 D;  4YS3 C;  3REL A;  3MGQ A;  5F99 D;  3KWQ C;  1P3I A;  5GT0 A;  3C1B B;  4UPK A;  1F66 C;  3AZJ C;  3REK C;  3AZE A;  1N1J A;  1P3O B;  1M1A C;  3X1T A;  3UTB B;  5CP6 D;  1H3O B;  1P3L A;  5B0Y A;  2JCH A;  3REI D;  5AV6 A;  1KX5 A;  1M18 C;  2CV5 A;  5B32 D;  3X1U B;  3LJA C;  3VH6 A;  3MGP C;  1KX4 C;  1HQ3 D;  3KUY C;  3AZL B;  1P3K D;  2IO5 B;  5B1L C;  3MGR A;  3C1B D;  5CPJ D;  4XUJ B;  4HGA B;  3NQU A;  3AZH A;  4G92 B;  5AV8 C;  3LZ0 A;  1JFI A;  3MVD A;  2DF4 C;  3UTB D;  2RVQ D;  3AZN D;  1BH9 A;  1P3G A;  3AZM B;  5B2I A;  3WAA C;  3B0D C;  3REH A;  4M6B A;  2ARO B;  3TU4 C;  4H9P A;  1S32 C;  3B6F B;  5B2J C;  4J8U D;  3C1C B;  4J8V B;  4LD9 D;  5B33 C;  1P3P D;  2VQR A;  5DNN B;  3W98 B;  4XZQ D;  4KHA B;  3WA9 D;  3X1V D;  5BT1 D;  4UUZ B;  4WU8 D;  4G91 B;  4Z5T C;  2NQB C;  1AOI A;  2YFV A;  1P34 C;  1HTA A;  3REJ D;  3AZK D;  2NZD A;  5BNV B;  3AYW B;  4J8X D;  5JRG A;  1P3B C;  3A1K A;  2PYO D;  5B24 D;  5CHL B;  4ZUX B;  3X1S C;  1P3F D;  3WKJ B;  3UTA C;  1P3M D;  2J8P A;  3REL C;  3W98 D;  3UT9 B;  4J8W B;  4KUD C;  3VH5 A;  1TZY D;  3AZE C;  5B40 B;  4H9Q A;  3A6N C;  3MGS B;  3W97 A;  3AYW D;  3AV1 A;  3LEL D;  3MNN D;  3AZI B;  4YM6 A;  3AN2 D;  1KX5 C;  4NFT A;  3AV2 C;  4NE3 A;  3KXB D;  5B0Z C;  2Y2N A;  4WU9 A;  1KX3 B;  4X23 B;  4R8P D;  4YS3 A;  1P3A B;  3AZH C;  3KWQ A;  4CSR B;  5B40 D;  5E5A B;  1F66 A;  1P3G C;  3AZJ A;  3W99 C;  5AV9 D;  3REK A;  4QLC D;  3AZI D;  1M1A A;  5B31 C;  2HUE C;  4WV4 B;  3EPK A;  1ZLA C;  3W96 B;  3MGQ D;  3B6G C;  5CPK A;  5GT0 D;  5AVB B;  1P3I D;  4Z2M H;  3O62 C;  1M18 A;  2HIO C;  4CAY A;  3LJA A;  3MGP A;  1KX4 A;  3KUY A;  3X1U A;  1AOI C;  3B0B A;  5B1L A;  3X1T D;  5GT3 D;  2ZY3 A;  5B1M B;  2F8N A;  2F8N G;  2BYK A;  4H9R A;  1ID3 C;  5JRG C;  5AV8 A;  1P3L D;  5GSU B;  5B0Y D;  2ZM5 A;  3LZ1 C;  2CV5 D;  5C3I C;  4JJN B;  3WAA A;  2YFW B;  4KGC C;  3TU4 A;  5BNX A;  5B2J A;  5B33 A;  3WTP B;  4Z66 B;  4DRA A;  5DNN A;  3MVD D;  3VH5 T;  3W97 C;  1BH8 B;  4Z5T A;  5B2I D;  5F99 C;  5GXQ A;  3AZG C;  5GSU D;  2FJ7 D;  1P34 A;  4AWL C;  5CP6 B;  1P3B A;  1EQZ D;  5AVC B;  1M19 B;  2G5I C;  3UTA A;  5B32 B;  3WTP D;  4ZUX A;  5CPI C;  1HQ3 B;  1U35 C;  1P3K B;  5FUG B;  3EPH A;  5CPJ B;  2NZD D;  4KUD A;  3A6N A;  1KU5 A;  1B6W A;  3AZN B;  1P3O C;  3KFU G;  5AVC D;  2JE5 A;  4WNN A;  3UTB C;  1M19 D;  4DQY B;  5CPK C;  5DNM D;  4J8U B;  4LD9 B;  1P3P B;  3AV2 A;  5B0Z A;  4XZQ B;  3WA9 B;  1R4V A;  3X1U C;  3X1V B;  4WU8 B;  3AV1 D;  3AZL C;  2IO5 C;  5KDM B;  4YM6 D;  4XUJ C;  4HGA C;  3REJ B;  5AV5 A;  3AZK B;  4G92 C;  3B0C T;  4CSR A;  3W99 A;  1F1E A;  4J8X B;  2PYO B;  5B31 A;  5B24 B;  5B31 G;  4WU9 D;  3AZM C;  1P3F B;  5BO0 B;  1P3M B;  1ZLA A;  2ARO C;  2Y2P A;  4YS3 D;  3B6F C;  3IP4 C;  3KWQ D;  3B6G A;  3C1C C;  4J8V C;  3O62 A;  3H0M C;  5DNN C;  2HIO A;  1F66 D;  5GXQ C;  1M1A D;  1TZY B;  4G91 C;  1ID3 A;  3AFA A;  3LEL B;  3MNN B;  1S32 B;  2Y2O A;  3AN2 B;  1M18 D;  3LZ1 A;  4KGC A;  3LJA D;  4ZUX C;  2BG1 A;  1KX4 D;  3KXB B;  3KUY D;  3WKJ C;  5BS7 C;  5B1L D;  5AY8 A;  2Y2Q A;  2F8N D;  4R8P B;  2F8N K;  4H9N B;  5AV8 D;  3UT9 C;  4J8W C;  3AZF B;  5JA4 A;  5F99 A;  3WAA D;  3AZG A;  5AV9 B;  5B40 C;  4QLC B;  3MGS C;  2L5A A;  3TU4 D;  4H9O B;  1S32 D;  5B2J D;  5G49 A;  5B33 D;  3EPL A;  1B67 A;  4DRB A;  3REL B;  3MGQ B;  1P3I B;  5GT0 B;  3EG5 B;  3REI A;  5CPI A;  2NQB D;  4Z5T D;  1KX3 C;  1U35 A;  1PZR A;  4X23 C;  3AZF D;  5GT3 B;  3X1T B;  1P3A C;  4NE5 A;  5AV5 C;  1P3B D;  1T3U A;  5FUG A;  1P3L B;  3C1B A;  5CPJ A;  5B0Y B;  5E5A C;  5AV6 B;  3X1S D;  3UTA D;  2CV5 B;  1P3O A;  2BYM B;  3REL D;  3UTB A;  3AZN A;  4WJ3 C;  3W96 C;  1H3O A;  3MGR B;  3NQU B;  4KUD D;  5AVB C;  4J8U A;  3AZE D;  3A6N D;  3LZ0 B;  1P3P A;  3MVD B;  2Y2L A;  1BH9 B;  3AZL A;  5B2I B;  3AFA C;  3REH B;  3X1V A;  2FJ7 B;  2HUE B;  4H9P B;  4XUJ A;  5B1M C;  2DQN C;  5AV6 D;  4WU8 A;  1KX5 D;  2F8N H;  5GSU C;  3VH6 W;  1EQZ B;  2W8S A;  3REJ A;  2F2A C;  3AZM A;  4JJN C;  4EO5 B;  5AY8 C;  3MGR D;  2ARO A;  2PYO A;  3AZH D;  3B6F A;  3C1C A;  4J8V A;  2YFV B;  3LZ0 D;  1P3M A;  4Z66 C;  3W98 A;  1Z2C B;  4ZBJ B;  4KHA A;  1P3G D;  2NZD B;  3W99 D;  4H9S A;  3REH D;  4UUZ A;  5B31 D;  2UWX A;  1TZY A;  1ZLA D;  3V9R B;  3B6G D;  5BNV A;  5CP6 C;  3AYW A;  3O62 D;  3LEL A;  5DNM B;  2HIO D;  5AVC C;  3REI C;  3AN2 A;  3WKJ A;  5BS7 A;  1AOI D;  5B32 C;  4H9Q B;  3W97 B;  3KXB A;  3AV1 B;  1ID3 D;  1HQ3 C;  5JRG D;  1P3K C;  3UT9 A;  4YM6 B;  3C1B C;  4J8W A;  5CPJ C;  3LZ1 D;  4H9N A;  5B40 A;  4KGC D;  3MGS A;  2RVQ C;  3AZN C;  4WU9 B;  3AZI A;  3R45 B;  4YS3 B;  3KWQ B;  4J8U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...