4J8UB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uB00
2F8NA 5DNNC 2BYMA 1P3AB 4JJNB 1P3KA 1EQZB 3B6GA 4QLCC 4X23A 4KHAB 3X1VA 1N1JA 1ZLAA 1P3PB 3W99B 5B2ID 5FUGA 1ID3C 5JRGB 4H9OB 5CPIC 5GT3D 4Z5TC 4R8PB 4EO5C 4NFTA 3WTPE 5AV5D 1P3FA 4H9RB 1M18D 1F66C 3W98A 4J8UB 5AVBD 1KX5D 1U35B 3RELB 2FJ7A 1BFMA 1P3KD 3B6GD 1KX4C 5JA4A 4HGAB 4X23D 3X1VD 3MNND 1KX3A 3B6FB 5B33A 1TZYB 4WU8A 5C3IB 4J8XC 3R45A 3KUYC 5CPKC 3KWQA 1P3OA 3MGPC 1S32A 1P3PC 3W97D 2HIOB 3MGRD 5B31A 3WKJA 3X1UB 3B0CT 4R8PC 5GT0B 3MGSA 1H3OB 3VH6W 1WWIA 5G49B 3REJD 5AVCC 1BH8A 5B40A 3AZKA 1KX3D 3LZ0C 3AV1C 1U35C 3RELC 3AZNC 1Q9CA 4YM6A 4H9QA 5E5AA 5B2IB 5GSUA 4Z66D 3X1SA 5GT3B 3KWQD 5DNNA 3B6FC 3AZJC 5B0ZC 3AYWC 5AV5B 1M18B 4QLCA 5AVBB 3MGSD 4YS3D 3V9RB 4E44A 3MVDB 3C1BC 3A6NC 1KX5B 3AFAC 3REHB 4G92C 5B40D 3AZKD 5BT1C 1P3KB 4LD9D 3AZMA 1M19D 4X23B 5GT0C 3AZLC 3X1VB 4ZUXC 4YM6D 3MNNB 5E5AD 5FUGB 3WA9A 4XUJC 1P3IB 5AY8C 1BH9A 1KX4A 1P3MA 3W97B 3MGRB 1M18C 3REJB 4J8XA 2BYKB 3KUYA 3AZMD 5CPKA 5F99D 3WTPA 4J8WD 3UTBB 1P3GC 3MVDC 1KX3B 5B24A 1KX5C 3REHC 2CV5D 4Z66B 3R45B 5B32A 2NQBC 5B1LC 3KWQB 2IO5B 3LELB 1P3MD 5BO0A 3LZ0A 3AV1A 3AZEC 3AZNA 5DNMA 1P3IC 3MGSB 4YS3B 1P3BD 1A7WA 3AZHD 5CPJC 3UTAA 3AZID 5AV8C 4Z2MH 3AN2D 5B40B 3WTPD 4LD9B 1TAFB 5B0ZA 3AZJA 3AYWA 1M19B 5B24D 3LJAC 5BNVA 4DRAA 4YM6B 4H9QB 5E5AB 3REJC 3AV2D 5B32D 5B2JB 3C1CC 3C1BA 3A6NA 3W96A 3WAAC 3LZ1C 3AFAA 3UTBC 3X1TB 3MGQA 4M6BA 5KDMA 2F8NH 4CAYB 3B0CW 3AZLA 5DNMD 4KGCC 4ZUXA 4WU9A 3UT9A 3UTAD 3LELC 4XUJA 2PYOC 3TU4D 5AV9A 5CP6C 3KXBD 3AZMB 1KU5A 4AWLC 5F99B 4KUDA 4J8WB 3AZGC 2NZDB 3AZFC 3REKC 2CV5B 4NE6A 1BH9B 1P3MB 1P34C 5GXQC 4WU9D 5B2JC 1P3GA 4NE3A 5B0YC 3UT9D 2F8ND 3X1TC 2YFVA 3O62A 5B1MA 4NE5A 3NQJA 3REIC 1P3BB 5AV9D 3AZHB 4Z2MG 3AZIB 3AN2B 3WTPB 1ZLAD 1P3AC 4JJNC 1EQZC 3AZEA 3AV2B 5B32B 1P3FD 5CPJA 5CHLB 3W98D 2RVQC 5AV6B 2AROA 3W99C 1P3LA 4H9PB 5JRGC 1B6WA 1AOIB 2F8NG 2NZDC 2FJ7D 5DNMB 5B1MD 2CV5C 4J8UC 3UTAB 4XZQA 1JFIA 3C1CA 4ZBJB 3WAAA 3TU4B 5B33D 3KXBB 2CWEA 4WU8D 4J8VA 1HQ3A 4UUZB 1M1AA 4HGAC 4KGCA 1P3OD 1S32D 2AROD 1TZYC 5B31D 5KDMB 5C3IC 3WKJD 3NQUA 4WU9B 1ID3A 3UT9B 2F8NB 5AV6C 5CPIA 2BYMB 3AZGA 4Z5TA 2HIOC 1AOIC 5BNXA 5AV9B 3X1UC 3B6GB 1ULYA 1F66A 1N1JB 1ZLAB 4J8VD 2HUEB 1HQ3D 1WWSA 5GSUD 5GXQA 5B0YA 3X1SD 5DNND 5B31G 1P3FB 4QLCD 3W98B 5B2IC 4WNNA 5GT3C 2FJ7B 5CPID 4JJNA 5AV5C 4Z5TD 4H9NA 4KHAA 5AVBC 5JA4B 1F66D 3MGPA 4WV4B 1P3PA 5B33B 3WA9D 4WU8B 4R8PA 1P3KC 3B6GC 3VH5T 4X23C 4H9RA 5AVCA 3B0DB 3X1VC 4J8UA 1P3OB 3MNNC 3VH5A 1S32B 1KX4D 3B0BA 5BS7C 5B31B 3WKJB 1U35A 3RELA 4J8XD 1BH8B 3KUYD 5CPKD 1JFIB 3W97C 3AZKB 3MGPD 3MGRC 3B6FA 1P3PD 4G91B 1TZYA 2FJ7C 4R8PD 4J8VB 5GSUB 3X1SB 5AVCD 5DNNB 1KX3C 2HIOA 3X1UA 4QLCB 4WU8C 3LZ0D 3AV1D 1U35D 5GT0A 3AZND 1H3OA 4Z66C 5G49A 3KWQC 1P3OC 2IO5C 5CPIB 4EO5B 5AY8A 3AZJD 5B0ZD 3B6FD 3AYWD 3MGSC 1F66B 4YS3C 5B32G 3WA9B 5GT3A 3C1BD 3A6ND 5B40C 3AZKC 3W96D 4LD9C 3AFAD 1M19C 4G91C 3MGQD 1M18A 5BT1D 4YM6C 1KX4B 5E5AC 2YFWA 5GT0D 1B67A 3AZLD 4ZUXD 3V9RA 3MVDA 1KX5A 3X1SC 4XUJD 3REHA 4J8XB 4H9NB 5AY8D 3KUYB 5CPKB 2NQBA 5B1LA 2L5AA 3MNNA 3MGPB 4KUDD 2LY8A 5BS7A 5B24B 4CSRA 1P3IA 3AZMC 5F99C 5AVCB 4J8WC 5AV8A 3W97A 3WA9C 3MGRA 5BO0B 1P3GD 3MVDD 3LJAA 3LZ0B 3AV1B 3AZNB 3O62D 3REHD 3REJA 2BYKA 2NQBD 1P3MC 5B1LD 3LZ1A 3UTBA 3AZJB 5B0ZB 3AYWB 5BNVB 1P3BC 3AZED 3AZHC 1P3ID 4Z66A 3AZIC 3VH5W 3C1BB 5CPJD 3A6NB 3WTPC 3AN2C 3LELA 3W96B 3AFAB 1P3LD 5AV8D 2PYOA 5B24C 3MGQB 4G92B 5CP6A 3LJAD 3AV2C 3AZLB 4YS3A 4ZUXB 5B32C 4XZQD 4XUJB 3C1CD 3REKA 3AZFA 3LZ1D 3WAAD 2JSSA 1TAFA 3UTBD 4LD9A 1M19A 5AY8B 5DNMC 4KUDB 1M1AD 1P34A 3UTAC 4KGCD 5B2JA 4ZBJC 3X1TA 3TU4C 3LELD 2PYOD 3KXBC 3REIA 5CP6D 4CAYA 4H9SC 2YFWB 1P3GB 1ID3D 1HTAA 1R4VA 3W96C 1P3AA 2YFVB 3O62B 5B1MB 3AZGD 3AZFD 1EQZA 3MGQC 3REKD 3NQJB 5F99A 2NQBB 5B1LB 4J8WA 3W99A 4WU9C 5JRGA 4H9OA 3UT9C 2F8NK 1P34D 5GXQD 2NZDA 5B2JD 5B0YD 3X1TD 3AZEB 4CSRB 3KSYA 5AV9C 2CV5A 1F1EA 3REID 5CPJB 1ZLAC 4KUDC 2AROB 2HUEC 5AV8B 1P3LB 3VH6T 3LJAB 1P3AD 4JJND 1P3BA 1EQZD 1P3FC 3VH6A 3AZHA 3W98C 3AZIA 4XZQB 3C1CB 3AN2A 2RVQD 4DRBA 3W99D 3LZ1B 3WAAB 5JRGD 4E45A 4WNNB 5B1MC 3O62C 2NZDD 3AV2A 1HQ3B 1M1AB 4KGCB 5AV6A 4J8UD 4H9PA 5B33C 2PYOB 1AOIA 5CP6B 3RELD 4AWLB 3NQUB 3B0DC 1ID3B 1S32C 2AROC 1P3LC 3AZGB 4Z5TB 4WZSB 3REKB 3TU4A 3AZFB 5B31C 3WKJC 5BNXB 3KXBA 1TZYD 5B2IA 4UUZA 4H9SA 1P34B 5GXQB 4XZQC 5B0YB 5AV6D 5AV5A 2HIOD 1AOID 3REIB 3X1UD 5AVBA 4J8VC 1HQ3C 1M1AC 5GSUC
chains in the Genus database with same CATH superfamily
2UWXA 5DNNC 2F8NA 3EPKA 2BYMA 1P3AB 4JJNB 1P3KA 1EQZB 3B6GA 4QLCC 4X23A 4KHAB 3X1VA 1N1JA 1ZLAA 1P3PB 3W99B 5B2ID 5FUGA 1ID3C 5JRGB 4H9OB 5CPIC 5GT3D 4Z5TC 4R8PB 4EO5C 4NFTA 3WTPE 5AV5D 1P3FA 4H9RB 1M18D 1F66C 3H0MC 3W98A 4J8UB 5AVBD 1KX5D 2ZY5A 1U35B 3RELB 2FJ7A 3P5JB 1BFMA 1P3KD 4WJ3C 3B6GD 1KX4C 5JA4A 4HGAB 4X23D 3X1VD 3MNND 1KX3A 3B6FB 5B33A 1TZYB 4WU8A 5C3IB 4J8XC 3R45A 3KUYC 5CPKC 3KWQA 1P3OA 3MGPC 1S32A 1P3PC 3W97D 2HIOB 3MGRD 5B31A 3WKJA 3X1UB 3B0CT 4R8PC 5GT0B 3MGSA 1H3OB 3VH6W 1WWIA 5G49B 3REJD 5AVCC 1BH8A 2J8PA 5B40A 3AZKA 3H0LC 1KX3D 3LZ0C 3AV1C 1U35C 3RELC 4UPKA 3AZNC 1Q9CA 4YM6A 4H9QA 5E5AA 5B2IB 5GSUA 4Z66D 3X1SA 5GT3B 3KWQD 5DNNA 3B6FC 3AZJC 5B0ZC 3AYWC 5AV5B 3IP4C 1M18B 4QLCA 5AVBB 3F6TA 3MGSD 4YS3D 3V9RB 4E44A 3MVDB 3C1BC 3A6NC 1KX5B 3AFAC 2FFFB 3REHB 4G92C 5B40D 3AZKD 5BT1C 1P3KB 4LD9D 3AZMA 1M19D 4X23B 5GT0C 3AZLC 2G5IC 4ZUXC 4YM6D 3X1VB 3MNNB 5E5AD 2DF4C 5FUGB 3WA9A 4XUJC 1P3IB 5AY8C 1BH9A 1KX4A 2Y2MA 2Y2JA 1P3MA 3W97B 3MGRB 2JCHA 1M18C 2ZY2A 3REJB 4J8XA 2BYKB 3KUYA 3AZMD 5CPKA 5F99D 3WTPA 4J8WD 3UTBB 1P3GC 3MVDC 1KX3B 5B24A 1KX5C 3REHC 2CV5D 4Z66B 3R45B 5B32A 2NQBC 5B1LC 4DQYB 3KWQB 2IO5B 3LELB 1P3MD 5BO0A 3LZ0A 3AV1A 3AZEC 3AZNA 5DNMA 1P3IC 3MGSB 2VQRA 4YS3B 1P3BD 1A7WA 3AZHD 5CPJC 3UTAA 3AZID 5AV8C 4Z2MH 3AN2D 5B40B 3WTPD 4LD9B 1TAFB 5B0ZA 3AZJA 3AYWA 1M19B 5B24D 3LJAC 5BNVA 4DRAA 4YM6B 4H9QB 5E5AB 3REJC 3AV2D 5B32D 5B2JB 3C1CC 3C1BA 3A6NA 3W96A 3WAAC 3LZ1C 3AFAA 3UTBC 3X1TB 3MGQA 4M6BA 5KDMA 2F8NH 4CAYB 3B0CW 3A1IA 3AZLA 5DNMD 4KGCC 4ZUXA 4WU9A 3UT9A 3EG5B 3UTAD 3LELC 4XUJA 2PYOC 3TU4D 5AV9A 5CP6C 3KXBD 3AZMB 1KU5A 4AWLC 5F99B 4KUDA 4J8WB 3AZGC 2NZDB 3AZFC 3REKC 2DQNC 2CV5B 4NE6A 1BH9B 2Y2PA 1P3MB 1P34C 5GXQC 4WU9D 5B2JC 1P3GA 4NE3A 5B0YC 3UT9D 2F8ND 3X1TC 2YFVA 3O62A 5B1MA 2ZM5A 4NE5A 3NQJA 3REIC 1P3BB 5AV9D 3AZHB 2BG1A 4Z2MG 3AZIB 3AL0C 3AN2B 3WTPB 1ZLAD 1P3AC 4JJNC 1EQZC 3AZEA 3AV2B 5B32B 1P3FD 5CPJA 5CHLB 3W98D 2RVQC 5AV6B 2AROA 3W99C 1P3LA 4H9PB 5JRGC 1B6WA 1AOIB 2F8NG 3EPHA 2NZDC 1PZRA 3EPLA 2FJ7D 5DNMB 5B1MD 2CV5C 4J8UC 3UTAB 4XZQA 1JFIA 3C1CA 4ZBJB 3WAAA 3TU4B 5B33D 3KXBB 2CWEA 4WU8D 4J8VA 3FDDA 1HQ3A 4UUZB 1M1AA 4HGAC 4KGCA 1P3OD 1S32D 2AROD 2Y2NA 1TZYC 5B31D 5KDMB 5C3IC 3WKJD 3NQUA 4WU9B 1ID3A 3UT9B 2F8NB 5AV6C 5CPIA 2BYMB 3AZGA 4Z5TA 2HIOC 1AOIC 5BNXA 5AV9B 3X1UC 3B6GB 1ULYA 1F66A 1N1JB 1ZLAB 4J8VD 2HUEB 1HQ3D 1WWSA 5GSUD 5GXQA 5B0YA 3X1SD 5DNND 5B31G 1P3FB 4QLCD 3W98B 5B2IC 4WNNA 5GT3C 2FJ7B 5CPID 4JJNA 5AV5C 4Z5TD 4H9NA 4KHAA 5AVBC 5JA4B 1F66D 3MGPA 4WV4B 1P3PA 5B33B 3WA9D 4WU8B 2ZY3A 4R8PA 1P3KC 3B6GC 3VH5T 4X23C 4H9RA 5AVCA 3B0DB 3X1VC 4J8UA 1P3OB 3MNNC 3VH5A 1S32B 1KX4D 3B0BA 2F2AC 5BS7C 5B31B 3WKJB 1U35A 3RELA 2Y2QA 4J8XD 1BH8B 3KUYD 5CPKD 1JFIB 3W97C 3AZKB 3MGPD 3MGRC 3B6FA 1P3PD 4G91B 1TZYA 2FJ7C 3H0RC 4R8PD 4J8VB 5GSUB 2ZY4A 5AVCD 3X1SB 5DNNB 1KX3C 2HIOA 2XD5A 3X1UA 4QLCB 4WU8C 3LZ0D 3AV1D 1U35D 5GT0A 3AZND 1H3OA 4Z66C 5G49A 3KWQC 1P3OC 2IO5C 5CPIB 4EO5B 5AY8A 3AZJD 5B0ZD 3B6FD 3AYWD 2RIQA 1Z2CB 3MGSC 4YS3C 1F66B 5B32G 3WA9B 5GT3A 3C1BD 3A6ND 5B40C 3AZKC 3W96D 4LD9C 3AFAD 1M19C 4G91C 3MGQD 1M18A 5BT1D 4YM6C 1KX4B 5E5AC 2YFWA 5GT0D 1B67A 3AZLD 4ZUXD 3V9RA 3MVDA 1KX5A 3X1SC 4XUJD 3REHA 2G5HC 4J8XB 4H9NB 5AY8D 3KUYB 5CPKB 2NQBA 5B1LA 2L5AA 3MNNA 2JE5A 3MGPB 4KUDD 2LY8A 2Y2KA 5BS7A 5B24B 2Y2HA 4CSRA 1P3IA 3AZMC 5F99C 5AVCB 4J8WC 5AV8A 2Y2LA 3W97A 3WA9C 3MGRA 5BO0B 1P3GD 3MVDD 3A1KA 3LJAA 3LZ0B 3AV1B 3AZNB 3O62D 3REHD 3REJA 2BYKA 2NQBD 1P3MC 5B1LD 3LZ1A 3UTBA 3AZJB 5B0ZB 3AYWB 5BNVB 1P3BC 3AZED 3AZHC 1P3ID 4Z66A 3AZIC 3VH5W 3C1BB 5CPJD 3A6NB 3WTPC 3AN2C 3LELA 3W96B 3AFAB 1P3LD 5AV8D 2PYOA 5B24C 3MGQB 4G92B 5CP6A 3LJAD 3AV2C 3AZLB 4YS3A 4ZUXB 5B32C 4XZQD 4XUJB 3C1CD 3REKA 3AZFA 3LZ1D 3WAAD 2JSSA 1TAFA 3UTBD 4LD9A 1M19A 5AY8B 5DNMC 4KUDB 1M1AD 1P34A 3UTAC 4KGCD 5B2JA 4ZBJC 3X1TA 3TU4C 3LELD 2PYOD 3KXBC 3REIA 2Y2OA 4CAYA 5CP6D 2W8SA 4H9SC 2YFWB 1P3GB 1ID3D 1HTAA 1R4VA 3W96C 1P3AA 2YFVB 3O62B 5B1MB 3AZGD 3AZFD 1EQZA 3MGQC 3REKD 3NQJB 5F99A 2NQBB 5B1LB 4J8WA 3W99A 4WU9C 5JRGA 4H9OA 3UT9C 2F8NK 1P34D 5GXQD 2NZDA 5B2JD 5B0YD 3X1TD 3AZEB 4CSRB 2XD1A 3KSYA 5AV9C 2CV5A 1F1EA 3REID 5CPJB 1ZLAC 4KUDC 2AROB 2HUEC 5AV8B 1P3LB 2Y2IA 3VH6T 3LJAB 1P3AD 4JJND 1P3BA 1EQZD 1P3FC 3VH6A 3AZHA 3W98C 3AZIA 4XZQB 3C1CB 3AN2A 2RVQD 4DRBA 3W99D 3LZ1B 3WAAB 5JRGD 4E45A 4WNNB 5B1MC 3O62C 2NZDD 1T3UA 3AV2A 1HQ3B 1M1AB 4KGCB 5AV6A 4J8UD 4H9PA 5B33C 2PYOB 1AOIA 5CP6B 3RELD 4AWLB 3NQUB 3B0DC 1ID3B 1S32C 2AROC 1P3LC 3AZGB 4Z5TB 4WZSB 2Y2GA 3REKB 3TU4A 3AZFB 5B31C 3WKJC 5BNXB 3KXBA 1W2EA 1TZYD 3KFUG 5B2IA 4UUZA 4H9SA 1P34B 5GXQB 4XZQC 5B0YB 5AV6D 3EPJA 5AV5A 2HIOD 1AOID 3REIB 3X1UD 5AVBA 4J8VC 1HQ3C 1M1AC 5GSUC
chains in the Genus database with same CATH topology
2UWXA 5DNNC 2F8NA 3EPKA 2BYMA 1P3AB 4JJNB 1P3KA 1EQZB 3B6GA 4QLCC 4X23A 4KHAB 3X1VA 1N1JA 1ZLAA 1P3PB 3W99B 5B2ID 5FUGA 1ID3C 5JRGB 4H9OB 5CPIC 5GT3D 4Z5TC 4R8PB 4EO5C 4NFTA 3WTPE 5AV5D 1P3FA 4H9RB 1M18D 1F66C 3H0MC 3W98A 4J8UB 5AVBD 1KX5D 2ZY5A 1U35B 3RELB 2FJ7A 3P5JB 1BFMA 1P3KD 4WJ3C 3B6GD 1KX4C 5JA4A 4HGAB 4X23D 3X1VD 3MNND 1KX3A 3B6FB 5B33A 1TZYB 4WU8A 5C3IB 4J8XC 3R45A 3KUYC 5CPKC 3KWQA 1P3OA 3MGPC 1S32A 1P3PC 3W97D 2HIOB 3MGRD 5B31A 3WKJA 3X1UB 3B0CT 4R8PC 5GT0B 3MGSA 1H3OB 3VH6W 1WWIA 5G49B 3REJD 5AVCC 1BH8A 2J8PA 5B40A 3AZKA 3H0LC 1KX3D 3LZ0C 3AV1C 1U35C 3RELC 4UPKA 3AZNC 1Q9CA 4YM6A 4H9QA 5E5AA 5B2IB 5GSUA 4Z66D 3X1SA 5GT3B 3KWQD 5DNNA 3B6FC 3AZJC 5B0ZC 3AYWC 5AV5B 3IP4C 1M18B 4QLCA 5AVBB 3F6TA 3MGSD 4YS3D 3V9RB 4E44A 3MVDB 3C1BC 3A6NC 1KX5B 3AFAC 2FFFB 3REHB 4G92C 5B40D 3AZKD 5BT1C 1P3KB 4LD9D 3AZMA 1M19D 4X23B 5GT0C 3AZLC 2G5IC 4ZUXC 4YM6D 3X1VB 3MNNB 5E5AD 2DF4C 5FUGB 3WA9A 4XUJC 1P3IB 5AY8C 1BH9A 1KX4A 2Y2MA 2Y2JA 1P3MA 3W97B 3MGRB 2JCHA 1M18C 2ZY2A 3REJB 4J8XA 2BYKB 3KUYA 3AZMD 5CPKA 5F99D 3WTPA 4J8WD 3UTBB 1P3GC 3MVDC 1KX3B 5B24A 1KX5C 3REHC 2CV5D 4Z66B 3R45B 5B32A 2NQBC 5B1LC 4DQYB 3KWQB 2IO5B 3LELB 1P3MD 5BO0A 3LZ0A 3AV1A 3AZEC 3AZNA 5DNMA 1P3IC 3MGSB 2VQRA 4YS3B 1P3BD 1A7WA 3AZHD 5CPJC 3UTAA 3AZID 5AV8C 4Z2MH 3AN2D 5B40B 3WTPD 4LD9B 1TAFB 5B0ZA 3AZJA 3AYWA 1M19B 5B24D 3LJAC 5BNVA 4DRAA 4YM6B 4H9QB 5E5AB 3REJC 3AV2D 5B32D 5B2JB 3C1CC 3C1BA 3A6NA 3W96A 3WAAC 3LZ1C 3AFAA 3UTBC 3X1TB 3MGQA 4M6BA 5KDMA 2F8NH 4CAYB 3B0CW 3A1IA 3AZLA 5DNMD 4KGCC 4ZUXA 4WU9A 3UT9A 3EG5B 3UTAD 3LELC 4XUJA 2PYOC 3TU4D 5AV9A 5CP6C 3KXBD 3AZMB 1KU5A 4AWLC 5F99B 4KUDA 4J8WB 3AZGC 2NZDB 3AZFC 3REKC 2DQNC 2CV5B 4NE6A 1BH9B 2Y2PA 1P3MB 1P34C 5GXQC 4WU9D 5B2JC 1P3GA 4NE3A 5B0YC 3UT9D 2F8ND 3X1TC 2YFVA 3O62A 5B1MA 2ZM5A 4NE5A 3NQJA 3REIC 1P3BB 5AV9D 3AZHB 2BG1A 4Z2MG 3AZIB 3AL0C 3AN2B 3WTPB 1ZLAD 1P3AC 4JJNC 1EQZC 3AZEA 3AV2B 5B32B 1P3FD 5CPJA 5CHLB 3W98D 2RVQC 5AV6B 2AROA 3W99C 1P3LA 4H9PB 5JRGC 1B6WA 1AOIB 2F8NG 3EPHA 2NZDC 1PZRA 3EPLA 2FJ7D 5DNMB 5B1MD 2CV5C 4J8UC 3UTAB 4XZQA 1JFIA 3C1CA 4ZBJB 3WAAA 3TU4B 5B33D 3KXBB 2CWEA 4WU8D 4J8VA 3FDDA 1HQ3A 4UUZB 1M1AA 4HGAC 4KGCA 1P3OD 1S32D 2AROD 2Y2NA 1TZYC 5B31D 5KDMB 5C3IC 3WKJD 3NQUA 4WU9B 1ID3A 3UT9B 2F8NB 5AV6C 5CPIA 2BYMB 3AZGA 4Z5TA 2HIOC 1AOIC 5BNXA 5AV9B 3X1UC 3B6GB 1ULYA 1F66A 1N1JB 1ZLAB 4J8VD 2HUEB 1HQ3D 1WWSA 5GSUD 5GXQA 5B0YA 3X1SD 5DNND 5B31G 1P3FB 4QLCD 3W98B 5B2IC 4WNNA 5GT3C 2FJ7B 5CPID 4JJNA 5AV5C 4Z5TD 4H9NA 4KHAA 5AVBC 5JA4B 1F66D 3MGPA 4WV4B 1P3PA 5B33B 3WA9D 4WU8B 2ZY3A 4R8PA 1P3KC 3B6GC 3VH5T 4X23C 4H9RA 5AVCA 3B0DB 3X1VC 4J8UA 1P3OB 3MNNC 3VH5A 1S32B 1KX4D 3B0BA 2F2AC 5BS7C 5B31B 3WKJB 1U35A 3RELA 2Y2QA 4J8XD 1BH8B 3KUYD 5CPKD 1JFIB 3W97C 3AZKB 3MGPD 3MGRC 3B6FA 1P3PD 4G91B 1TZYA 2FJ7C 3H0RC 4R8PD 4J8VB 5GSUB 2ZY4A 5AVCD 3X1SB 5DNNB 1KX3C 2HIOA 2XD5A 3X1UA 4QLCB 4WU8C 3LZ0D 3AV1D 1U35D 5GT0A 3AZND 1H3OA 4Z66C 5G49A 3KWQC 1P3OC 2IO5C 5CPIB 4EO5B 5AY8A 3AZJD 5B0ZD 3B6FD 3AYWD 2RIQA 1Z2CB 3MGSC 4YS3C 1F66B 5B32G 3WA9B 5GT3A 3C1BD 3A6ND 5B40C 3AZKC 3W96D 4LD9C 3AFAD 1M19C 4G91C 3MGQD 1M18A 5BT1D 4YM6C 1KX4B 5E5AC 2YFWA 5GT0D 1B67A 3AZLD 4ZUXD 3V9RA 3MVDA 1KX5A 3X1SC 4XUJD 3REHA 2G5HC 4J8XB 4H9NB 5AY8D 3KUYB 5CPKB 2NQBA 5B1LA 2L5AA 3MNNA 2JE5A 3MGPB 4KUDD 2LY8A 2Y2KA 5BS7A 5B24B 2Y2HA 4CSRA 1P3IA 3AZMC 5F99C 5AVCB 4J8WC 5AV8A 2Y2LA 3W97A 3WA9C 3MGRA 5BO0B 1P3GD 3MVDD 3A1KA 3LJAA 3LZ0B 3AV1B 3AZNB 3O62D 3REHD 3REJA 2BYKA 2NQBD 1P3MC 5B1LD 3LZ1A 3UTBA 3AZJB 5B0ZB 3AYWB 5BNVB 1P3BC 3AZED 3AZHC 1P3ID 4Z66A 3AZIC 3VH5W 3C1BB 5CPJD 3A6NB 3WTPC 3AN2C 3LELA 3W96B 3AFAB 1P3LD 5AV8D 2PYOA 5B24C 3MGQB 4G92B 5CP6A 3LJAD 3AV2C 3AZLB 4YS3A 4ZUXB 5B32C 4XZQD 4XUJB 3C1CD 3REKA 3AZFA 3LZ1D 3WAAD 2JSSA 1TAFA 3UTBD 4LD9A 1M19A 5AY8B 5DNMC 4KUDB 1M1AD 1P34A 3UTAC 4KGCD 5B2JA 4ZBJC 3X1TA 3TU4C 3LELD 2PYOD 3KXBC 3REIA 2Y2OA 4CAYA 5CP6D 2W8SA 4H9SC 2YFWB 1P3GB 1ID3D 1HTAA 1R4VA 3W96C 1P3AA 2YFVB 3O62B 5B1MB 3AZGD 3AZFD 1EQZA 3MGQC 3REKD 3NQJB 5F99A 2NQBB 5B1LB 4J8WA 3W99A 4WU9C 5JRGA 4H9OA 3UT9C 2F8NK 1P34D 5GXQD 2NZDA 5B2JD 5B0YD 3X1TD 3AZEB 4CSRB 2XD1A 3KSYA 5AV9C 2CV5A 1F1EA 3REID 5CPJB 1ZLAC 4KUDC 2AROB 2HUEC 5AV8B 1P3LB 2Y2IA 3VH6T 3LJAB 1P3AD 4JJND 1P3BA 1EQZD 1P3FC 3VH6A 3AZHA 3W98C 3AZIA 4XZQB 3C1CB 3AN2A 2RVQD 4DRBA 3W99D 3LZ1B 3WAAB 5JRGD 4E45A 4WNNB 5B1MC 3O62C 2NZDD 1T3UA 3AV2A 1HQ3B 1M1AB 4KGCB 5AV6A 4J8UD 4H9PA 5B33C 2PYOB 1AOIA 5CP6B 3RELD 4AWLB 3NQUB 3B0DC 1ID3B 1S32C 2AROC 1P3LC 3AZGB 4Z5TB 4WZSB 2Y2GA 3REKB 3TU4A 3AZFB 5B31C 3WKJC 5BNXB 3KXBA 1W2EA 1TZYD 3KFUG 5B2IA 4UUZA 4H9SA 1P34B 5GXQB 4XZQC 5B0YB 5AV6D 3EPJA 5AV5A 2HIOD 1AOID 3REIB 3X1UD 5AVBA 4J8VC 1HQ3C 1M1AC 5GSUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N A;  5DNN C;  2BYM A;  1P3A B;  4JJN B;  1P3K A;  1EQZ B;  3B6G A;  4QLC C;  4X23 A;  4KHA B;  3X1V A;  1N1J A;  1ZLA A;  1P3P B;  3W99 B;  5B2I D;  5FUG A;  1ID3 C;  5JRG B;  4H9O B;  5CPI C;  5GT3 D;  4Z5T C;  4R8P B;  4EO5 C;  4NFT A;  3WTP E;  5AV5 D;  1P3F A;  4H9R B;  1M18 D;  1F66 C;  3W98 A;  4J8U B;  5AVB D;  1KX5 D;  1U35 B;  3REL B;  2FJ7 A;  1BFM A;  1P3K D;  3B6G D;  1KX4 C;  5JA4 A;  4HGA B;  4X23 D;  3X1V D;  3MNN D;  1KX3 A;  3B6F B;  5B33 A;  1TZY B;  4WU8 A;  5C3I B;  4J8X C;  3R45 A;  3KUY C;  5CPK C;  3KWQ A;  1P3O A;  3MGP C;  1S32 A;  1P3P C;  3W97 D;  2HIO B;  3MGR D;  5B31 A;  3WKJ A;  3X1U B;  3B0C T;  4R8P C;  5GT0 B;  3MGS A;  1H3O B;  3VH6 W;  1WWI A;  5G49 B;  3REJ D;  5AVC C;  1BH8 A;  5B40 A;  3AZK A;  1KX3 D;  3LZ0 C;  3AV1 C;  1U35 C;  3REL C;  3AZN C;  1Q9C A;  4YM6 A;  4H9Q A;  5E5A A;  5B2I B;  5GSU A;  4Z66 D;  3X1S A;  5GT3 B;  3KWQ D;  5DNN A;  3B6F C;  3AZJ C;  5B0Z C;  3AYW C;  5AV5 B;  1M18 B;  4QLC A;  5AVB B;  3MGS D;  4YS3 D;  3V9R B;  4E44 A;  3MVD B;  3C1B C;  3A6N C;  1KX5 B;  3AFA C;  3REH B;  4G92 C;  5B40 D;  3AZK D;  5BT1 C;  1P3K B;  4LD9 D;  3AZM A;  1M19 D;  4X23 B;  5GT0 C;  3AZL C;  3X1V B;  4ZUX C;  4YM6 D;  3MNN B;  5E5A D;  5FUG B;  3WA9 A;  4XUJ C;  1P3I B;  5AY8 C;  1BH9 A;  1KX4 A;  1P3M A;  3W97 B;  3MGR B;  1M18 C;  3REJ B;  4J8X A;  2BYK B;  3KUY A;  3AZM D;  5CPK A;  5F99 D;  3WTP A;  4J8W D;  3UTB B;  1P3G C;  3MVD C;  1KX3 B;  5B24 A;  1KX5 C;  3REH C;  2CV5 D;  4Z66 B;  3R45 B;  5B32 A;  2NQB C;  5B1L C;  3KWQ B;  2IO5 B;  3LEL B;  1P3M D;  5BO0 A;  3LZ0 A;  3AV1 A;  3AZE C;  3AZN A;  5DNM A;  1P3I C;  3MGS B;  4YS3 B;  1P3B D;  1A7W A;  3AZH D;  5CPJ C;  3UTA A;  3AZI D;  5AV8 C;  4Z2M H;  3AN2 D;  5B40 B;  3WTP D;  4LD9 B;  1TAF B;  5B0Z A;  3AZJ A;  3AYW A;  1M19 B;  5B24 D;  3LJA C;  5BNV A;  4DRA A;  4YM6 B;  4H9Q B;  5E5A B;  3REJ C;  3AV2 D;  5B32 D;  5B2J B;  3C1C C;  3C1B A;  3A6N A;  3W96 A;  3WAA C;  3LZ1 C;  3AFA A;  3UTB C;  3X1T B;  3MGQ A;  4M6B A;  5KDM A;  2F8N H;  4CAY B;  3B0C W;  3AZL A;  5DNM D;  4KGC C;  4ZUX A;  4WU9 A;  3UT9 A;  3UTA D;  3LEL C;  4XUJ A;  2PYO C;  3TU4 D;  5AV9 A;  5CP6 C;  3KXB D;  3AZM B;  1KU5 A;  4AWL C;  5F99 B;  4KUD A;  4J8W B;  3AZG C;  2NZD B;  3AZF C;  3REK C;  2CV5 B;  4NE6 A;  1BH9 B;  1P3M B;  1P34 C;  5GXQ C;  4WU9 D;  5B2J C;  1P3G A;  4NE3 A;  5B0Y C;  3UT9 D;  2F8N D;  3X1T C;  2YFV A;  3O62 A;  5B1M A;  4NE5 A;  3NQJ A;  3REI C;  1P3B B;  5AV9 D;  3AZH B;  4Z2M G;  3AZI B;  3AN2 B;  3WTP B;  1ZLA D;  1P3A C;  4JJN C;  1EQZ C;  3AZE A;  3AV2 B;  5B32 B;  1P3F D;  5CPJ A;  5CHL B;  3W98 D;  2RVQ C;  5AV6 B;  2ARO A;  3W99 C;  1P3L A;  4H9P B;  5JRG C;  1B6W A;  1AOI B;  2F8N G;  2NZD C;  2FJ7 D;  5DNM B;  5B1M D;  2CV5 C;  4J8U C;  3UTA B;  4XZQ A;  1JFI A;  3C1C A;  4ZBJ B;  3WAA A;  3TU4 B;  5B33 D;  3KXB B;  2CWE A;  4WU8 D;  4J8V A;  1HQ3 A;  4UUZ B;  1M1A A;  4HGA C;  4KGC A;  1P3O D;  1S32 D;  2ARO D;  1TZY C;  5B31 D;  5KDM B;  5C3I C;  3WKJ D;  3NQU A;  4WU9 B;  1ID3 A;  3UT9 B;  2F8N B;  5AV6 C;  5CPI A;  2BYM B;  3AZG A;  4Z5T A;  2HIO C;  1AOI C;  5BNX A;  5AV9 B;  3X1U C;  3B6G B;  1ULY A;  1F66 A;  1N1J B;  1ZLA B;  4J8V D;  2HUE B;  1HQ3 D;  1WWS A;  5GSU D;  5GXQ A;  5B0Y A;  3X1S D;  5DNN D;  5B31 G;  1P3F B;  4QLC D;  3W98 B;  5B2I C;  4WNN A;  5GT3 C;  2FJ7 B;  5CPI D;  4JJN A;  5AV5 C;  4Z5T D;  4H9N A;  4KHA A;  5AVB C;  5JA4 B;  1F66 D;  3MGP A;  4WV4 B;  1P3P A;  5B33 B;  3WA9 D;  4WU8 B;  4R8P A;  1P3K C;  3B6G C;  3VH5 T;  4X23 C;  4H9R A;  5AVC A;  3B0D B;  3X1V C;  4J8U A;  1P3O B;  3MNN C;  3VH5 A;  1S32 B;  1KX4 D;  3B0B A;  5BS7 C;  5B31 B;  3WKJ B;  1U35 A;  3REL A;  4J8X D;  1BH8 B;  3KUY D;  5CPK D;  1JFI B;  3W97 C;  3AZK B;  3MGP D;  3MGR C;  3B6F A;  1P3P D;  4G91 B;  1TZY A;  2FJ7 C;  4R8P D;  4J8V B;  5GSU B;  3X1S B;  5AVC D;  5DNN B;  1KX3 C;  2HIO A;  3X1U A;  4QLC B;  4WU8 C;  3LZ0 D;  3AV1 D;  1U35 D;  5GT0 A;  3AZN D;  1H3O A;  4Z66 C;  5G49 A;  3KWQ C;  1P3O C;  2IO5 C;  5CPI B;  4EO5 B;  5AY8 A;  3AZJ D;  5B0Z D;  3B6F D;  3AYW D;  3MGS C;  1F66 B;  4YS3 C;  5B32 G;  3WA9 B;  5GT3 A;  3C1B D;  3A6N D;  5B40 C;  3AZK C;  3W96 D;  4LD9 C;  3AFA D;  1M19 C;  4G91 C;  3MGQ D;  1M18 A;  5BT1 D;  4YM6 C;  1KX4 B;  5E5A C;  2YFW A;  5GT0 D;  1B67 A;  3AZL D;  4ZUX D;  3V9R A;  3MVD A;  1KX5 A;  3X1S C;  4XUJ D;  3REH A;  4J8X B;  4H9N B;  5AY8 D;  3KUY B;  5CPK B;  2NQB A;  5B1L A;  2L5A A;  3MNN A;  3MGP B;  4KUD D;  2LY8 A;  5BS7 A;  5B24 B;  4CSR A;  1P3I A;  3AZM C;  5F99 C;  5AVC B;  4J8W C;  5AV8 A;  3W97 A;  3WA9 C;  3MGR A;  5BO0 B;  1P3G D;  3MVD D;  3LJA A;  3LZ0 B;  3AV1 B;  3AZN B;  3O62 D;  3REH D;  3REJ A;  2BYK A;  2NQB D;  1P3M C;  5B1L D;  3LZ1 A;  3UTB A;  3AZJ B;  5B0Z B;  3AYW B;  5BNV B;  1P3B C;  3AZE D;  3AZH C;  1P3I D;  4Z66 A;  3AZI C;  3VH5 W;  3C1B B;  5CPJ D;  3A6N B;  3WTP C;  3AN2 C;  3LEL A;  3W96 B;  3AFA B;  1P3L D;  5AV8 D;  2PYO A;  5B24 C;  3MGQ B;  4G92 B;  5CP6 A;  3LJA D;  3AV2 C;  3AZL B;  4YS3 A;  4ZUX B;  5B32 C;  4XZQ D;  4XUJ B;  3C1C D;  3REK A;  3AZF A;  3LZ1 D;  3WAA D;  2JSS A;  1TAF A;  3UTB D;  4LD9 A;  1M19 A;  5AY8 B;  5DNM C;  4KUD B;  1M1A D;  1P34 A;  3UTA C;  4KGC D;  5B2J A;  4ZBJ C;  3X1T A;  3TU4 C;  3LEL D;  2PYO D;  3KXB C;  3REI A;  5CP6 D;  4CAY A;  4H9S C;  2YFW B;  1P3G B;  1ID3 D;  1HTA A;  1R4V A;  3W96 C;  1P3A A;  2YFV B;  3O62 B;  5B1M B;  3AZG D;  3AZF D;  1EQZ A;  3MGQ C;  3REK D;  3NQJ B;  5F99 A;  2NQB B;  5B1L B;  4J8W A;  3W99 A;  4WU9 C;  5JRG A;  4H9O A;  3UT9 C;  2F8N K;  1P34 D;  5GXQ D;  2NZD A;  5B2J D;  5B0Y D;  3X1T D;  3AZE B;  4CSR B;  3KSY A;  5AV9 C;  2CV5 A;  1F1E A;  3REI D;  5CPJ B;  1ZLA C;  4KUD C;  2ARO B;  2HUE C;  5AV8 B;  1P3L B;  3VH6 T;  3LJA B;  1P3A D;  4JJN D;  1P3B A;  1EQZ D;  1P3F C;  3VH6 A;  3AZH A;  3W98 C;  3AZI A;  4XZQ B;  3C1C B;  3AN2 A;  2RVQ D;  4DRB A;  3W99 D;  3LZ1 B;  3WAA B;  5JRG D;  4E45 A;  4WNN B;  5B1M C;  3O62 C;  2NZD D;  3AV2 A;  1HQ3 B;  1M1A B;  4KGC B;  5AV6 A;  4J8U D;  4H9P A;  5B33 C;  2PYO B;  1AOI A;  5CP6 B;  3REL D;  4AWL B;  3NQU B;  3B0D C;  1ID3 B;  1S32 C;  2ARO C;  1P3L C;  3AZG B;  4Z5T B;  4WZS B;  3REK B;  3TU4 A;  3AZF B;  5B31 C;  3WKJ C;  5BNX B;  3KXB A;  1TZY D;  5B2I A;  4UUZ A;  4H9S A;  1P34 B;  5GXQ B;  4XZQ C;  5B0Y B;  5AV6 D;  5AV5 A;  2HIO D;  1AOI D;  3REI B;  3X1U D;  5AVB A;  4J8V C;  1HQ3 C;  1M1A C;  5GSU C; 
#chains in the Genus database with same CATH topology
 2UWX A;  5DNN C;  2F8N A;  3EPK A;  2BYM A;  1P3A B;  4JJN B;  1P3K A;  1EQZ B;  3B6G A;  4QLC C;  4X23 A;  4KHA B;  3X1V A;  1N1J A;  1ZLA A;  1P3P B;  3W99 B;  5B2I D;  5FUG A;  1ID3 C;  5JRG B;  4H9O B;  5CPI C;  5GT3 D;  4Z5T C;  4R8P B;  4EO5 C;  4NFT A;  3WTP E;  5AV5 D;  1P3F A;  4H9R B;  1M18 D;  1F66 C;  3H0M C;  3W98 A;  4J8U B;  5AVB D;  1KX5 D;  2ZY5 A;  1U35 B;  3REL B;  2FJ7 A;  3P5J B;  1BFM A;  1P3K D;  4WJ3 C;  3B6G D;  1KX4 C;  5JA4 A;  4HGA B;  4X23 D;  3X1V D;  3MNN D;  1KX3 A;  3B6F B;  5B33 A;  1TZY B;  4WU8 A;  5C3I B;  4J8X C;  3R45 A;  3KUY C;  5CPK C;  3KWQ A;  1P3O A;  3MGP C;  1S32 A;  1P3P C;  3W97 D;  2HIO B;  3MGR D;  5B31 A;  3WKJ A;  3X1U B;  3B0C T;  4R8P C;  5GT0 B;  3MGS A;  1H3O B;  3VH6 W;  1WWI A;  5G49 B;  3REJ D;  5AVC C;  1BH8 A;  2J8P A;  5B40 A;  3AZK A;  3H0L C;  1KX3 D;  3LZ0 C;  3AV1 C;  1U35 C;  3REL C;  4UPK A;  3AZN C;  1Q9C A;  4YM6 A;  4H9Q A;  5E5A A;  5B2I B;  5GSU A;  4Z66 D;  3X1S A;  5GT3 B;  3KWQ D;  5DNN A;  3B6F C;  3AZJ C;  5B0Z C;  3AYW C;  5AV5 B;  3IP4 C;  1M18 B;  4QLC A;  5AVB B;  3F6T A;  3MGS D;  4YS3 D;  3V9R B;  4E44 A;  3MVD B;  3C1B C;  3A6N C;  1KX5 B;  3AFA C;  2FFF B;  3REH B;  4G92 C;  5B40 D;  3AZK D;  5BT1 C;  1P3K B;  4LD9 D;  3AZM A;  1M19 D;  4X23 B;  5GT0 C;  3AZL C;  2G5I C;  4ZUX C;  4YM6 D;  3X1V B;  3MNN B;  5E5A D;  2DF4 C;  5FUG B;  3WA9 A;  4XUJ C;  1P3I B;  5AY8 C;  1BH9 A;  1KX4 A;  2Y2M A;  2Y2J A;  1P3M A;  3W97 B;  3MGR B;  2JCH A;  1M18 C;  2ZY2 A;  3REJ B;  4J8X A;  2BYK B;  3KUY A;  3AZM D;  5CPK A;  5F99 D;  3WTP A;  4J8W D;  3UTB B;  1P3G C;  3MVD C;  1KX3 B;  5B24 A;  1KX5 C;  3REH C;  2CV5 D;  4Z66 B;  3R45 B;  5B32 A;  2NQB C;  5B1L C;  4DQY B;  3KWQ B;  2IO5 B;  3LEL B;  1P3M D;  5BO0 A;  3LZ0 A;  3AV1 A;  3AZE C;  3AZN A;  5DNM A;  1P3I C;  3MGS B;  2VQR A;  4YS3 B;  1P3B D;  1A7W A;  3AZH D;  5CPJ C;  3UTA A;  3AZI D;  5AV8 C;  4Z2M H;  3AN2 D;  5B40 B;  3WTP D;  4LD9 B;  1TAF B;  5B0Z A;  3AZJ A;  3AYW A;  1M19 B;  5B24 D;  3LJA C;  5BNV A;  4DRA A;  4YM6 B;  4H9Q B;  5E5A B;  3REJ C;  3AV2 D;  5B32 D;  5B2J B;  3C1C C;  3C1B A;  3A6N A;  3W96 A;  3WAA C;  3LZ1 C;  3AFA A;  3UTB C;  3X1T B;  3MGQ A;  4M6B A;  5KDM A;  2F8N H;  4CAY B;  3B0C W;  3A1I A;  3AZL A;  5DNM D;  4KGC C;  4ZUX A;  4WU9 A;  3UT9 A;  3EG5 B;  3UTA D;  3LEL C;  4XUJ A;  2PYO C;  3TU4 D;  5AV9 A;  5CP6 C;  3KXB D;  3AZM B;  1KU5 A;  4AWL C;  5F99 B;  4KUD A;  4J8W B;  3AZG C;  2NZD B;  3AZF C;  3REK C;  2DQN C;  2CV5 B;  4NE6 A;  1BH9 B;  2Y2P A;  1P3M B;  1P34 C;  5GXQ C;  4WU9 D;  5B2J C;  1P3G A;  4NE3 A;  5B0Y C;  3UT9 D;  2F8N D;  3X1T C;  2YFV A;  3O62 A;  5B1M A;  2ZM5 A;  4NE5 A;  3NQJ A;  3REI C;  1P3B B;  5AV9 D;  3AZH B;  2BG1 A;  4Z2M G;  3AZI B;  3AL0 C;  3AN2 B;  3WTP B;  1ZLA D;  1P3A C;  4JJN C;  1EQZ C;  3AZE A;  3AV2 B;  5B32 B;  1P3F D;  5CPJ A;  5CHL B;  3W98 D;  2RVQ C;  5AV6 B;  2ARO A;  3W99 C;  1P3L A;  4H9P B;  5JRG C;  1B6W A;  1AOI B;  2F8N G;  3EPH A;  2NZD C;  1PZR A;  3EPL A;  2FJ7 D;  5DNM B;  5B1M D;  2CV5 C;  4J8U C;  3UTA B;  4XZQ A;  1JFI A;  3C1C A;  4ZBJ B;  3WAA A;  3TU4 B;  5B33 D;  3KXB B;  2CWE A;  4WU8 D;  4J8V A;  3FDD A;  1HQ3 A;  4UUZ B;  1M1A A;  4HGA C;  4KGC A;  1P3O D;  1S32 D;  2ARO D;  2Y2N A;  1TZY C;  5B31 D;  5KDM B;  5C3I C;  3WKJ D;  3NQU A;  4WU9 B;  1ID3 A;  3UT9 B;  2F8N B;  5AV6 C;  5CPI A;  2BYM B;  3AZG A;  4Z5T A;  2HIO C;  1AOI C;  5BNX A;  5AV9 B;  3X1U C;  3B6G B;  1ULY A;  1F66 A;  1N1J B;  1ZLA B;  4J8V D;  2HUE B;  1HQ3 D;  1WWS A;  5GSU D;  5GXQ A;  5B0Y A;  3X1S D;  5DNN D;  5B31 G;  1P3F B;  4QLC D;  3W98 B;  5B2I C;  4WNN A;  5GT3 C;  2FJ7 B;  5CPI D;  4JJN A;  5AV5 C;  4Z5T D;  4H9N A;  4KHA A;  5AVB C;  5JA4 B;  1F66 D;  3MGP A;  4WV4 B;  1P3P A;  5B33 B;  3WA9 D;  4WU8 B;  2ZY3 A;  4R8P A;  1P3K C;  3B6G C;  3VH5 T;  4X23 C;  4H9R A;  5AVC A;  3B0D B;  3X1V C;  4J8U A;  1P3O B;  3MNN C;  3VH5 A;  1S32 B;  1KX4 D;  3B0B A;  2F2A C;  5BS7 C;  5B31 B;  3WKJ B;  1U35 A;  3REL A;  2Y2Q A;  4J8X D;  1BH8 B;  3KUY D;  5CPK D;  1JFI B;  3W97 C;  3AZK B;  3MGP D;  3MGR C;  3B6F A;  1P3P D;  4G91 B;  1TZY A;  2FJ7 C;  3H0R C;  4R8P D;  4J8V B;  5GSU B;  2ZY4 A;  5AVC D;  3X1S B;  5DNN B;  1KX3 C;  2HIO A;  2XD5 A;  3X1U A;  4QLC B;  4WU8 C;  3LZ0 D;  3AV1 D;  1U35 D;  5GT0 A;  3AZN D;  1H3O A;  4Z66 C;  5G49 A;  3KWQ C;  1P3O C;  2IO5 C;  5CPI B;  4EO5 B;  5AY8 A;  3AZJ D;  5B0Z D;  3B6F D;  3AYW D;  2RIQ A;  1Z2C B;  3MGS C;  4YS3 C;  1F66 B;  5B32 G;  3WA9 B;  5GT3 A;  3C1B D;  3A6N D;  5B40 C;  3AZK C;  3W96 D;  4LD9 C;  3AFA D;  1M19 C;  4G91 C;  3MGQ D;  1M18 A;  5BT1 D;  4YM6 C;  1KX4 B;  5E5A C;  2YFW A;  5GT0 D;  1B67 A;  3AZL D;  4ZUX D;  3V9R A;  3MVD A;  1KX5 A;  3X1S C;  4XUJ D;  3REH A;  2G5H C;  4J8X B;  4H9N B;  5AY8 D;  3KUY B;  5CPK B;  2NQB A;  5B1L A;  2L5A A;  3MNN A;  2JE5 A;  3MGP B;  4KUD D;  2LY8 A;  2Y2K A;  5BS7 A;  5B24 B;  2Y2H A;  4CSR A;  1P3I A;  3AZM C;  5F99 C;  5AVC B;  4J8W C;  5AV8 A;  2Y2L A;  3W97 A;  3WA9 C;  3MGR A;  5BO0 B;  1P3G D;  3MVD D;  3A1K A;  3LJA A;  3LZ0 B;  3AV1 B;  3AZN B;  3O62 D;  3REH D;  3REJ A;  2BYK A;  2NQB D;  1P3M C;  5B1L D;  3LZ1 A;  3UTB A;  3AZJ B;  5B0Z B;  3AYW B;  5BNV B;  1P3B C;  3AZE D;  3AZH C;  1P3I D;  4Z66 A;  3AZI C;  3VH5 W;  3C1B B;  5CPJ D;  3A6N B;  3WTP C;  3AN2 C;  3LEL A;  3W96 B;  3AFA B;  1P3L D;  5AV8 D;  2PYO A;  5B24 C;  3MGQ B;  4G92 B;  5CP6 A;  3LJA D;  3AV2 C;  3AZL B;  4YS3 A;  4ZUX B;  5B32 C;  4XZQ D;  4XUJ B;  3C1C D;  3REK A;  3AZF A;  3LZ1 D;  3WAA D;  2JSS A;  1TAF A;  3UTB D;  4LD9 A;  1M19 A;  5AY8 B;  5DNM C;  4KUD B;  1M1A D;  1P34 A;  3UTA C;  4KGC D;  5B2J A;  4ZBJ C;  3X1T A;  3TU4 C;  3LEL D;  2PYO D;  3KXB C;  3REI A;  2Y2O A;  4CAY A;  5CP6 D;  2W8S A;  4H9S C;  2YFW B;  1P3G B;  1ID3 D;  1HTA A;  1R4V A;  3W96 C;  1P3A A;  2YFV B;  3O62 B;  5B1M B;  3AZG D;  3AZF D;  1EQZ A;  3MGQ C;  3REK D;  3NQJ B;  5F99 A;  2NQB B;  5B1L B;  4J8W A;  3W99 A;  4WU9 C;  5JRG A;  4H9O A;  3UT9 C;  2F8N K;  1P34 D;  5GXQ D;  2NZD A;  5B2J D;  5B0Y D;  3X1T D;  3AZE B;  4CSR B;  2XD1 A;  3KSY A;  5AV9 C;  2CV5 A;  1F1E A;  3REI D;  5CPJ B;  1ZLA C;  4KUD C;  2ARO B;  2HUE C;  5AV8 B;  1P3L B;  2Y2I A;  3VH6 T;  3LJA B;  1P3A D;  4JJN D;  1P3B A;  1EQZ D;  1P3F C;  3VH6 A;  3AZH A;  3W98 C;  3AZI A;  4XZQ B;  3C1C B;  3AN2 A;  2RVQ D;  4DRB A;  3W99 D;  3LZ1 B;  3WAA B;  5JRG D;  4E45 A;  4WNN B;  5B1M C;  3O62 C;  2NZD D;  1T3U A;  3AV2 A;  1HQ3 B;  1M1A B;  4KGC B;  5AV6 A;  4J8U D;  4H9P A;  5B33 C;  2PYO B;  1AOI A;  5CP6 B;  3REL D;  4AWL B;  3NQU B;  3B0D C;  1ID3 B;  1S32 C;  2ARO C;  1P3L C;  3AZG B;  4Z5T B;  4WZS B;  2Y2G A;  3REK B;  3TU4 A;  3AZF B;  5B31 C;  3WKJ C;  5BNX B;  3KXB A;  1W2E A;  1TZY D;  3KFU G;  5B2I A;  4UUZ A;  4H9S A;  1P34 B;  5GXQ B;  4XZQ C;  5B0Y B;  5AV6 D;  3EPJ A;  5AV5 A;  2HIO D;  1AOI D;  3REI B;  3X1U D;  5AVB A;  4J8V C;  1HQ3 C;  1M1A C;  5GSU C; 
#chains in the Genus database with same CATH homology
 2UWX A;  5DNN C;  2F8N A;  3EPK A;  2BYM A;  1P3A B;  4JJN B;  1P3K A;  1EQZ B;  3B6G A;  4QLC C;  4X23 A;  4KHA B;  3X1V A;  1N1J A;  1ZLA A;  1P3P B;  3W99 B;  5B2I D;  5FUG A;  1ID3 C;  5JRG B;  4H9O B;  5CPI C;  5GT3 D;  4Z5T C;  4R8P B;  4EO5 C;  4NFT A;  3WTP E;  5AV5 D;  1P3F A;  4H9R B;  1M18 D;  1F66 C;  3H0M C;  3W98 A;  4J8U B;  5AVB D;  1KX5 D;  2ZY5 A;  1U35 B;  3REL B;  2FJ7 A;  3P5J B;  1BFM A;  1P3K D;  4WJ3 C;  3B6G D;  1KX4 C;  5JA4 A;  4HGA B;  4X23 D;  3X1V D;  3MNN D;  1KX3 A;  3B6F B;  5B33 A;  1TZY B;  4WU8 A;  5C3I B;  4J8X C;  3R45 A;  3KUY C;  5CPK C;  3KWQ A;  1P3O A;  3MGP C;  1S32 A;  1P3P C;  3W97 D;  2HIO B;  3MGR D;  5B31 A;  3WKJ A;  3X1U B;  3B0C T;  4R8P C;  5GT0 B;  3MGS A;  1H3O B;  3VH6 W;  1WWI A;  5G49 B;  3REJ D;  5AVC C;  1BH8 A;  2J8P A;  5B40 A;  3AZK A;  3H0L C;  1KX3 D;  3LZ0 C;  3AV1 C;  1U35 C;  3REL C;  4UPK A;  3AZN C;  1Q9C A;  4YM6 A;  4H9Q A;  5E5A A;  5B2I B;  5GSU A;  4Z66 D;  3X1S A;  5GT3 B;  3KWQ D;  5DNN A;  3B6F C;  3AZJ C;  5B0Z C;  3AYW C;  5AV5 B;  3IP4 C;  1M18 B;  4QLC A;  5AVB B;  3F6T A;  3MGS D;  4YS3 D;  3V9R B;  4E44 A;  3MVD B;  3C1B C;  3A6N C;  1KX5 B;  3AFA C;  2FFF B;  3REH B;  4G92 C;  5B40 D;  3AZK D;  5BT1 C;  1P3K B;  4LD9 D;  3AZM A;  1M19 D;  4X23 B;  5GT0 C;  3AZL C;  2G5I C;  4ZUX C;  4YM6 D;  3X1V B;  3MNN B;  5E5A D;  2DF4 C;  5FUG B;  3WA9 A;  4XUJ C;  1P3I B;  5AY8 C;  1BH9 A;  1KX4 A;  2Y2M A;  2Y2J A;  1P3M A;  3W97 B;  3MGR B;  2JCH A;  1M18 C;  2ZY2 A;  3REJ B;  4J8X A;  2BYK B;  3KUY A;  3AZM D;  5CPK A;  5F99 D;  3WTP A;  4J8W D;  3UTB B;  1P3G C;  3MVD C;  1KX3 B;  5B24 A;  1KX5 C;  3REH C;  2CV5 D;  4Z66 B;  3R45 B;  5B32 A;  2NQB C;  5B1L C;  4DQY B;  3KWQ B;  2IO5 B;  3LEL B;  1P3M D;  5BO0 A;  3LZ0 A;  3AV1 A;  3AZE C;  3AZN A;  5DNM A;  1P3I C;  3MGS B;  2VQR A;  4YS3 B;  1P3B D;  1A7W A;  3AZH D;  5CPJ C;  3UTA A;  3AZI D;  5AV8 C;  4Z2M H;  3AN2 D;  5B40 B;  3WTP D;  4LD9 B;  1TAF B;  5B0Z A;  3AZJ A;  3AYW A;  1M19 B;  5B24 D;  3LJA C;  5BNV A;  4DRA A;  4YM6 B;  4H9Q B;  5E5A B;  3REJ C;  3AV2 D;  5B32 D;  5B2J B;  3C1C C;  3C1B A;  3A6N A;  3W96 A;  3WAA C;  3LZ1 C;  3AFA A;  3UTB C;  3X1T B;  3MGQ A;  4M6B A;  5KDM A;  2F8N H;  4CAY B;  3B0C W;  3A1I A;  3AZL A;  5DNM D;  4KGC C;  4ZUX A;  4WU9 A;  3UT9 A;  3EG5 B;  3UTA D;  3LEL C;  4XUJ A;  2PYO C;  3TU4 D;  5AV9 A;  5CP6 C;  3KXB D;  3AZM B;  1KU5 A;  4AWL C;  5F99 B;  4KUD A;  4J8W B;  3AZG C;  2NZD B;  3AZF C;  3REK C;  2DQN C;  2CV5 B;  4NE6 A;  1BH9 B;  2Y2P A;  1P3M B;  1P34 C;  5GXQ C;  4WU9 D;  5B2J C;  1P3G A;  4NE3 A;  5B0Y C;  3UT9 D;  2F8N D;  3X1T C;  2YFV A;  3O62 A;  5B1M A;  2ZM5 A;  4NE5 A;  3NQJ A;  3REI C;  1P3B B;  5AV9 D;  3AZH B;  2BG1 A;  4Z2M G;  3AZI B;  3AL0 C;  3AN2 B;  3WTP B;  1ZLA D;  1P3A C;  4JJN C;  1EQZ C;  3AZE A;  3AV2 B;  5B32 B;  1P3F D;  5CPJ A;  5CHL B;  3W98 D;  2RVQ C;  5AV6 B;  2ARO A;  3W99 C;  1P3L A;  4H9P B;  5JRG C;  1B6W A;  1AOI B;  2F8N G;  3EPH A;  2NZD C;  1PZR A;  3EPL A;  2FJ7 D;  5DNM B;  5B1M D;  2CV5 C;  4J8U C;  3UTA B;  4XZQ A;  1JFI A;  3C1C A;  4ZBJ B;  3WAA A;  3TU4 B;  5B33 D;  3KXB B;  2CWE A;  4WU8 D;  4J8V A;  3FDD A;  1HQ3 A;  4UUZ B;  1M1A A;  4HGA C;  4KGC A;  1P3O D;  1S32 D;  2ARO D;  2Y2N A;  1TZY C;  5B31 D;  5KDM B;  5C3I C;  3WKJ D;  3NQU A;  4WU9 B;  1ID3 A;  3UT9 B;  2F8N B;  5AV6 C;  5CPI A;  2BYM B;  3AZG A;  4Z5T A;  2HIO C;  1AOI C;  5BNX A;  5AV9 B;  3X1U C;  3B6G B;  1ULY A;  1F66 A;  1N1J B;  1ZLA B;  4J8V D;  2HUE B;  1HQ3 D;  1WWS A;  5GSU D;  5GXQ A;  5B0Y A;  3X1S D;  5DNN D;  5B31 G;  1P3F B;  4QLC D;  3W98 B;  5B2I C;  4WNN A;  5GT3 C;  2FJ7 B;  5CPI D;  4JJN A;  5AV5 C;  4Z5T D;  4H9N A;  4KHA A;  5AVB C;  5JA4 B;  1F66 D;  3MGP A;  4WV4 B;  1P3P A;  5B33 B;  3WA9 D;  4WU8 B;  2ZY3 A;  4R8P A;  1P3K C;  3B6G C;  3VH5 T;  4X23 C;  4H9R A;  5AVC A;  3B0D B;  3X1V C;  4J8U A;  1P3O B;  3MNN C;  3VH5 A;  1S32 B;  1KX4 D;  3B0B A;  2F2A C;  5BS7 C;  5B31 B;  3WKJ B;  1U35 A;  3REL A;  2Y2Q A;  4J8X D;  1BH8 B;  3KUY D;  5CPK D;  1JFI B;  3W97 C;  3AZK B;  3MGP D;  3MGR C;  3B6F A;  1P3P D;  4G91 B;  1TZY A;  2FJ7 C;  3H0R C;  4R8P D;  4J8V B;  5GSU B;  2ZY4 A;  5AVC D;  3X1S B;  5DNN B;  1KX3 C;  2HIO A;  2XD5 A;  3X1U A;  4QLC B;  4WU8 C;  3LZ0 D;  3AV1 D;  1U35 D;  5GT0 A;  3AZN D;  1H3O A;  4Z66 C;  5G49 A;  3KWQ C;  1P3O C;  2IO5 C;  5CPI B;  4EO5 B;  5AY8 A;  3AZJ D;  5B0Z D;  3B6F D;  3AYW D;  2RIQ A;  1Z2C B;  3MGS C;  4YS3 C;  1F66 B;  5B32 G;  3WA9 B;  5GT3 A;  3C1B D;  3A6N D;  5B40 C;  3AZK C;  3W96 D;  4LD9 C;  3AFA D;  1M19 C;  4G91 C;  3MGQ D;  1M18 A;  5BT1 D;  4YM6 C;  1KX4 B;  5E5A C;  2YFW A;  5GT0 D;  1B67 A;  3AZL D;  4ZUX D;  3V9R A;  3MVD A;  1KX5 A;  3X1S C;  4XUJ D;  3REH A;  2G5H C;  4J8X B;  4H9N B;  5AY8 D;  3KUY B;  5CPK B;  2NQB A;  5B1L A;  2L5A A;  3MNN A;  2JE5 A;  3MGP B;  4KUD D;  2LY8 A;  2Y2K A;  5BS7 A;  5B24 B;  2Y2H A;  4CSR A;  1P3I A;  3AZM C;  5F99 C;  5AVC B;  4J8W C;  5AV8 A;  2Y2L A;  3W97 A;  3WA9 C;  3MGR A;  5BO0 B;  1P3G D;  3MVD D;  3A1K A;  3LJA A;  3LZ0 B;  3AV1 B;  3AZN B;  3O62 D;  3REH D;  3REJ A;  2BYK A;  2NQB D;  1P3M C;  5B1L D;  3LZ1 A;  3UTB A;  3AZJ B;  5B0Z B;  3AYW B;  5BNV B;  1P3B C;  3AZE D;  3AZH C;  1P3I D;  4Z66 A;  3AZI C;  3VH5 W;  3C1B B;  5CPJ D;  3A6N B;  3WTP C;  3AN2 C;  3LEL A;  3W96 B;  3AFA B;  1P3L D;  5AV8 D;  2PYO A;  5B24 C;  3MGQ B;  4G92 B;  5CP6 A;  3LJA D;  3AV2 C;  3AZL B;  4YS3 A;  4ZUX B;  5B32 C;  4XZQ D;  4XUJ B;  3C1C D;  3REK A;  3AZF A;  3LZ1 D;  3WAA D;  2JSS A;  1TAF A;  3UTB D;  4LD9 A;  1M19 A;  5AY8 B;  5DNM C;  4KUD B;  1M1A D;  1P34 A;  3UTA C;  4KGC D;  5B2J A;  4ZBJ C;  3X1T A;  3TU4 C;  3LEL D;  2PYO D;  3KXB C;  3REI A;  2Y2O A;  4CAY A;  5CP6 D;  2W8S A;  4H9S C;  2YFW B;  1P3G B;  1ID3 D;  1HTA A;  1R4V A;  3W96 C;  1P3A A;  2YFV B;  3O62 B;  5B1M B;  3AZG D;  3AZF D;  1EQZ A;  3MGQ C;  3REK D;  3NQJ B;  5F99 A;  2NQB B;  5B1L B;  4J8W A;  3W99 A;  4WU9 C;  5JRG A;  4H9O A;  3UT9 C;  2F8N K;  1P34 D;  5GXQ D;  2NZD A;  5B2J D;  5B0Y D;  3X1T D;  3AZE B;  4CSR B;  2XD1 A;  3KSY A;  5AV9 C;  2CV5 A;  1F1E A;  3REI D;  5CPJ B;  1ZLA C;  4KUD C;  2ARO B;  2HUE C;  5AV8 B;  1P3L B;  2Y2I A;  3VH6 T;  3LJA B;  1P3A D;  4JJN D;  1P3B A;  1EQZ D;  1P3F C;  3VH6 A;  3AZH A;  3W98 C;  3AZI A;  4XZQ B;  3C1C B;  3AN2 A;  2RVQ D;  4DRB A;  3W99 D;  3LZ1 B;  3WAA B;  5JRG D;  4E45 A;  4WNN B;  5B1M C;  3O62 C;  2NZD D;  1T3U A;  3AV2 A;  1HQ3 B;  1M1A B;  4KGC B;  5AV6 A;  4J8U D;  4H9P A;  5B33 C;  2PYO B;  1AOI A;  5CP6 B;  3REL D;  4AWL B;  3NQU B;  3B0D C;  1ID3 B;  1S32 C;  2ARO C;  1P3L C;  3AZG B;  4Z5T B;  4WZS B;  2Y2G A;  3REK B;  3TU4 A;  3AZF B;  5B31 C;  3WKJ C;  5BNX B;  3KXB A;  1W2E A;  1TZY D;  3KFU G;  5B2I A;  4UUZ A;  4H9S A;  1P34 B;  5GXQ B;  4XZQ C;  5B0Y B;  5AV6 D;  3EPJ A;  5AV5 A;  2HIO D;  1AOI D;  3REI B;  3X1U D;  5AVB A;  4J8V C;  1HQ3 C;  1M1A C;  5GSU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...