4J8UB

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uB00
3MGRB 5AV5A 3UTBB 3WA9B 3REKB 1P3KB 3AZID 3AZMC 4WU8B 2LY8A 2IO5C 5CP6B 3UTAA 1P3GD 1P3FA 3REIC 2YFVB 4J8VA 5AV9B 5B0YB 1M1AD 1P3LC 1P3PD 3WKJD 5F99A 3KXBD 3AFAA 3UT9B 4KUDD 3MGPA 1KU5A 3AZNC 1P34D 1KX4A 5B1LC 4R8PB 3MGRD 2NQBB 3B0CT 2FJ7C 3A6ND 3WA9D 3REKD 3MNNC 4CSRB 3WTPA 3W98A 5GT0A 3AZJA 4G92C 3C1CC 3NQJB 5CP6D 3C1BA 2NZDC 2F8NK 1P3MC 5CPIC 5GT3B 3X1UA 5AV9D 5B0YD 3VH6W 3WAAA 3AN2C 4XUJB 1H3OA 3REHB 1ZLAA 5B2JC 3AZHA 1HQ3C 3X1VB 4Z66A 4HGAC 3AZKA 3LELB 5AV5C 4R8PD 1P3OB 1JFIB 3KUYA 3AZFD 1TAFA 3W96A 5JA4B 5B31B 3RELA 4NE6A 1S32A 3UTAC 1AOIB 2BYKB 3O62B 5B1MA 4YM6C 4J8VC 3LZ0D 5BT1C 5GT3D 4ZUXA 2AROD 4XZQD 2BYMB 4J8XA 5AVBB 5F99C 3LZ1A 4J8UA 4QLCD 1P3BB 3X1VD 5B33C 1KX4C 5B24A 3B6FB 5B2IB 1P3OD 4X23B 4H9PB 5B0ZB 5DNNA 2YFWB 4WU9A 3W98C 3WTPC 5GT0C 5B31D 3AYWB 1F66B 3X1TD 3C1BC 3O62D 3MGQA 3X1SA 3KWQC 4JJNA 1P3ID 3X1UC 3V9RA 3WAAC 3VH6A 1ID3B 2PYOC 3B0CW 5B32B 5AVBD 1ZLAC 4J8WD 2F8NG 4Z5TB 5E5AA 3LJAB 2NQBC 2CV5B 3AZKC 4YS3B 1M19C 5B2ID 3B6FD 5B0ZD 1M18D 5JRGC 3REIA 4ZBJC 3W96C 3RELC 5AV8B 4LD9B 1P3LA 3AV1B 5C3IB 2HIOB 1BH9B 3W97B 1KX5C 5B1MC 3AZGB 4E45A 4XUJC 4ZUXC 4KHAA 3AZNA 1P3AD 5AVCA 4J8XC 1TZYB 3LZ1C 4J8UC 5GSUA 3W99A 3MGSA 3AV2A 3B0DB 3MNNA 3LJAD 4NE5A 4CAYA 3R45A 4YS3D 3MVDB 1KX3D 5DNNC 4WU9C 1P3MA 3AZLD 5CPIA 5BO0B 5AV8D 1M1AB 1P3PB 5B40B 4LD9D 5AV6B 3AZLA 3KXBB 3X1SC 3TU4A 4JJNC 5B2JA 5FUGA 5AY8B 3AZGD 4Z2MH 4H9OA 1TZYD 4H9NA 3A6NB 2FJ7D 4E44A 5E5AC 4X23C 1P3GA 1F1EA 3AZEA 5DNMA 3C1CD 3MVDD 5CPJB 4KGCA 3AYWC 2RVQC 4YM6A 5G49A 3WKJA 2NZDD 5GXQC 5B40D 4H9QA 4UUZB 5AV6D 3AN2D 3AFAB 4AWLB 4G91C 5B32C 5AY8D 3MGRA 3UTBA 3MGPB 5B33A 5AVCC 1P3KA 5AV5D 5GSUC 3AZFB 3W99C 4WU8A 3MGSC 3AV2C 5BS7A 2L5AA 3AZJB 3REJB 2YFVA 5CPJD 5AV9A 4Z2MG 5B0YA 3KWQA 1P3FD 5BNVB 3LZ0B 3AV1C 4J8VD 2AROB 4XZQB 2HIOC 2PYOA 3UT9A 3AZLC 3TU4C 4QLCB 5F99D 3AFAD 3AZHB 2NQBA 3MGPD 4Z66B 2HUEC 1M19A 1KX4D 4CSRA 3AZIC 3B0BA 5JRGA 3KUYB 3NQJA 3W98D 3WTPD 1N1JB 4WNNB 1P3GC 3AZJD 3REJD 3AZEC 5DNMC 1P3AC 4WV4B 3X1TB 1S32B 5GT3A 2JSSA 1EQZB 4KGCC 1KX5A 3C1BD 3WKJC 1U35B 1P3IB 4XUJA 3REHA 2F8NB 3X1UD 4KUDC 3WAAD 1HTAA 4J8WB 1P34C 3LELA 3MGRC 1P3OA 3AZHD 3UTBC 3WA9C 1JFIA 3REKC 4Z66D 1P3KC 5B24B 3AZKD 1M18B 5B31A 4WU8C 3NQUB 5BS7C 3KUYD 5CP6C 3B6GB 4M6BA 1AOIA 2BYKA 3VH5T 3W96D 1S32D 1EQZD 5AV9C 5B0YC 3MGQB 2BYMA 5CPKB 5B1MD 1U35D 2F8ND 4EO5B 1P3AB 4ZUXD 3V9RB 3UT9C 1P3BA 1R4VA 4J8UD 4R8PC 3B6FA 4X23A 5B0ZA 3AZMB 2YFWA 1KX3B 5B24D 2IO5B 1Q9CA 3AYWA 3REIB 4WU9D 1F66A 5GXQA 3B6GD 4H9SC 3KSYA 1P3LB 5GT3C 3MGQD 5CPKD 4JJND 1ID3A 5B32A 3REHC 5B1LB 3X1VC 4Z5TA 2FJ7B 2CV5A 3LELC 1P3OC 3MNNB 5E5AD 3AZMD 4CAYB 4G92B 3R45B 3C1CB 1BH8A 5B31C 3REID 2NZDB 1WWIA 3AV1A 1P3MB 1AOIC 4H9RB 2HIOA 1BH9A 1WWSA 3W97A 3O62C 5CPIB 1P3LD 3AZGA 3AN2B 5B2JB 5AVBC 5FUGB 3VH6T 1HQ3B 4H9OB 4HGAB 3AZND 1P3BC 5B1LD 5AV5B 3AZIA 5GSUD 5B32G 3W99D 5B2IC 3MGSD 3AV2D 3B6FC 3MNND 5BNXA 3VH5W 5B0ZC 3UTAB 1P3FB 5BO0A 4DRBA 1P3PA 1M1AA 1F66C 4YM6B 4J8VB 1P3MD 5CPID 3KXBA 5KDMA 4KUDA 4H9QB 5F99B 1P34A 3TU4D 1ID3C 5B2JD 3A6NA 3WA9A 1HQ3D 5CHLB 3REKA 5B33B 4NFTA 1KX4B 4Z5TC 3LJAC 2CV5C 4YS3C 5CP6A 1KX3C 3W98B 3WTPB 5GT0B 1BFMA 5CPJA 3AZED 5DNMD 3UTAD 5AV8C 3C1BB 4LD9C 4KGCD 4UUZA 3KWQB 4YM6D 5C3IC 3W97C 5BT1D 3X1UB 3WAAB 2PYOB 3AZGC 1H3OB 1A7WA 1ZLAB 1B67A 4R8PA 1TZYC 3AZFA 3UTBD 5B33D 3B0DC 3AZKB 1M19B 1P3KD 5JRGB 3REJA 4WU8D 1TAFB 3MVDC 4ZBJB 4H9SA 3W96B 3VH5A 5GT0D 3RELB 5BNVA 3LZ0A 2AROA 4XZQA 1M1AC 1P3PC 5B40C 1KX5B 5B1MB 3KWQD 5AV6C 3KXBC 4ZUXB 4QLCA 4J8XB 3X1VA 5AY8C 2PYOD 3UT9D 3LZ1B 4J8UB 1ZLAD 3A6NC 2NQBD 5JA4A 1M19D 1N1JA 4WNNA 5DNNB 5JRGD 4WU9B 2F8NH 3X1TA 3RELD 3O62A 5CPJC 1EQZA 1P3FC 1U35A 1P3IA 2F8NA 3X1SB 1KX5D 4JJNB 5AVBA 4XUJD 4J8WA 4WZSB 3REHD 3AFAC 4AWLC 4J8XD 3MGPC 3LZ1D 5B2IA 4H9PA 5E5AB 3LELD 1M18A 3AZFC 3NQUA 3B6GA 3AZJC 5DNND 3REJC 1ULYA 5GXQB 1AOID 5B31G 4DRAA 3LZ0C 5CPKA 2AROC 4XZQC 1P3AA 3X1SD 4G91B 4QLCC 4KHAB 3AZNB 5AVCB 3AZHC 3LJAA 1P3BD 3AZMA 5GSUB 4YS3A 4Z66C 3W99B 3MGSB 3AV2B 1KX3A 4X23D 3KUYC 1BH8B 5AV8A 4LD9A 3AYWD 2RVQD 3X1TC 1S32C 1EQZC 5GXQD 1F66D 1U35C 1P3IC 3AZLB 2CWEA 3TU4B 1TZYA 5B1LA 1ID3D 5B32D 4J8WC 2FJ7A 5AVCD 2HUEB 4H9NB 4Z5TD 3AZIB 2CV5D 3C1CA 5B24C 3MVDA 1M18C 1B6WA 5BNXB 1P3GB 2NZDA 3AZEB 3WTPE 5DNMB 4NE3A 3B6GC 4H9RA 5B40A 4KGCB 3WKJB 5G49B 5AV6A 3AV1D 3AN2A 2HIOD 3MGQC 3W97D 5CPKC 5KDMB 5AY8A 4KUDB 1HQ3A 4EO5C 1P34B
chains in the Genus database with same CATH superfamily
3MGRB 5AV5A 3UTBB 3WA9B 3REKB 1P3KB 3AZID 3AZMC 4WU8B 2LY8A 2IO5C 5CP6B 3UTAA 1P3GD 1P3FA 3REIC 2JE5A 2YFVB 4J8VA 3A1IA 5AV9B 2Y2GA 5B0YB 1M1AD 1P3LC 1P3PD 3WKJD 5F99A 3KXBD 3AFAA 3UT9B 4KUDD 3MGPA 1KU5A 3AZNC 1P34D 1KX4A 5B1LC 2XD5A 4R8PB 3MGRD 2NQBB 3B0CT 3EPKA 3A6ND 2FJ7C 3WA9D 3FDDA 3REKD 3MNNC 4CSRB 3WTPA 3W98A 5GT0A 3P5JB 3AZJA 4G92C 3C1CC 3NQJB 5CP6D 3C1BA 2NZDC 2F8NK 1P3MC 2Y2KA 5CPIC 5GT3B 3X1UA 5AV9D 2Y2LA 5B0YD 3VH6W 3WAAA 2Y2OA 3AN2C 4XUJB 1H3OA 3REHB 1ZLAA 5B2JC 3AZHA 1HQ3C 3X1VB 4Z66A 4HGAC 2JCHA 3AZKA 3LELB 5AV5C 4R8PD 1P3OB 1JFIB 3KUYA 3AZFD 1TAFA 1T3UA 3W96A 5JA4B 5B31B 3RELA 4NE6A 1S32A 3UTAC 1AOIB 2BYKB 3O62B 5B1MA 4YM6C 4J8VC 3LZ0D 5BT1C 5GT3D 4ZUXA 2AROD 4XZQD 2BYMB 4J8XA 5AVBB 1W2EA 5F99C 3LZ1A 4J8UA 4QLCD 1P3BB 3X1VD 5B33C 1KX4C 5B24A 3B6FB 5B2IB 1P3OD 4X23B 4H9PB 5B0ZB 5DNNA 2YFWB 4WU9A 3W98C 3WTPC 5GT0C 5B31D 4UPKA 3AYWB 3EG5B 1F66B 3X1TD 3C1BC 3O62D 3MGQA 3X1SA 3KWQC 4JJNA 2J8PA 1P3ID 3X1UC 3V9RA 3WAAC 3VH6A 1ID3B 2PYOC 3B0CW 5B32B 5AVBD 1ZLAC 4J8WD 2F8NG 4Z5TB 5E5AA 3LJAB 2NQBC 2CV5B 3AZKC 4YS3B 1M19C 5B2ID 3B6FD 5B0ZD 1M18D 5JRGC 3REIA 4ZBJC 2Y2MA 3W96C 3RELC 5AV8B 4LD9B 1P3LA 2DF4C 3AV1B 2ZM5A 5C3IB 2HIOB 1BH9B 3W97B 1KX5C 5B1MC 3AZGB 4E45A 4XUJC 4ZUXC 2Y2JA 4KHAA 3AZNA 1P3AD 5AVCA 4J8XC 4WJ3C 1TZYB 3LZ1C 4J8UC 5GSUA 3W99A 3MGSA 3AV2A 3B0DB 3MNNA 2ZY3A 3LJAD 4NE5A 4CAYA 3R45A 4YS3D 3MVDB 1KX3D 5DNNC 4WU9C 1P3MA 3AZLD 5CPIA 5BO0B 5AV8D 1M1AB 1P3PB 5B40B 4LD9D 5AV6B 3AZLA 3KXBB 3X1SC 3TU4A 4JJNC 5B2JA 5FUGA 5AY8B 3AZGD 4Z2MH 4H9OA 3EPJA 1TZYD 4H9NA 3A6NB 2FJ7D 4E44A 5E5AC 4X23C 1P3GA 1F1EA 3AZEA 5DNMA 3C1CD 3MVDD 5CPJB 4KGCA 3AYWC 2RVQC 4YM6A 5G49A 3WKJA 2NZDD 5GXQC 5B40D 4H9QA 4UUZB 5AV6D 3AN2D 3AFAB 4AWLB 4G91C 5B32C 5AY8D 3MGRA 3UTBA 3MGPB 5B33A 2FFFB 5AVCC 1P3KA 5AV5D 5GSUC 3AZFB 3W99C 4WU8A 3MGSC 3AV2C 5BS7A 2F2AC 2L5AA 3AZJB 3REJB 2YFVA 5CPJD 5AV9A 4Z2MG 5B0YA 3KWQA 1P3FD 5BNVB 2ZY5A 3LZ0B 3AV1C 4J8VD 2AROB 4XZQB 2HIOC 3H0LC 2PYOA 3UT9A 3AZLC 3TU4C 4QLCB 5F99D 3KFUG 3AFAD 3AZHB 2NQBA 3MGPD 4Z66B 2HUEC 1M19A 1KX4D 4CSRA 3AZIC 3B0BA 5JRGA 3KUYB 3NQJA 3W98D 3WTPD 1N1JB 4WNNB 1P3GC 3AZJD 3REJD 3AZEC 5DNMC 1P3AC 4WV4B 3X1TB 1S32B 5GT3A 2JSSA 1EQZB 4KGCC 1KX5A 3C1BD 3WKJC 1U35B 1P3IB 4XUJA 3REHA 2F8NB 3X1UD 4KUDC 3WAAD 1HTAA 4J8WB 1P34C 3LELA 3MGRC 1P3OA 2DQNC 3AZHD 3UTBC 3WA9C 1JFIA 3REKC 4Z66D 1P3KC 5B24B 3AZKD 1M18B 5B31A 4WU8C 3NQUB 5BS7C 3KUYD 2Y2HA 5CP6C 3B6GB 4M6BA 1AOIA 2BYKA 3VH5T 3W96D 3EPLA 1S32D 1EQZD 5AV9C 2Y2IA 5B0YC 2G5IC 3MGQB 2BYMA 5CPKB 5B1MD 1U35D 2F8ND 4EO5B 1P3AB 4ZUXD 3V9RB 3UT9C 1P3BA 1R4VA 4J8UD 4R8PC 3B6FA 4X23A 5B0ZA 3AZMB 2YFWA 1KX3B 5B24D 2IO5B 1Q9CA 3AYWA 3REIB 4WU9D 1F66A 5GXQA 3B6GD 4H9SC 3KSYA 1P3LB 5GT3C 3MGQD 5CPKD 4JJND 1ID3A 5B32A 3REHC 5B1LB 3X1VC 4Z5TA 2FJ7B 2CV5A 3LELC 1P3OC 3MNNB 5E5AD 3AZMD 4CAYB 4G92B 3R45B 3C1CB 1BH8A 5B31C 3REID 2NZDB 1WWIA 3AV1A 2Y2QA 1P3MB 4H9RB 1AOIC 2HIOA 1BH9A 1WWSA 2BG1A 3W97A 3O62C 5CPIB 1P3LD 3AZGA 3AN2B 2RIQA 5B2JB 5AVBC 5FUGB 3VH6T 1HQ3B 4H9OB 4HGAB 3AZND 1P3BC 5B1LD 5AV5B 3AZIA 5GSUD 5B32G 3W99D 5B2IC 3MGSD 3AV2D 3B6FC 3MNND 5BNXA 3VH5W 5B0ZC 3UTAB 1P3FB 5BO0A 3EPHA 4DRBA 1P3PA 1M1AA 1F66C 4YM6B 4J8VB 1P3MD 5CPID 3KXBA 5KDMA 4KUDA 4H9QB 2W8SA 5F99B 1P34A 3TU4D 1ID3C 5B2JD 3H0MC 3A6NA 3WA9A 1HQ3D 5CHLB 3REKA 5B33B 4NFTA 1KX4B 4Z5TC 3LJAC 2CV5C 4YS3C 5CP6A 1KX3C 3W98B 3WTPB 3F6TA 5GT0B 1BFMA 5CPJA 3AZED 5DNMD 3UTAD 5AV8C 3C1BB 3A1KA 2G5HC 4KGCD 4LD9C 4UUZA 3KWQB 4YM6D 5C3IC 3W97C 5BT1D 3X1UB 3WAAB 2PYOB 3AZGC 1H3OB 1A7WA 1ZLAB 3AL0C 1B67A 4R8PA 1TZYC 3AZFA 3UTBD 5B33D 3B0DC 3AZKB 1M19B 1P3KD 5JRGB 3REJA 4WU8D 1TAFB 3MVDC 4ZBJB 4H9SA 3W96B 3VH5A 5GT0D 3RELB 3IP4C 5BNVA 2VQRA 3LZ0A 2AROA 4XZQA 1M1AC 1P3PC 5B40C 1KX5B 5B1MB 3KWQD 2Y2PA 5AV6C 2XD1A 3KXBC 4ZUXB 4QLCA 4J8XB 3X1VA 5AY8C 2PYOD 3UT9D 2ZY4A 3LZ1B 4J8UB 1ZLAD 3A6NC 2NQBD 5JA4A 1M19D 1N1JA 4WNNA 5DNNB 5JRGD 4WU9B 4DQYB 2F8NH 3X1TA 3RELD 3O62A 5CPJC 1EQZA 1P3FC 3H0RC 1U35A 1P3IA 2F8NA 3X1SB 1KX5D 4JJNB 5AVBA 2Y2NA 4XUJD 4J8WA 4WZSB 3REHD 3AFAC 4AWLC 4J8XD 2UWXA 3MGPC 1Z2CB 3LZ1D 5B2IA 4H9PA 5E5AB 3LELD 1M18A 3AZFC 3NQUA 3B6GA 3AZJC 5DNND 3REJC 1ULYA 5GXQB 1AOID 5B31G 4DRAA 3LZ0C 5CPKA 2AROC 4XZQC 1P3AA 3X1SD 4G91B 4QLCC 4KHAB 3AZNB 5AVCB 3AZHC 3LJAA 1P3BD 3AZMA 5GSUB 4YS3A 4Z66C 3W99B 3MGSB 3AV2B 1KX3A 4X23D 3KUYC 1BH8B 5AV8A 4LD9A 3AYWD 2RVQD 3X1TC 1S32C 1EQZC 5GXQD 1F66D 1U35C 1P3IC 2ZY2A 3AZLB 2CWEA 3TU4B 1TZYA 5B1LA 1ID3D 5B32D 4J8WC 2FJ7A 5AVCD 2HUEB 4H9NB 4Z5TD 3AZIB 2CV5D 3C1CA 5B24C 3MVDA 1M18C 1B6WA 5BNXB 1P3GB 2NZDA 3AZEB 1PZRA 3WTPE 5DNMB 4NE3A 3B6GC 4H9RA 5B40A 4KGCB 3WKJB 5G49B 5AV6A 3AV1D 3AN2A 2HIOD 3MGQC 3W97D 5CPKC 5KDMB 5AY8A 4KUDB 1HQ3A 4EO5C 1P34B
chains in the Genus database with same CATH topology
3MGRB 5AV5A 3UTBB 3WA9B 3REKB 1P3KB 3AZID 3AZMC 4WU8B 2LY8A 2IO5C 5CP6B 3UTAA 1P3GD 1P3FA 3REIC 2JE5A 2YFVB 4J8VA 3A1IA 5AV9B 2Y2GA 5B0YB 1M1AD 1P3LC 1P3PD 3WKJD 5F99A 3KXBD 3AFAA 3UT9B 4KUDD 3MGPA 1KU5A 3AZNC 1P34D 1KX4A 5B1LC 2XD5A 4R8PB 3MGRD 2NQBB 3B0CT 3EPKA 3A6ND 2FJ7C 3WA9D 3FDDA 3REKD 3MNNC 4CSRB 3WTPA 3W98A 5GT0A 3P5JB 3AZJA 4G92C 3C1CC 3NQJB 5CP6D 3C1BA 2NZDC 2F8NK 1P3MC 2Y2KA 5CPIC 5GT3B 3X1UA 5AV9D 2Y2LA 5B0YD 3VH6W 3WAAA 2Y2OA 3AN2C 4XUJB 1H3OA 3REHB 1ZLAA 5B2JC 3AZHA 1HQ3C 3X1VB 4Z66A 4HGAC 2JCHA 3AZKA 3LELB 5AV5C 4R8PD 1P3OB 1JFIB 3KUYA 3AZFD 1TAFA 1T3UA 3W96A 5JA4B 5B31B 3RELA 4NE6A 1S32A 3UTAC 1AOIB 2BYKB 3O62B 5B1MA 4YM6C 4J8VC 3LZ0D 5BT1C 5GT3D 4ZUXA 2AROD 4XZQD 2BYMB 4J8XA 5AVBB 1W2EA 5F99C 3LZ1A 4J8UA 4QLCD 1P3BB 3X1VD 5B33C 1KX4C 5B24A 3B6FB 5B2IB 1P3OD 4X23B 4H9PB 5B0ZB 5DNNA 2YFWB 4WU9A 3W98C 3WTPC 5GT0C 5B31D 4UPKA 3AYWB 3EG5B 1F66B 3X1TD 3C1BC 3O62D 3MGQA 3X1SA 3KWQC 4JJNA 2J8PA 1P3ID 3X1UC 3V9RA 3WAAC 3VH6A 1ID3B 2PYOC 3B0CW 5B32B 5AVBD 1ZLAC 4J8WD 2F8NG 4Z5TB 5E5AA 3LJAB 2NQBC 2CV5B 3AZKC 4YS3B 1M19C 5B2ID 3B6FD 5B0ZD 1M18D 5JRGC 3REIA 4ZBJC 2Y2MA 3W96C 3RELC 5AV8B 4LD9B 1P3LA 2DF4C 3AV1B 2ZM5A 5C3IB 2HIOB 1BH9B 3W97B 1KX5C 5B1MC 3AZGB 4E45A 4XUJC 4ZUXC 2Y2JA 4KHAA 3AZNA 1P3AD 5AVCA 4J8XC 4WJ3C 1TZYB 3LZ1C 4J8UC 5GSUA 3W99A 3MGSA 3AV2A 3B0DB 3MNNA 2ZY3A 3LJAD 4NE5A 4CAYA 3R45A 4YS3D 3MVDB 1KX3D 5DNNC 4WU9C 1P3MA 3AZLD 5CPIA 5BO0B 5AV8D 1M1AB 1P3PB 5B40B 4LD9D 5AV6B 3AZLA 3KXBB 3X1SC 3TU4A 4JJNC 5B2JA 5FUGA 5AY8B 3AZGD 4Z2MH 4H9OA 3EPJA 1TZYD 4H9NA 3A6NB 2FJ7D 4E44A 5E5AC 4X23C 1P3GA 1F1EA 3AZEA 5DNMA 3C1CD 3MVDD 5CPJB 4KGCA 3AYWC 2RVQC 4YM6A 5G49A 3WKJA 2NZDD 5GXQC 5B40D 4H9QA 4UUZB 5AV6D 3AN2D 3AFAB 4AWLB 4G91C 5B32C 5AY8D 3MGRA 3UTBA 3MGPB 5B33A 2FFFB 5AVCC 1P3KA 5AV5D 5GSUC 3AZFB 3W99C 4WU8A 3MGSC 3AV2C 5BS7A 2F2AC 2L5AA 3AZJB 3REJB 2YFVA 5CPJD 5AV9A 4Z2MG 5B0YA 3KWQA 1P3FD 5BNVB 2ZY5A 3LZ0B 3AV1C 4J8VD 2AROB 4XZQB 2HIOC 3H0LC 2PYOA 3UT9A 3AZLC 3TU4C 4QLCB 5F99D 3KFUG 3AFAD 3AZHB 2NQBA 3MGPD 4Z66B 2HUEC 1M19A 1KX4D 4CSRA 3AZIC 3B0BA 5JRGA 3KUYB 3NQJA 3W98D 3WTPD 1N1JB 4WNNB 1P3GC 3AZJD 3REJD 3AZEC 5DNMC 1P3AC 4WV4B 3X1TB 1S32B 5GT3A 2JSSA 1EQZB 4KGCC 1KX5A 3C1BD 3WKJC 1U35B 1P3IB 4XUJA 3REHA 2F8NB 3X1UD 4KUDC 3WAAD 1HTAA 4J8WB 1P34C 3LELA 3MGRC 1P3OA 2DQNC 3AZHD 3UTBC 3WA9C 1JFIA 3REKC 4Z66D 1P3KC 5B24B 3AZKD 1M18B 5B31A 4WU8C 3NQUB 5BS7C 3KUYD 2Y2HA 5CP6C 3B6GB 4M6BA 1AOIA 2BYKA 3VH5T 3W96D 3EPLA 1S32D 1EQZD 5AV9C 2Y2IA 5B0YC 2G5IC 3MGQB 2BYMA 5CPKB 5B1MD 1U35D 2F8ND 4EO5B 1P3AB 4ZUXD 3V9RB 3UT9C 1P3BA 1R4VA 4J8UD 4R8PC 3B6FA 4X23A 5B0ZA 3AZMB 2YFWA 1KX3B 5B24D 2IO5B 1Q9CA 3AYWA 3REIB 4WU9D 1F66A 5GXQA 3B6GD 4H9SC 3KSYA 1P3LB 5GT3C 3MGQD 5CPKD 4JJND 1ID3A 5B32A 3REHC 5B1LB 3X1VC 4Z5TA 2FJ7B 2CV5A 3LELC 1P3OC 3MNNB 5E5AD 3AZMD 4CAYB 4G92B 3R45B 3C1CB 1BH8A 5B31C 3REID 2NZDB 1WWIA 3AV1A 2Y2QA 1P3MB 4H9RB 1AOIC 2HIOA 1BH9A 1WWSA 2BG1A 3W97A 3O62C 5CPIB 1P3LD 3AZGA 3AN2B 2RIQA 5B2JB 5AVBC 5FUGB 3VH6T 1HQ3B 4H9OB 4HGAB 3AZND 1P3BC 5B1LD 5AV5B 3AZIA 5GSUD 5B32G 3W99D 5B2IC 3MGSD 3AV2D 3B6FC 3MNND 5BNXA 3VH5W 5B0ZC 3UTAB 1P3FB 5BO0A 3EPHA 4DRBA 1P3PA 1M1AA 1F66C 4YM6B 4J8VB 1P3MD 5CPID 3KXBA 5KDMA 4KUDA 4H9QB 2W8SA 5F99B 1P34A 3TU4D 1ID3C 5B2JD 3H0MC 3A6NA 3WA9A 1HQ3D 5CHLB 3REKA 5B33B 4NFTA 1KX4B 4Z5TC 3LJAC 2CV5C 4YS3C 5CP6A 1KX3C 3W98B 3WTPB 3F6TA 5GT0B 1BFMA 5CPJA 3AZED 5DNMD 3UTAD 5AV8C 3C1BB 3A1KA 2G5HC 4KGCD 4LD9C 4UUZA 3KWQB 4YM6D 5C3IC 3W97C 5BT1D 3X1UB 3WAAB 2PYOB 3AZGC 1H3OB 1A7WA 1ZLAB 3AL0C 1B67A 4R8PA 1TZYC 3AZFA 3UTBD 5B33D 3B0DC 3AZKB 1M19B 1P3KD 5JRGB 3REJA 4WU8D 1TAFB 3MVDC 4ZBJB 4H9SA 3W96B 3VH5A 5GT0D 3RELB 3IP4C 5BNVA 2VQRA 3LZ0A 2AROA 4XZQA 1M1AC 1P3PC 5B40C 1KX5B 5B1MB 3KWQD 2Y2PA 5AV6C 2XD1A 3KXBC 4ZUXB 4QLCA 4J8XB 3X1VA 5AY8C 2PYOD 3UT9D 2ZY4A 3LZ1B 4J8UB 1ZLAD 3A6NC 2NQBD 5JA4A 1M19D 1N1JA 4WNNA 5DNNB 5JRGD 4WU9B 4DQYB 2F8NH 3X1TA 3RELD 3O62A 5CPJC 1EQZA 1P3FC 3H0RC 1U35A 1P3IA 2F8NA 3X1SB 1KX5D 4JJNB 5AVBA 2Y2NA 4XUJD 4J8WA 4WZSB 3REHD 3AFAC 4AWLC 4J8XD 2UWXA 3MGPC 1Z2CB 3LZ1D 5B2IA 4H9PA 5E5AB 3LELD 1M18A 3AZFC 3NQUA 3B6GA 3AZJC 5DNND 3REJC 1ULYA 5GXQB 1AOID 5B31G 4DRAA 3LZ0C 5CPKA 2AROC 4XZQC 1P3AA 3X1SD 4G91B 4QLCC 4KHAB 3AZNB 5AVCB 3AZHC 3LJAA 1P3BD 3AZMA 5GSUB 4YS3A 4Z66C 3W99B 3MGSB 3AV2B 1KX3A 4X23D 3KUYC 1BH8B 5AV8A 4LD9A 3AYWD 2RVQD 3X1TC 1S32C 1EQZC 5GXQD 1F66D 1U35C 1P3IC 2ZY2A 3AZLB 2CWEA 3TU4B 1TZYA 5B1LA 1ID3D 5B32D 4J8WC 2FJ7A 5AVCD 2HUEB 4H9NB 4Z5TD 3AZIB 2CV5D 3C1CA 5B24C 3MVDA 1M18C 1B6WA 5BNXB 1P3GB 2NZDA 3AZEB 1PZRA 3WTPE 5DNMB 4NE3A 3B6GC 4H9RA 5B40A 4KGCB 3WKJB 5G49B 5AV6A 3AV1D 3AN2A 2HIOD 3MGQC 3W97D 5CPKC 5KDMB 5AY8A 4KUDB 1HQ3A 4EO5C 1P34B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR B;  5AV5 A;  3UTB B;  3WA9 B;  3REK B;  1P3K B;  3AZI D;  3AZM C;  4WU8 B;  2LY8 A;  2IO5 C;  5CP6 B;  3UTA A;  1P3G D;  1P3F A;  3REI C;  2YFV B;  4J8V A;  5AV9 B;  5B0Y B;  1M1A D;  1P3L C;  1P3P D;  3WKJ D;  5F99 A;  3KXB D;  3AFA A;  3UT9 B;  4KUD D;  3MGP A;  1KU5 A;  3AZN C;  1P34 D;  1KX4 A;  5B1L C;  4R8P B;  3MGR D;  2NQB B;  3B0C T;  2FJ7 C;  3A6N D;  3WA9 D;  3REK D;  3MNN C;  4CSR B;  3WTP A;  3W98 A;  5GT0 A;  3AZJ A;  4G92 C;  3C1C C;  3NQJ B;  5CP6 D;  3C1B A;  2NZD C;  2F8N K;  1P3M C;  5CPI C;  5GT3 B;  3X1U A;  5AV9 D;  5B0Y D;  3VH6 W;  3WAA A;  3AN2 C;  4XUJ B;  1H3O A;  3REH B;  1ZLA A;  5B2J C;  3AZH A;  1HQ3 C;  3X1V B;  4Z66 A;  4HGA C;  3AZK A;  3LEL B;  5AV5 C;  4R8P D;  1P3O B;  1JFI B;  3KUY A;  3AZF D;  1TAF A;  3W96 A;  5JA4 B;  5B31 B;  3REL A;  4NE6 A;  1S32 A;  3UTA C;  1AOI B;  2BYK B;  3O62 B;  5B1M A;  4YM6 C;  4J8V C;  3LZ0 D;  5BT1 C;  5GT3 D;  4ZUX A;  2ARO D;  4XZQ D;  2BYM B;  4J8X A;  5AVB B;  5F99 C;  3LZ1 A;  4J8U A;  4QLC D;  1P3B B;  3X1V D;  5B33 C;  1KX4 C;  5B24 A;  3B6F B;  5B2I B;  1P3O D;  4X23 B;  4H9P B;  5B0Z B;  5DNN A;  2YFW B;  4WU9 A;  3W98 C;  3WTP C;  5GT0 C;  5B31 D;  3AYW B;  1F66 B;  3X1T D;  3C1B C;  3O62 D;  3MGQ A;  3X1S A;  3KWQ C;  4JJN A;  1P3I D;  3X1U C;  3V9R A;  3WAA C;  3VH6 A;  1ID3 B;  2PYO C;  3B0C W;  5B32 B;  5AVB D;  1ZLA C;  4J8W D;  2F8N G;  4Z5T B;  5E5A A;  3LJA B;  2NQB C;  2CV5 B;  3AZK C;  4YS3 B;  1M19 C;  5B2I D;  3B6F D;  5B0Z D;  1M18 D;  5JRG C;  3REI A;  4ZBJ C;  3W96 C;  3REL C;  5AV8 B;  4LD9 B;  1P3L A;  3AV1 B;  5C3I B;  2HIO B;  1BH9 B;  3W97 B;  1KX5 C;  5B1M C;  3AZG B;  4E45 A;  4XUJ C;  4ZUX C;  4KHA A;  3AZN A;  1P3A D;  5AVC A;  4J8X C;  1TZY B;  3LZ1 C;  4J8U C;  5GSU A;  3W99 A;  3MGS A;  3AV2 A;  3B0D B;  3MNN A;  3LJA D;  4NE5 A;  4CAY A;  3R45 A;  4YS3 D;  3MVD B;  1KX3 D;  5DNN C;  4WU9 C;  1P3M A;  3AZL D;  5CPI A;  5BO0 B;  5AV8 D;  1M1A B;  1P3P B;  5B40 B;  4LD9 D;  5AV6 B;  3AZL A;  3KXB B;  3X1S C;  3TU4 A;  4JJN C;  5B2J A;  5FUG A;  5AY8 B;  3AZG D;  4Z2M H;  4H9O A;  1TZY D;  4H9N A;  3A6N B;  2FJ7 D;  4E44 A;  5E5A C;  4X23 C;  1P3G A;  1F1E A;  3AZE A;  5DNM A;  3C1C D;  3MVD D;  5CPJ B;  4KGC A;  3AYW C;  2RVQ C;  4YM6 A;  5G49 A;  3WKJ A;  2NZD D;  5GXQ C;  5B40 D;  4H9Q A;  4UUZ B;  5AV6 D;  3AN2 D;  3AFA B;  4AWL B;  4G91 C;  5B32 C;  5AY8 D;  3MGR A;  3UTB A;  3MGP B;  5B33 A;  5AVC C;  1P3K A;  5AV5 D;  5GSU C;  3AZF B;  3W99 C;  4WU8 A;  3MGS C;  3AV2 C;  5BS7 A;  2L5A A;  3AZJ B;  3REJ B;  2YFV A;  5CPJ D;  5AV9 A;  4Z2M G;  5B0Y A;  3KWQ A;  1P3F D;  5BNV B;  3LZ0 B;  3AV1 C;  4J8V D;  2ARO B;  4XZQ B;  2HIO C;  2PYO A;  3UT9 A;  3AZL C;  3TU4 C;  4QLC B;  5F99 D;  3AFA D;  3AZH B;  2NQB A;  3MGP D;  4Z66 B;  2HUE C;  1M19 A;  1KX4 D;  4CSR A;  3AZI C;  3B0B A;  5JRG A;  3KUY B;  3NQJ A;  3W98 D;  3WTP D;  1N1J B;  4WNN B;  1P3G C;  3AZJ D;  3REJ D;  3AZE C;  5DNM C;  1P3A C;  4WV4 B;  3X1T B;  1S32 B;  5GT3 A;  2JSS A;  1EQZ B;  4KGC C;  1KX5 A;  3C1B D;  3WKJ C;  1U35 B;  1P3I B;  4XUJ A;  3REH A;  2F8N B;  3X1U D;  4KUD C;  3WAA D;  1HTA A;  4J8W B;  1P34 C;  3LEL A;  3MGR C;  1P3O A;  3AZH D;  3UTB C;  3WA9 C;  1JFI A;  3REK C;  4Z66 D;  1P3K C;  5B24 B;  3AZK D;  1M18 B;  5B31 A;  4WU8 C;  3NQU B;  5BS7 C;  3KUY D;  5CP6 C;  3B6G B;  4M6B A;  1AOI A;  2BYK A;  3VH5 T;  3W96 D;  1S32 D;  1EQZ D;  5AV9 C;  5B0Y C;  3MGQ B;  2BYM A;  5CPK B;  5B1M D;  1U35 D;  2F8N D;  4EO5 B;  1P3A B;  4ZUX D;  3V9R B;  3UT9 C;  1P3B A;  1R4V A;  4J8U D;  4R8P C;  3B6F A;  4X23 A;  5B0Z A;  3AZM B;  2YFW A;  1KX3 B;  5B24 D;  2IO5 B;  1Q9C A;  3AYW A;  3REI B;  4WU9 D;  1F66 A;  5GXQ A;  3B6G D;  4H9S C;  3KSY A;  1P3L B;  5GT3 C;  3MGQ D;  5CPK D;  4JJN D;  1ID3 A;  5B32 A;  3REH C;  5B1L B;  3X1V C;  4Z5T A;  2FJ7 B;  2CV5 A;  3LEL C;  1P3O C;  3MNN B;  5E5A D;  3AZM D;  4CAY B;  4G92 B;  3R45 B;  3C1C B;  1BH8 A;  5B31 C;  3REI D;  2NZD B;  1WWI A;  3AV1 A;  1P3M B;  1AOI C;  4H9R B;  2HIO A;  1BH9 A;  1WWS A;  3W97 A;  3O62 C;  5CPI B;  1P3L D;  3AZG A;  3AN2 B;  5B2J B;  5AVB C;  5FUG B;  3VH6 T;  1HQ3 B;  4H9O B;  4HGA B;  3AZN D;  1P3B C;  5B1L D;  5AV5 B;  3AZI A;  5GSU D;  5B32 G;  3W99 D;  5B2I C;  3MGS D;  3AV2 D;  3B6F C;  3MNN D;  5BNX A;  3VH5 W;  5B0Z C;  3UTA B;  1P3F B;  5BO0 A;  4DRB A;  1P3P A;  1M1A A;  1F66 C;  4YM6 B;  4J8V B;  1P3M D;  5CPI D;  3KXB A;  5KDM A;  4KUD A;  4H9Q B;  5F99 B;  1P34 A;  3TU4 D;  1ID3 C;  5B2J D;  3A6N A;  3WA9 A;  1HQ3 D;  5CHL B;  3REK A;  5B33 B;  4NFT A;  1KX4 B;  4Z5T C;  3LJA C;  2CV5 C;  4YS3 C;  5CP6 A;  1KX3 C;  3W98 B;  3WTP B;  5GT0 B;  1BFM A;  5CPJ A;  3AZE D;  5DNM D;  3UTA D;  5AV8 C;  3C1B B;  4LD9 C;  4KGC D;  4UUZ A;  3KWQ B;  4YM6 D;  5C3I C;  3W97 C;  5BT1 D;  3X1U B;  3WAA B;  2PYO B;  3AZG C;  1H3O B;  1A7W A;  1ZLA B;  1B67 A;  4R8P A;  1TZY C;  3AZF A;  3UTB D;  5B33 D;  3B0D C;  3AZK B;  1M19 B;  1P3K D;  5JRG B;  3REJ A;  4WU8 D;  1TAF B;  3MVD C;  4ZBJ B;  4H9S A;  3W96 B;  3VH5 A;  5GT0 D;  3REL B;  5BNV A;  3LZ0 A;  2ARO A;  4XZQ A;  1M1A C;  1P3P C;  5B40 C;  1KX5 B;  5B1M B;  3KWQ D;  5AV6 C;  3KXB C;  4ZUX B;  4QLC A;  4J8X B;  3X1V A;  5AY8 C;  2PYO D;  3UT9 D;  3LZ1 B;  4J8U B;  1ZLA D;  3A6N C;  2NQB D;  5JA4 A;  1M19 D;  1N1J A;  4WNN A;  5DNN B;  5JRG D;  4WU9 B;  2F8N H;  3X1T A;  3REL D;  3O62 A;  5CPJ C;  1EQZ A;  1P3F C;  1U35 A;  1P3I A;  2F8N A;  3X1S B;  1KX5 D;  4JJN B;  5AVB A;  4XUJ D;  4J8W A;  4WZS B;  3REH D;  3AFA C;  4AWL C;  4J8X D;  3MGP C;  3LZ1 D;  5B2I A;  4H9P A;  5E5A B;  3LEL D;  1M18 A;  3AZF C;  3NQU A;  3B6G A;  3AZJ C;  5DNN D;  3REJ C;  1ULY A;  5GXQ B;  1AOI D;  5B31 G;  4DRA A;  3LZ0 C;  5CPK A;  2ARO C;  4XZQ C;  1P3A A;  3X1S D;  4G91 B;  4QLC C;  4KHA B;  3AZN B;  5AVC B;  3AZH C;  3LJA A;  1P3B D;  3AZM A;  5GSU B;  4YS3 A;  4Z66 C;  3W99 B;  3MGS B;  3AV2 B;  1KX3 A;  4X23 D;  3KUY C;  1BH8 B;  5AV8 A;  4LD9 A;  3AYW D;  2RVQ D;  3X1T C;  1S32 C;  1EQZ C;  5GXQ D;  1F66 D;  1U35 C;  1P3I C;  3AZL B;  2CWE A;  3TU4 B;  1TZY A;  5B1L A;  1ID3 D;  5B32 D;  4J8W C;  2FJ7 A;  5AVC D;  2HUE B;  4H9N B;  4Z5T D;  3AZI B;  2CV5 D;  3C1C A;  5B24 C;  3MVD A;  1M18 C;  1B6W A;  5BNX B;  1P3G B;  2NZD A;  3AZE B;  3WTP E;  5DNM B;  4NE3 A;  3B6G C;  4H9R A;  5B40 A;  4KGC B;  3WKJ B;  5G49 B;  5AV6 A;  3AV1 D;  3AN2 A;  2HIO D;  3MGQ C;  3W97 D;  5CPK C;  5KDM B;  5AY8 A;  4KUD B;  1HQ3 A;  4EO5 C;  1P34 B; 
#chains in the Genus database with same CATH topology
 3MGR B;  5AV5 A;  3UTB B;  3WA9 B;  3REK B;  1P3K B;  3AZI D;  3AZM C;  4WU8 B;  2LY8 A;  2IO5 C;  5CP6 B;  3UTA A;  1P3G D;  1P3F A;  3REI C;  2JE5 A;  2YFV B;  4J8V A;  3A1I A;  5AV9 B;  2Y2G A;  5B0Y B;  1M1A D;  1P3L C;  1P3P D;  3WKJ D;  5F99 A;  3KXB D;  3AFA A;  3UT9 B;  4KUD D;  3MGP A;  1KU5 A;  3AZN C;  1P34 D;  1KX4 A;  5B1L C;  2XD5 A;  4R8P B;  3MGR D;  2NQB B;  3B0C T;  3EPK A;  3A6N D;  2FJ7 C;  3WA9 D;  3FDD A;  3REK D;  3MNN C;  4CSR B;  3WTP A;  3W98 A;  5GT0 A;  3P5J B;  3AZJ A;  4G92 C;  3C1C C;  3NQJ B;  5CP6 D;  3C1B A;  2NZD C;  2F8N K;  1P3M C;  2Y2K A;  5CPI C;  5GT3 B;  3X1U A;  5AV9 D;  2Y2L A;  5B0Y D;  3VH6 W;  3WAA A;  2Y2O A;  3AN2 C;  4XUJ B;  1H3O A;  3REH B;  1ZLA A;  5B2J C;  3AZH A;  1HQ3 C;  3X1V B;  4Z66 A;  4HGA C;  2JCH A;  3AZK A;  3LEL B;  5AV5 C;  4R8P D;  1P3O B;  1JFI B;  3KUY A;  3AZF D;  1TAF A;  1T3U A;  3W96 A;  5JA4 B;  5B31 B;  3REL A;  4NE6 A;  1S32 A;  3UTA C;  1AOI B;  2BYK B;  3O62 B;  5B1M A;  4YM6 C;  4J8V C;  3LZ0 D;  5BT1 C;  5GT3 D;  4ZUX A;  2ARO D;  4XZQ D;  2BYM B;  4J8X A;  5AVB B;  1W2E A;  5F99 C;  3LZ1 A;  4J8U A;  4QLC D;  1P3B B;  3X1V D;  5B33 C;  1KX4 C;  5B24 A;  3B6F B;  5B2I B;  1P3O D;  4X23 B;  4H9P B;  5B0Z B;  5DNN A;  2YFW B;  4WU9 A;  3W98 C;  3WTP C;  5GT0 C;  5B31 D;  4UPK A;  3AYW B;  3EG5 B;  1F66 B;  3X1T D;  3C1B C;  3O62 D;  3MGQ A;  3X1S A;  3KWQ C;  4JJN A;  2J8P A;  1P3I D;  3X1U C;  3V9R A;  3WAA C;  3VH6 A;  1ID3 B;  2PYO C;  3B0C W;  5B32 B;  5AVB D;  1ZLA C;  4J8W D;  2F8N G;  4Z5T B;  5E5A A;  3LJA B;  2NQB C;  2CV5 B;  3AZK C;  4YS3 B;  1M19 C;  5B2I D;  3B6F D;  5B0Z D;  1M18 D;  5JRG C;  3REI A;  4ZBJ C;  2Y2M A;  3W96 C;  3REL C;  5AV8 B;  4LD9 B;  1P3L A;  2DF4 C;  3AV1 B;  2ZM5 A;  5C3I B;  2HIO B;  1BH9 B;  3W97 B;  1KX5 C;  5B1M C;  3AZG B;  4E45 A;  4XUJ C;  4ZUX C;  2Y2J A;  4KHA A;  3AZN A;  1P3A D;  5AVC A;  4J8X C;  4WJ3 C;  1TZY B;  3LZ1 C;  4J8U C;  5GSU A;  3W99 A;  3MGS A;  3AV2 A;  3B0D B;  3MNN A;  2ZY3 A;  3LJA D;  4NE5 A;  4CAY A;  3R45 A;  4YS3 D;  3MVD B;  1KX3 D;  5DNN C;  4WU9 C;  1P3M A;  3AZL D;  5CPI A;  5BO0 B;  5AV8 D;  1M1A B;  1P3P B;  5B40 B;  4LD9 D;  5AV6 B;  3AZL A;  3KXB B;  3X1S C;  3TU4 A;  4JJN C;  5B2J A;  5FUG A;  5AY8 B;  3AZG D;  4Z2M H;  4H9O A;  3EPJ A;  1TZY D;  4H9N A;  3A6N B;  2FJ7 D;  4E44 A;  5E5A C;  4X23 C;  1P3G A;  1F1E A;  3AZE A;  5DNM A;  3C1C D;  3MVD D;  5CPJ B;  4KGC A;  3AYW C;  2RVQ C;  4YM6 A;  5G49 A;  3WKJ A;  2NZD D;  5GXQ C;  5B40 D;  4H9Q A;  4UUZ B;  5AV6 D;  3AN2 D;  3AFA B;  4AWL B;  4G91 C;  5B32 C;  5AY8 D;  3MGR A;  3UTB A;  3MGP B;  5B33 A;  2FFF B;  5AVC C;  1P3K A;  5AV5 D;  5GSU C;  3AZF B;  3W99 C;  4WU8 A;  3MGS C;  3AV2 C;  5BS7 A;  2F2A C;  2L5A A;  3AZJ B;  3REJ B;  2YFV A;  5CPJ D;  5AV9 A;  4Z2M G;  5B0Y A;  3KWQ A;  1P3F D;  5BNV B;  2ZY5 A;  3LZ0 B;  3AV1 C;  4J8V D;  2ARO B;  4XZQ B;  2HIO C;  3H0L C;  2PYO A;  3UT9 A;  3AZL C;  3TU4 C;  4QLC B;  5F99 D;  3KFU G;  3AFA D;  3AZH B;  2NQB A;  3MGP D;  4Z66 B;  2HUE C;  1M19 A;  1KX4 D;  4CSR A;  3AZI C;  3B0B A;  5JRG A;  3KUY B;  3NQJ A;  3W98 D;  3WTP D;  1N1J B;  4WNN B;  1P3G C;  3AZJ D;  3REJ D;  3AZE C;  5DNM C;  1P3A C;  4WV4 B;  3X1T B;  1S32 B;  5GT3 A;  2JSS A;  1EQZ B;  4KGC C;  1KX5 A;  3C1B D;  3WKJ C;  1U35 B;  1P3I B;  4XUJ A;  3REH A;  2F8N B;  3X1U D;  4KUD C;  3WAA D;  1HTA A;  4J8W B;  1P34 C;  3LEL A;  3MGR C;  1P3O A;  2DQN C;  3AZH D;  3UTB C;  3WA9 C;  1JFI A;  3REK C;  4Z66 D;  1P3K C;  5B24 B;  3AZK D;  1M18 B;  5B31 A;  4WU8 C;  3NQU B;  5BS7 C;  3KUY D;  2Y2H A;  5CP6 C;  3B6G B;  4M6B A;  1AOI A;  2BYK A;  3VH5 T;  3W96 D;  3EPL A;  1S32 D;  1EQZ D;  5AV9 C;  2Y2I A;  5B0Y C;  2G5I C;  3MGQ B;  2BYM A;  5CPK B;  5B1M D;  1U35 D;  2F8N D;  4EO5 B;  1P3A B;  4ZUX D;  3V9R B;  3UT9 C;  1P3B A;  1R4V A;  4J8U D;  4R8P C;  3B6F A;  4X23 A;  5B0Z A;  3AZM B;  2YFW A;  1KX3 B;  5B24 D;  2IO5 B;  1Q9C A;  3AYW A;  3REI B;  4WU9 D;  1F66 A;  5GXQ A;  3B6G D;  4H9S C;  3KSY A;  1P3L B;  5GT3 C;  3MGQ D;  5CPK D;  4JJN D;  1ID3 A;  5B32 A;  3REH C;  5B1L B;  3X1V C;  4Z5T A;  2FJ7 B;  2CV5 A;  3LEL C;  1P3O C;  3MNN B;  5E5A D;  3AZM D;  4CAY B;  4G92 B;  3R45 B;  3C1C B;  1BH8 A;  5B31 C;  3REI D;  2NZD B;  1WWI A;  3AV1 A;  2Y2Q A;  1P3M B;  4H9R B;  1AOI C;  2HIO A;  1BH9 A;  1WWS A;  2BG1 A;  3W97 A;  3O62 C;  5CPI B;  1P3L D;  3AZG A;  3AN2 B;  2RIQ A;  5B2J B;  5AVB C;  5FUG B;  3VH6 T;  1HQ3 B;  4H9O B;  4HGA B;  3AZN D;  1P3B C;  5B1L D;  5AV5 B;  3AZI A;  5GSU D;  5B32 G;  3W99 D;  5B2I C;  3MGS D;  3AV2 D;  3B6F C;  3MNN D;  5BNX A;  3VH5 W;  5B0Z C;  3UTA B;  1P3F B;  5BO0 A;  3EPH A;  4DRB A;  1P3P A;  1M1A A;  1F66 C;  4YM6 B;  4J8V B;  1P3M D;  5CPI D;  3KXB A;  5KDM A;  4KUD A;  4H9Q B;  2W8S A;  5F99 B;  1P34 A;  3TU4 D;  1ID3 C;  5B2J D;  3H0M C;  3A6N A;  3WA9 A;  1HQ3 D;  5CHL B;  3REK A;  5B33 B;  4NFT A;  1KX4 B;  4Z5T C;  3LJA C;  2CV5 C;  4YS3 C;  5CP6 A;  1KX3 C;  3W98 B;  3WTP B;  3F6T A;  5GT0 B;  1BFM A;  5CPJ A;  3AZE D;  5DNM D;  3UTA D;  5AV8 C;  3C1B B;  3A1K A;  2G5H C;  4KGC D;  4LD9 C;  4UUZ A;  3KWQ B;  4YM6 D;  5C3I C;  3W97 C;  5BT1 D;  3X1U B;  3WAA B;  2PYO B;  3AZG C;  1H3O B;  1A7W A;  1ZLA B;  3AL0 C;  1B67 A;  4R8P A;  1TZY C;  3AZF A;  3UTB D;  5B33 D;  3B0D C;  3AZK B;  1M19 B;  1P3K D;  5JRG B;  3REJ A;  4WU8 D;  1TAF B;  3MVD C;  4ZBJ B;  4H9S A;  3W96 B;  3VH5 A;  5GT0 D;  3REL B;  3IP4 C;  5BNV A;  2VQR A;  3LZ0 A;  2ARO A;  4XZQ A;  1M1A C;  1P3P C;  5B40 C;  1KX5 B;  5B1M B;  3KWQ D;  2Y2P A;  5AV6 C;  2XD1 A;  3KXB C;  4ZUX B;  4QLC A;  4J8X B;  3X1V A;  5AY8 C;  2PYO D;  3UT9 D;  2ZY4 A;  3LZ1 B;  4J8U B;  1ZLA D;  3A6N C;  2NQB D;  5JA4 A;  1M19 D;  1N1J A;  4WNN A;  5DNN B;  5JRG D;  4WU9 B;  4DQY B;  2F8N H;  3X1T A;  3REL D;  3O62 A;  5CPJ C;  1EQZ A;  1P3F C;  3H0R C;  1U35 A;  1P3I A;  2F8N A;  3X1S B;  1KX5 D;  4JJN B;  5AVB A;  2Y2N A;  4XUJ D;  4J8W A;  4WZS B;  3REH D;  3AFA C;  4AWL C;  4J8X D;  2UWX A;  3MGP C;  1Z2C B;  3LZ1 D;  5B2I A;  4H9P A;  5E5A B;  3LEL D;  1M18 A;  3AZF C;  3NQU A;  3B6G A;  3AZJ C;  5DNN D;  3REJ C;  1ULY A;  5GXQ B;  1AOI D;  5B31 G;  4DRA A;  3LZ0 C;  5CPK A;  2ARO C;  4XZQ C;  1P3A A;  3X1S D;  4G91 B;  4QLC C;  4KHA B;  3AZN B;  5AVC B;  3AZH C;  3LJA A;  1P3B D;  3AZM A;  5GSU B;  4YS3 A;  4Z66 C;  3W99 B;  3MGS B;  3AV2 B;  1KX3 A;  4X23 D;  3KUY C;  1BH8 B;  5AV8 A;  4LD9 A;  3AYW D;  2RVQ D;  3X1T C;  1S32 C;  1EQZ C;  5GXQ D;  1F66 D;  1U35 C;  1P3I C;  2ZY2 A;  3AZL B;  2CWE A;  3TU4 B;  1TZY A;  5B1L A;  1ID3 D;  5B32 D;  4J8W C;  2FJ7 A;  5AVC D;  2HUE B;  4H9N B;  4Z5T D;  3AZI B;  2CV5 D;  3C1C A;  5B24 C;  3MVD A;  1M18 C;  1B6W A;  5BNX B;  1P3G B;  2NZD A;  3AZE B;  1PZR A;  3WTP E;  5DNM B;  4NE3 A;  3B6G C;  4H9R A;  5B40 A;  4KGC B;  3WKJ B;  5G49 B;  5AV6 A;  3AV1 D;  3AN2 A;  2HIO D;  3MGQ C;  3W97 D;  5CPK C;  5KDM B;  5AY8 A;  4KUD B;  1HQ3 A;  4EO5 C;  1P34 B; 
#chains in the Genus database with same CATH homology
 3MGR B;  5AV5 A;  3UTB B;  3WA9 B;  3REK B;  1P3K B;  3AZI D;  3AZM C;  4WU8 B;  2LY8 A;  2IO5 C;  5CP6 B;  3UTA A;  1P3G D;  1P3F A;  3REI C;  2JE5 A;  2YFV B;  4J8V A;  3A1I A;  5AV9 B;  2Y2G A;  5B0Y B;  1M1A D;  1P3L C;  1P3P D;  3WKJ D;  5F99 A;  3KXB D;  3AFA A;  3UT9 B;  4KUD D;  3MGP A;  1KU5 A;  3AZN C;  1P34 D;  1KX4 A;  5B1L C;  2XD5 A;  4R8P B;  3MGR D;  2NQB B;  3B0C T;  3EPK A;  3A6N D;  2FJ7 C;  3WA9 D;  3FDD A;  3REK D;  3MNN C;  4CSR B;  3WTP A;  3W98 A;  5GT0 A;  3P5J B;  3AZJ A;  4G92 C;  3C1C C;  3NQJ B;  5CP6 D;  3C1B A;  2NZD C;  2F8N K;  1P3M C;  2Y2K A;  5CPI C;  5GT3 B;  3X1U A;  5AV9 D;  2Y2L A;  5B0Y D;  3VH6 W;  3WAA A;  2Y2O A;  3AN2 C;  4XUJ B;  1H3O A;  3REH B;  1ZLA A;  5B2J C;  3AZH A;  1HQ3 C;  3X1V B;  4Z66 A;  4HGA C;  2JCH A;  3AZK A;  3LEL B;  5AV5 C;  4R8P D;  1P3O B;  1JFI B;  3KUY A;  3AZF D;  1TAF A;  1T3U A;  3W96 A;  5JA4 B;  5B31 B;  3REL A;  4NE6 A;  1S32 A;  3UTA C;  1AOI B;  2BYK B;  3O62 B;  5B1M A;  4YM6 C;  4J8V C;  3LZ0 D;  5BT1 C;  5GT3 D;  4ZUX A;  2ARO D;  4XZQ D;  2BYM B;  4J8X A;  5AVB B;  1W2E A;  5F99 C;  3LZ1 A;  4J8U A;  4QLC D;  1P3B B;  3X1V D;  5B33 C;  1KX4 C;  5B24 A;  3B6F B;  5B2I B;  1P3O D;  4X23 B;  4H9P B;  5B0Z B;  5DNN A;  2YFW B;  4WU9 A;  3W98 C;  3WTP C;  5GT0 C;  5B31 D;  4UPK A;  3AYW B;  3EG5 B;  1F66 B;  3X1T D;  3C1B C;  3O62 D;  3MGQ A;  3X1S A;  3KWQ C;  4JJN A;  2J8P A;  1P3I D;  3X1U C;  3V9R A;  3WAA C;  3VH6 A;  1ID3 B;  2PYO C;  3B0C W;  5B32 B;  5AVB D;  1ZLA C;  4J8W D;  2F8N G;  4Z5T B;  5E5A A;  3LJA B;  2NQB C;  2CV5 B;  3AZK C;  4YS3 B;  1M19 C;  5B2I D;  3B6F D;  5B0Z D;  1M18 D;  5JRG C;  3REI A;  4ZBJ C;  2Y2M A;  3W96 C;  3REL C;  5AV8 B;  4LD9 B;  1P3L A;  2DF4 C;  3AV1 B;  2ZM5 A;  5C3I B;  2HIO B;  1BH9 B;  3W97 B;  1KX5 C;  5B1M C;  3AZG B;  4E45 A;  4XUJ C;  4ZUX C;  2Y2J A;  4KHA A;  3AZN A;  1P3A D;  5AVC A;  4J8X C;  4WJ3 C;  1TZY B;  3LZ1 C;  4J8U C;  5GSU A;  3W99 A;  3MGS A;  3AV2 A;  3B0D B;  3MNN A;  2ZY3 A;  3LJA D;  4NE5 A;  4CAY A;  3R45 A;  4YS3 D;  3MVD B;  1KX3 D;  5DNN C;  4WU9 C;  1P3M A;  3AZL D;  5CPI A;  5BO0 B;  5AV8 D;  1M1A B;  1P3P B;  5B40 B;  4LD9 D;  5AV6 B;  3AZL A;  3KXB B;  3X1S C;  3TU4 A;  4JJN C;  5B2J A;  5FUG A;  5AY8 B;  3AZG D;  4Z2M H;  4H9O A;  3EPJ A;  1TZY D;  4H9N A;  3A6N B;  2FJ7 D;  4E44 A;  5E5A C;  4X23 C;  1P3G A;  1F1E A;  3AZE A;  5DNM A;  3C1C D;  3MVD D;  5CPJ B;  4KGC A;  3AYW C;  2RVQ C;  4YM6 A;  5G49 A;  3WKJ A;  2NZD D;  5GXQ C;  5B40 D;  4H9Q A;  4UUZ B;  5AV6 D;  3AN2 D;  3AFA B;  4AWL B;  4G91 C;  5B32 C;  5AY8 D;  3MGR A;  3UTB A;  3MGP B;  5B33 A;  2FFF B;  5AVC C;  1P3K A;  5AV5 D;  5GSU C;  3AZF B;  3W99 C;  4WU8 A;  3MGS C;  3AV2 C;  5BS7 A;  2F2A C;  2L5A A;  3AZJ B;  3REJ B;  2YFV A;  5CPJ D;  5AV9 A;  4Z2M G;  5B0Y A;  3KWQ A;  1P3F D;  5BNV B;  2ZY5 A;  3LZ0 B;  3AV1 C;  4J8V D;  2ARO B;  4XZQ B;  2HIO C;  3H0L C;  2PYO A;  3UT9 A;  3AZL C;  3TU4 C;  4QLC B;  5F99 D;  3KFU G;  3AFA D;  3AZH B;  2NQB A;  3MGP D;  4Z66 B;  2HUE C;  1M19 A;  1KX4 D;  4CSR A;  3AZI C;  3B0B A;  5JRG A;  3KUY B;  3NQJ A;  3W98 D;  3WTP D;  1N1J B;  4WNN B;  1P3G C;  3AZJ D;  3REJ D;  3AZE C;  5DNM C;  1P3A C;  4WV4 B;  3X1T B;  1S32 B;  5GT3 A;  2JSS A;  1EQZ B;  4KGC C;  1KX5 A;  3C1B D;  3WKJ C;  1U35 B;  1P3I B;  4XUJ A;  3REH A;  2F8N B;  3X1U D;  4KUD C;  3WAA D;  1HTA A;  4J8W B;  1P34 C;  3LEL A;  3MGR C;  1P3O A;  2DQN C;  3AZH D;  3UTB C;  3WA9 C;  1JFI A;  3REK C;  4Z66 D;  1P3K C;  5B24 B;  3AZK D;  1M18 B;  5B31 A;  4WU8 C;  3NQU B;  5BS7 C;  3KUY D;  2Y2H A;  5CP6 C;  3B6G B;  4M6B A;  1AOI A;  2BYK A;  3VH5 T;  3W96 D;  3EPL A;  1S32 D;  1EQZ D;  5AV9 C;  2Y2I A;  5B0Y C;  2G5I C;  3MGQ B;  2BYM A;  5CPK B;  5B1M D;  1U35 D;  2F8N D;  4EO5 B;  1P3A B;  4ZUX D;  3V9R B;  3UT9 C;  1P3B A;  1R4V A;  4J8U D;  4R8P C;  3B6F A;  4X23 A;  5B0Z A;  3AZM B;  2YFW A;  1KX3 B;  5B24 D;  2IO5 B;  1Q9C A;  3AYW A;  3REI B;  4WU9 D;  1F66 A;  5GXQ A;  3B6G D;  4H9S C;  3KSY A;  1P3L B;  5GT3 C;  3MGQ D;  5CPK D;  4JJN D;  1ID3 A;  5B32 A;  3REH C;  5B1L B;  3X1V C;  4Z5T A;  2FJ7 B;  2CV5 A;  3LEL C;  1P3O C;  3MNN B;  5E5A D;  3AZM D;  4CAY B;  4G92 B;  3R45 B;  3C1C B;  1BH8 A;  5B31 C;  3REI D;  2NZD B;  1WWI A;  3AV1 A;  2Y2Q A;  1P3M B;  4H9R B;  1AOI C;  2HIO A;  1BH9 A;  1WWS A;  2BG1 A;  3W97 A;  3O62 C;  5CPI B;  1P3L D;  3AZG A;  3AN2 B;  2RIQ A;  5B2J B;  5AVB C;  5FUG B;  3VH6 T;  1HQ3 B;  4H9O B;  4HGA B;  3AZN D;  1P3B C;  5B1L D;  5AV5 B;  3AZI A;  5GSU D;  5B32 G;  3W99 D;  5B2I C;  3MGS D;  3AV2 D;  3B6F C;  3MNN D;  5BNX A;  3VH5 W;  5B0Z C;  3UTA B;  1P3F B;  5BO0 A;  3EPH A;  4DRB A;  1P3P A;  1M1A A;  1F66 C;  4YM6 B;  4J8V B;  1P3M D;  5CPI D;  3KXB A;  5KDM A;  4KUD A;  4H9Q B;  2W8S A;  5F99 B;  1P34 A;  3TU4 D;  1ID3 C;  5B2J D;  3H0M C;  3A6N A;  3WA9 A;  1HQ3 D;  5CHL B;  3REK A;  5B33 B;  4NFT A;  1KX4 B;  4Z5T C;  3LJA C;  2CV5 C;  4YS3 C;  5CP6 A;  1KX3 C;  3W98 B;  3WTP B;  3F6T A;  5GT0 B;  1BFM A;  5CPJ A;  3AZE D;  5DNM D;  3UTA D;  5AV8 C;  3C1B B;  3A1K A;  2G5H C;  4KGC D;  4LD9 C;  4UUZ A;  3KWQ B;  4YM6 D;  5C3I C;  3W97 C;  5BT1 D;  3X1U B;  3WAA B;  2PYO B;  3AZG C;  1H3O B;  1A7W A;  1ZLA B;  3AL0 C;  1B67 A;  4R8P A;  1TZY C;  3AZF A;  3UTB D;  5B33 D;  3B0D C;  3AZK B;  1M19 B;  1P3K D;  5JRG B;  3REJ A;  4WU8 D;  1TAF B;  3MVD C;  4ZBJ B;  4H9S A;  3W96 B;  3VH5 A;  5GT0 D;  3REL B;  3IP4 C;  5BNV A;  2VQR A;  3LZ0 A;  2ARO A;  4XZQ A;  1M1A C;  1P3P C;  5B40 C;  1KX5 B;  5B1M B;  3KWQ D;  2Y2P A;  5AV6 C;  2XD1 A;  3KXB C;  4ZUX B;  4QLC A;  4J8X B;  3X1V A;  5AY8 C;  2PYO D;  3UT9 D;  2ZY4 A;  3LZ1 B;  4J8U B;  1ZLA D;  3A6N C;  2NQB D;  5JA4 A;  1M19 D;  1N1J A;  4WNN A;  5DNN B;  5JRG D;  4WU9 B;  4DQY B;  2F8N H;  3X1T A;  3REL D;  3O62 A;  5CPJ C;  1EQZ A;  1P3F C;  3H0R C;  1U35 A;  1P3I A;  2F8N A;  3X1S B;  1KX5 D;  4JJN B;  5AVB A;  2Y2N A;  4XUJ D;  4J8W A;  4WZS B;  3REH D;  3AFA C;  4AWL C;  4J8X D;  2UWX A;  3MGP C;  1Z2C B;  3LZ1 D;  5B2I A;  4H9P A;  5E5A B;  3LEL D;  1M18 A;  3AZF C;  3NQU A;  3B6G A;  3AZJ C;  5DNN D;  3REJ C;  1ULY A;  5GXQ B;  1AOI D;  5B31 G;  4DRA A;  3LZ0 C;  5CPK A;  2ARO C;  4XZQ C;  1P3A A;  3X1S D;  4G91 B;  4QLC C;  4KHA B;  3AZN B;  5AVC B;  3AZH C;  3LJA A;  1P3B D;  3AZM A;  5GSU B;  4YS3 A;  4Z66 C;  3W99 B;  3MGS B;  3AV2 B;  1KX3 A;  4X23 D;  3KUY C;  1BH8 B;  5AV8 A;  4LD9 A;  3AYW D;  2RVQ D;  3X1T C;  1S32 C;  1EQZ C;  5GXQ D;  1F66 D;  1U35 C;  1P3I C;  2ZY2 A;  3AZL B;  2CWE A;  3TU4 B;  1TZY A;  5B1L A;  1ID3 D;  5B32 D;  4J8W C;  2FJ7 A;  5AVC D;  2HUE B;  4H9N B;  4Z5T D;  3AZI B;  2CV5 D;  3C1C A;  5B24 C;  3MVD A;  1M18 C;  1B6W A;  5BNX B;  1P3G B;  2NZD A;  3AZE B;  1PZR A;  3WTP E;  5DNM B;  4NE3 A;  3B6G C;  4H9R A;  5B40 A;  4KGC B;  3WKJ B;  5G49 B;  5AV6 A;  3AV1 D;  3AN2 A;  2HIO D;  3MGQ C;  3W97 D;  5CPK C;  5KDM B;  5AY8 A;  4KUD B;  1HQ3 A;  4EO5 C;  1P34 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...