3B6GA

Nucleosome core particle treated with oxaliplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
b'GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gA00
2BYMA 3MGRD 5B1LA 3C1CD 5CHLB 5CPJC 5BT1D 3VH6A 1KX3B 3AZGD 3UT9B 4JJNB 4HGAB 3O62B 3UTBB 3AZIB 1P3KC 4G92C 3UT9D 5B33B 4WU8A 5JRGA 4AWLB 1M1AB 5CPIB 3O62D 3UTBD 3AZID 1F66B 1HQ3C 5B33D 3LZ1C 1M1AD 5B0ZB 2BYMB 5B1LB 5GT3D 4J8UD 1P3OC 3AFAD 5B2JB 5AV5A 3B0DC 2F8NA 4QLCC 2RVQC 2AROC 5B0ZD 3VH6W 1P34C 3W97C 5B2JD 3WAAA 3AV2A 1U35A 1ID3C 5JRGB 1KX5B 3RELC 1H3OA 3AZFA 4G92B 3AZHC 5JRGD 4XUJA 3AZLC 4H9OA 1KX5D 5BNXB 3LZ0C 4UUZB 1P3KD 4J8VA 5BO0A 5AVBA 2IO5C 5C3IC 3KWQA 3W96A 3UTAC 3R45A 3X1UC 5GT0C 3B6FC 1P3PA 3WAAB 3AV2B 1HQ3D 1U35B 3LZ1D 2AROB 5AV8A 1P3OD 3W97B 4XZQA 3WAAD 3AV2D 4NE5A 4QLCD 3AZFB 4LD9C 1ID3B 3W99A 2NQBA 2AROD 4CAYA 4XUJB 1P34D 3RELB 1BH9A 3W97D 5B31C 5GSUA 1AOIA 1P3AC 4R8PA 3AZFD 1JFIA 1ID3D 2F8NH 4J8VB 5AVBB 3REJC 3KWQB 5CPKA 1P3IA 3W96B 3RELD 3W98A 3R45B 3MNNB 4WZSB 5AVBD 1R4VA 3AZLD 3W96D 3UTAB 2NZDC 3B6FB 4H9QB 5AV8B 3MNND 1KX4C 3VH5T 4E44A 4XZQB 4G91C 3B0CW 4EO5C 1ZLAA 1P3GA 3W99B 2NQBB 4CAYB 4YM6C 3AN2C 3UTAD 3B6FD 5GT0D 3B6GC 1BH9B 3KXBA 2FJ7C 5GSUB 2CV5A 1AOIB 5AVCC 4LD9B 2JSSA 1JFIB 3W99D 2NQBD 5G49A 1P3IB 1B67A 3MGRA 3W98B 3C1CA 3X1TA 4LD9D 3AYWA 1P3BB 5E5AA 5B24C 5AV6C 5B0YA 5B32A 3MVDA 5B40C 1P3AD 4KHAB 3UT9A 1ZLAB 1P3GB 3AZJC 1P3BD 3UTBA 3AZIA 3KXBB 1BFMA 2CV5B 5B33A 4ZBJC 1P3GD 3MGRB 5GT3A 4J8UA 3C1CB 3KXBD 3AFAA 3X1TB 5AVCB 5B1MC 4J8WC 3AYWB 5B2IC 5B0ZA 3AN2D 3B6GD 5DNNC 5E5AB 5B2JA 4CSRA 5B0YB 5B32B 3X1TD 5AVCD 3MVDB 3AYWD 3AV1C 2HIOA 3NQJA 5JA4A 3REKC 5E5AD 5AV6B 3MVDD 5B0YD 5B32D 3TU4C 3B0BA 3WTPC 1KX5A 5B24D 2YFVA 5GT3B 4J8UB 5AV6D 3AFAB 3WKJC 1P3KA 1P3LB 3WA9C 1TAFA 2PYOC 1P3MC 5BNXA 1S32C 4UUZA 4CSRB 1P3LD 3AZNC 5GXQC 1HQ3A 4NE3A 3LZ1A 1WWIA 5AY8C 2HIOB 3NQJB 2HUEB 5JA4B 1P3OA 2BYKA 4H9SC 5CPJB 4J8WD 4QLCA 4Z66C 3AV1B 2AROA 5KDMB 2HIOD 5B2ID 1P34A 3V9RA 2YFVB 3W97A 5AV5C 5CPJD 3TU4B 3REIC 1P3KB 1ID3A 3AV1D 1TZYC 1TAFB 3RELA 4J8XC 2F8NK 3X1VC 3TU4D 3WKJB 3AZKC 3VH6T 1HQ3B 3AZHA 4ZUXC 3LZ1B 3AZLA 1P3MB 3C1BC 3MNNA 1P3OB 3LZ0A 2BYKB 3WKJD 3B0DB 4QLCB 2PYOD 4WU9C 1P34B 3UTAA 1P3MD 3B6FA 5GT0A 4H9QA 3V9RB 1B6WA 3AZND 5GXQD 4Z66B 3MGPC 2RVQD 5AY8D 4X23C 4H9RA 5BNVB 3REIB 5F99C 4Z66D 4LD9A 5CP6C 1TZYB 3LELC 3KUYC 3AZHB 4Z5TC 3AZLB 3LZ0B 3REID 5B32G 1P3AA 1TZYD 4ZUXB 3AZHD 3X1SC 2IO5B 5C3IB 3C1BB 1P3BA 3X1UB 5GT0B 4J8XD 3X1VD 3LZ0D 4KHAA 4R8PC 3REHC 4ZUXD 5DNMC 1A7WA 3C1BD 2NZDA 3X1UD 2CWEA 5AV9C 4H9RB 4YM6A 3AN2A 3B6GA 5BS7C 4YS3C 3MGSC 2FJ7A 5B31B 1N1JA 5AVCA 1P3AB 3KUYB 4X23D 1P3FC 3REJB 1EQZC 1F1EA 5B31D 5F99D 5CP6D 2YFWA 3KUYD 3REJD 1M19C 2NZDB 5B24A 5AV6A 1KX4B 5BT1C 4KUDC 4G91B 4KGCC 3MGQC 3REHB 4EO5B 3AZGC 3A6NC 4H9NA 1HTAA 4YM6B 3AZJA 3AN2B 2NZDD 3B6GB 1KX4D 2FJ7B 1ULYA 3REHD 1P3LA 1KX3C 1N1JB 3UT9C 3LJAC 4JJNC 5DNMD 4YM6D 4HGAC 3O62C 3AZIC 5AV9D 2FJ7D 4J8WA 1P3FB 2YFWB 4AWLC 5B2IA 1M1AC 5FUGA 5CPIC 5DNNA 3MGSD 5B24B 3AZMC 5B40B 5CPJA 1F66C 1M18C 3AV1A 1P3FD 3AZEC 4H9NB 5KDMA 5B0ZC 4M6BA 3AZJB 5B1LC 5B40D 3TU4A 4KUDB 3NQUA 4ZBJB 3WTPA 1M19D 3AZJD 1BH8B 4KUDD 4KGCD 3MGQD 3WKJA 1WWSA 5B1MB 4J8WB 3A6ND 3WA9A 3LJAB 4WU8C 5JRGC 2PYOA 5B2IB 5FUGB 1P3MA 1KX5C 1S32A 5DNNB 1KX3D 3AZNA 5GXQA 5B1MD 3LJAD 5AY8A 4JJND 3REKB 5DNND 4H9SA 3AZMB 3NQUB 4Z66A 1M18B 3AZEB 4H9PA 4Z2MG 5CPID 3WTPB 3REKD 3AZMD 5B31G 3WAAC 3REIA 5BNVA 3AV2C 1F66D 1U35C 1M18D 3WA9B 1TZYA 3AZED 2PYOB 3WTPD 5B1LD 1S32B 1KU5A 4J8XA 4NE6A 3X1VA 3AZKA 3AZFC 3AZNB 5GXQB 3WA9D 4WU8B 4ZUXA 4XUJC 5AY8B 3C1BA 1S32D 3X1UA 3VH5A 4J8VC 4WU8D 2LY8A 5AVBC 3KWQC 4H9PB 3W96C 4WU9A 3MNNC 5AV5B 1P3PC 2F8NB 4WNNA 3MGPA 4X23A 5AV8C 2L5AA 4XZQC 5B31A 5AV5D 4J8XB 3X1VB 5F99A 3WTPE 3AZKB 2F8ND 5CP6A 3LELA 3KUYA 3W99C 2NQBC 3REJA 4Z5TA 1H3OB 5GSUC 1AOIC 3AZKD 3KSYA 1U35D 3VH5W 3X1SA 5CPKC 1P3IC 4H9OB 4WU9B 3W98C 1KX4A 3REHA 4WNNB 5BO0B 3MGPB 4XUJD 4X23B 5DNMA 4WU9D 1P3BC 5AV9A 1P3PB 5F99B 4J8VD 3MGPD 5CP6B 4DRBA 1ZLAC 3KWQD 3LELB 1P3GC 4DRAA 4Z5TB 3B0CT 5BS7A 3MGSA 4YS3A 3KXBC 1P3PD 2CV5C 4WV4B 1P3FA 3LELD 3X1SB 4NFTA 4Z5TD 3MGRC 1EQZA 5AV8D 3C1CC 4XZQD 5B40A 3X1TC 4R8PB 3AYWC 3X1SD 5CPKB 4Z2MH 5DNMB 1M19A 5E5AC 5AV9B 5GSUD 5B0YC 5B32C 3MVDC 1AOID 3MGQA 4R8PD 4KUDA 4KGCA 3AZGA 3A6NA 5CPKD 1P3ID 1Q9CA 3W98D 3MGSB 3UTBC 1BH8A 4YS3B 1KX3A 5B1MA 3LJAA 5B33C 4JJNA 3O62A 1EQZB 5GT3C 4YS3D 4J8UC 3AFAC 1P3LC 1ZLAD 1M1AA 5G49B 5CPIA 1M19B 3REKA 1EQZD 3AZMA 5B2JC 2CV5D 1F66A 4KGCB 3MGQB 2F8NG 1M18A 3AZGB 4E45A 3A6NB 3AZEA 2HIOC 2HUEC
chains in the Genus database with same CATH superfamily
2BYMA 3MGRD 5B1LA 3C1CD 5CHLB 5CPJC 5BT1D 3VH6A 1KX3B 3AZGD 3UT9B 4JJNB 4HGAB 3O62B 3UTBB 3AZIB 1P3KC 2W8SA 4G92C 3UT9D 5B33B 4WU8A 5JRGA 4AWLB 1M1AB 5CPIB 3O62D 3UTBD 3AZID 1F66B 1HQ3C 5B33D 3LZ1C 1M1AD 5B0ZB 2BYMB 2HUEC 5B1LB 5GT3D 4J8UD 1P3OC 3AFAD 5B2JB 5AV5A 3B0DC 2F8NA 4QLCC 2RVQC 2AROC 5B0ZD 3VH6W 1P34C 3W97C 5B2JD 3WAAA 3AV2A 1U35A 1ID3C 5JRGB 2G5HC 1KX5B 3RELC 1H3OA 3AZFA 4G92B 2F2AC 3AZHC 5JRGD 4XUJA 3AZLC 4H9OA 1KX5D 5BNXB 2Y2KA 3LZ0C 4UUZB 1P3KD 4J8VA 5BO0A 2Y2JA 2IO5C 5C3IC 5AVBA 3KWQA 3W96A 3UTAC 3R45A 3X1UC 5GT0C 3B6FC 2DQNC 1P3PA 2Y2PA 3WAAB 3F6TA 3AV2B 1HQ3D 3A1KA 1U35B 3LZ1D 2AROB 5AV8A 1P3OD 3W97B 4XZQA 3WAAD 3AV2D 2BG1A 4NE5A 4QLCD 3AZFB 4LD9C 1ID3B 3W99A 2NQBA 2AROD 2Y2LA 4CAYA 4XUJB 1P34D 3RELB 1BH9A 3W97D 5B31C 5GSUA 1AOIA 1P3AC 4R8PA 3AZFD 1JFIA 1ID3D 2F8NH 4J8VB 2Y2OA 5AVBB 3REJC 3KWQB 5CPKA 1P3IA 3W96B 3RELD 3W98A 3R45B 3MNNB 4WZSB 5AVBD 1R4VA 3AZLD 3W96D 3UTAB 2NZDC 3B6FB 4H9QB 5AV8B 3MNND 1KX4C 3VH5T 4E44A 4XZQB 4G91C 3B0CW 4EO5C 1ZLAA 1P3GA 3W99B 2NQBB 4CAYB 4YM6C 3AN2C 3UTAD 3B6FD 5GT0D 3B6GC 1BH9B 3KXBA 2FJ7C 5GSUB 2CV5A 1AOIB 5AVCC 4LD9B 2JSSA 1JFIB 3W99D 2NQBD 5G49A 1P3IB 1B67A 3MGRA 3W98B 3C1CA 3X1TA 4LD9D 3AYWA 1P3BB 5E5AA 5B24C 5AV6C 5B0YA 5B32A 3MVDA 5B40C 1P3AD 4KHAB 3UT9A 1ZLAB 1P3GB 3AZJC 1P3BD 3UTBA 3AZIA 3KXBB 1BFMA 2CV5B 5B33A 4ZBJC 1P3GD 3MGRB 5GT3A 4J8UA 3C1CB 3KXBD 3AFAA 3X1TB 5AVCB 5B1MC 4J8WC 3AYWB 3EPHA 5B2IC 5B0ZA 3AN2D 3B6GD 3EPJA 5DNNC 5E5AB 5B2JA 4CSRA 5B0YB 5B32B 3X1TD 5AVCD 3MVDB 4UPKA 3AYWD 3AV1C 2HIOA 3NQJA 5JA4A 3REKC 5E5AD 4DQYB 5AV6B 3MVDD 5B0YD 5B32D 3TU4C 3B0BA 3WTPC 1KX5A 5B24D 2YFVA 5GT3B 4J8UB 5AV6D 2ZM5A 3AFAB 3WKJC 1P3KA 1P3LB 3WA9C 1TAFA 2PYOC 1P3MC 5BNXA 1S32C 3EG5B 4UUZA 4CSRB 1P3LD 3AZNC 2DF4C 5GXQC 1HQ3A 4NE3A 2XD5A 3LZ1A 1WWIA 5AY8C 2HIOB 3NQJB 2HUEB 5JA4B 1P3OA 2BYKA 4H9SC 5CPJB 4J8WD 4QLCA 2RIQA 2J8PA 2Y2QA 4Z66C 3AV1B 2ZY4A 2AROA 5KDMB 2HIOD 5B2ID 1P34A 3V9RA 2YFVB 3W97A 5AV5C 5CPJD 3TU4B 3REIC 1P3KB 1ID3A 3AV1D 1TZYC 1TAFB 3RELA 4J8XC 2F8NK 3X1VC 3TU4D 3WKJB 3AZKC 3VH6T 1Z2CB 2Y2GA 1HQ3B 3AZHA 4ZUXC 3LZ1B 3AZLA 1P3MB 3C1BC 3MNNA 1P3OB 3LZ0A 2BYKB 3WKJD 3B0DB 4QLCB 2PYOD 4WU9C 1P34B 3UTAA 1P3MD 3B6FA 5GT0A 4H9QA 3V9RB 1B6WA 3AZND 5GXQD 2Y2MA 4Z66B 3MGPC 2RVQD 5AY8D 4X23C 3H0RC 3EPLA 4H9RA 5BNVB 3REIB 5F99C 4Z66D 4LD9A 5CP6C 1TZYB 3LELC 3KUYC 3AZHB 2G5IC 4Z5TC 3AZLB 3LZ0B 3REID 5B32G 1P3AA 1TZYD 4ZUXB 3AZHD 3X1SC 2IO5B 5C3IB 3C1BB 1P3BA 3X1UB 5GT0B 4J8XD 3X1VD 3LZ0D 4KHAA 4R8PC 3REHC 3FDDA 4ZUXD 5DNMC 1A7WA 3C1BD 2NZDA 3X1UD 2CWEA 5AV9C 4H9RB 4YM6A 3AN2A 3B6GA 5BS7C 4YS3C 3MGSC 2FJ7A 5B31B 1N1JA 5AVCA 1P3AB 3KUYB 4X23D 3EPKA 1P3FC 3REJB 1EQZC 1F1EA 5B31D 5F99D 5CP6D 2YFWA 3KUYD 3REJD 1M19C 2NZDB 5B24A 5AV6A 1KX4B 5BT1C 4KUDC 4G91B 4KGCC 3MGQC 3REHB 4EO5B 3AZGC 3A6NC 2JE5A 4H9NA 1HTAA 4YM6B 3AZJA 3AN2B 2NZDD 3B6GB 1KX4D 2FJ7B 1ULYA 3REHD 1P3LA 1KX3C 1N1JB 3UT9C 3LJAC 4JJNC 5DNMD 4YM6D 4HGAC 3O62C 3AZIC 5AV9D 2FJ7D 4J8WA 1P3FB 2YFWB 4AWLC 5B2IA 1M1AC 5FUGA 5CPIC 3AL0C 5DNNA 3MGSD 5B24B 3AZMC 5B40B 5CPJA 1F66C 1M18C 3AV1A 1P3FD 3AZEC 4H9NB 5KDMA 5B0ZC 4M6BA 3AZJB 5B1LC 5B40D 3TU4A 4KUDB 3NQUA 4ZBJB 3WTPA 1M19D 3AZJD 1BH8B 2Y2IA 4KUDD 4KGCD 3MGQD 3WKJA 1WWSA 5B1MB 4J8WB 3A6ND 3WA9A 3LJAB 4WU8C 5JRGC 2PYOA 5B2IB 3IP4C 5FUGB 1P3MA 1S32A 1KX5C 5DNNB 1KX3D 3AZNA 5GXQA 5B1MD 3LJAD 2ZY2A 5AY8A 4JJND 2XD1A 3REKB 5DNND 4H9SA 3AZMB 3NQUB 4Z66A 2Y2NA 1M18B 3AZEB 4H9PA 4Z2MG 5CPID 2Y2HA 3WTPB 3REKD 3AZMD 5B31G 4WJ3C 3WAAC 3REIA 5BNVA 3AV2C 3P5JB 1F66D 1U35C 1M18D 3WA9B 1TZYA 3AZED 2PYOB 3WTPD 5B1LD 1S32B 1KU5A 4J8XA 4NE6A 3X1VA 3AZKA 3AZFC 3AZNB 5GXQB 3WA9D 4WU8B 4ZUXA 4XUJC 5AY8B 3C1BA 1S32D 3X1UA 3VH5A 2JCHA 4J8VC 4WU8D 2LY8A 5AVBC 3KWQC 4H9PB 3W96C 4WU9A 3MNNC 5AV5B 1P3PC 2F8NB 4WNNA 3MGPA 3KFUG 4X23A 2ZY5A 5AV8C 2L5AA 4XZQC 5B31A 5AV5D 4J8XB 3X1VB 5F99A 3WTPE 3AZKB 2F8ND 5CP6A 3LELA 3KUYA 3W99C 2NQBC 3REJA 4Z5TA 1H3OB 5GSUC 1AOIC 3AZKD 3KSYA 1U35D 3VH5W 3X1SA 5CPKC 1P3IC 4H9OB 4WU9B 3W98C 2FFFB 1KX4A 3REHA 4WNNB 5BO0B 3MGPB 4XUJD 4X23B 5DNMA 4WU9D 3H0LC 1P3BC 1PZRA 5AV9A 1P3PB 5F99B 4J8VD 3MGPD 5CP6B 4DRBA 1ZLAC 3KWQD 3LELB 1P3GC 1T3UA 4DRAA 4Z5TB 3B0CT 5BS7A 3MGSA 4YS3A 3KXBC 1P3PD 3H0MC 2CV5C 4WV4B 1W2EA 1P3FA 3LELD 3X1SB 4NFTA 4Z5TD 3MGRC 1EQZA 5AV8D 3C1CC 4XZQD 5B40A 3X1TC 4R8PB 3AYWC 3X1SD 5CPKB 4Z2MH 5DNMB 1M19A 2VQRA 5E5AC 5AV9B 5GSUD 5B0YC 5B32C 3MVDC 1AOID 3MGQA 4R8PD 4KUDA 4KGCA 3AZGA 3A6NA 5CPKD 1P3ID 1Q9CA 3W98D 3MGSB 3UTBC 1BH8A 4YS3B 1KX3A 5B1MA 3LJAA 5B33C 3A1IA 4JJNA 3O62A 1EQZB 5GT3C 4YS3D 4J8UC 3AFAC 1P3LC 1ZLAD 1M1AA 5G49B 5CPIA 1M19B 3REKA 1EQZD 3AZMA 5B2JC 2CV5D 1F66A 4KGCB 3MGQB 2F8NG 1M18A 3AZGB 4E45A 3A6NB 3AZEA 2UWXA 2HIOC 2ZY3A
chains in the Genus database with same CATH topology
2BYMA 3MGRD 5B1LA 3C1CD 5CHLB 5CPJC 5BT1D 3VH6A 1KX3B 3AZGD 3UT9B 4JJNB 4HGAB 3O62B 3UTBB 3AZIB 1P3KC 2W8SA 4G92C 3UT9D 5B33B 4WU8A 5JRGA 4AWLB 1M1AB 5CPIB 3O62D 3UTBD 3AZID 1F66B 1HQ3C 5B33D 3LZ1C 1M1AD 5B0ZB 2BYMB 2HUEC 5B1LB 5GT3D 4J8UD 1P3OC 3AFAD 5B2JB 5AV5A 3B0DC 2F8NA 4QLCC 2RVQC 2AROC 5B0ZD 3VH6W 1P34C 3W97C 5B2JD 3WAAA 3AV2A 1U35A 1ID3C 5JRGB 2G5HC 1KX5B 3RELC 1H3OA 3AZFA 4G92B 2F2AC 3AZHC 5JRGD 4XUJA 3AZLC 4H9OA 1KX5D 5BNXB 2Y2KA 3LZ0C 4UUZB 1P3KD 4J8VA 5BO0A 2Y2JA 2IO5C 5C3IC 5AVBA 3KWQA 3W96A 3UTAC 3R45A 3X1UC 5GT0C 3B6FC 2DQNC 1P3PA 2Y2PA 3WAAB 3F6TA 3AV2B 1HQ3D 3A1KA 1U35B 3LZ1D 2AROB 5AV8A 1P3OD 3W97B 4XZQA 3WAAD 3AV2D 2BG1A 4NE5A 4QLCD 3AZFB 4LD9C 1ID3B 3W99A 2NQBA 2AROD 2Y2LA 4CAYA 4XUJB 1P34D 3RELB 1BH9A 3W97D 5B31C 5GSUA 1AOIA 1P3AC 4R8PA 3AZFD 1JFIA 1ID3D 2F8NH 4J8VB 2Y2OA 5AVBB 3REJC 3KWQB 5CPKA 1P3IA 3W96B 3RELD 3W98A 3R45B 3MNNB 4WZSB 5AVBD 1R4VA 3AZLD 3W96D 3UTAB 2NZDC 3B6FB 4H9QB 5AV8B 3MNND 1KX4C 3VH5T 4E44A 4XZQB 4G91C 3B0CW 4EO5C 1ZLAA 1P3GA 3W99B 2NQBB 4CAYB 4YM6C 3AN2C 3UTAD 3B6FD 5GT0D 3B6GC 1BH9B 3KXBA 2FJ7C 5GSUB 2CV5A 1AOIB 5AVCC 4LD9B 2JSSA 1JFIB 3W99D 2NQBD 5G49A 1P3IB 1B67A 3MGRA 3W98B 3C1CA 3X1TA 4LD9D 3AYWA 1P3BB 5E5AA 5B24C 5AV6C 5B0YA 5B32A 3MVDA 5B40C 1P3AD 4KHAB 3UT9A 1ZLAB 1P3GB 3AZJC 1P3BD 3UTBA 3AZIA 3KXBB 1BFMA 2CV5B 5B33A 4ZBJC 1P3GD 3MGRB 5GT3A 4J8UA 3C1CB 3KXBD 3AFAA 3X1TB 5AVCB 5B1MC 4J8WC 3AYWB 3EPHA 5B2IC 5B0ZA 3AN2D 3B6GD 3EPJA 5DNNC 5E5AB 5B2JA 4CSRA 5B0YB 5B32B 3X1TD 5AVCD 3MVDB 4UPKA 3AYWD 3AV1C 2HIOA 3NQJA 5JA4A 3REKC 5E5AD 4DQYB 5AV6B 3MVDD 5B0YD 5B32D 3TU4C 3B0BA 3WTPC 1KX5A 5B24D 2YFVA 5GT3B 4J8UB 5AV6D 2ZM5A 3AFAB 3WKJC 1P3KA 1P3LB 3WA9C 1TAFA 2PYOC 1P3MC 5BNXA 1S32C 3EG5B 4UUZA 4CSRB 1P3LD 3AZNC 2DF4C 5GXQC 1HQ3A 4NE3A 2XD5A 3LZ1A 1WWIA 5AY8C 2HIOB 3NQJB 2HUEB 5JA4B 1P3OA 2BYKA 4H9SC 5CPJB 4J8WD 4QLCA 2RIQA 2J8PA 2Y2QA 4Z66C 3AV1B 2ZY4A 2AROA 5KDMB 2HIOD 5B2ID 1P34A 3V9RA 2YFVB 3W97A 5AV5C 5CPJD 3TU4B 3REIC 1P3KB 1ID3A 3AV1D 1TZYC 1TAFB 3RELA 4J8XC 2F8NK 3X1VC 3TU4D 3WKJB 3AZKC 3VH6T 1Z2CB 2Y2GA 1HQ3B 3AZHA 4ZUXC 3LZ1B 3AZLA 1P3MB 3C1BC 3MNNA 1P3OB 3LZ0A 2BYKB 3WKJD 3B0DB 4QLCB 2PYOD 4WU9C 1P34B 3UTAA 1P3MD 3B6FA 5GT0A 4H9QA 3V9RB 1B6WA 3AZND 5GXQD 2Y2MA 4Z66B 3MGPC 2RVQD 5AY8D 4X23C 3H0RC 3EPLA 4H9RA 5BNVB 3REIB 5F99C 4Z66D 4LD9A 5CP6C 1TZYB 3LELC 3KUYC 3AZHB 2G5IC 4Z5TC 3AZLB 3LZ0B 3REID 5B32G 1P3AA 1TZYD 4ZUXB 3AZHD 3X1SC 2IO5B 5C3IB 3C1BB 1P3BA 3X1UB 5GT0B 4J8XD 3X1VD 3LZ0D 4KHAA 4R8PC 3REHC 3FDDA 4ZUXD 5DNMC 1A7WA 3C1BD 2NZDA 3X1UD 2CWEA 5AV9C 4H9RB 4YM6A 3AN2A 3B6GA 5BS7C 4YS3C 3MGSC 2FJ7A 5B31B 1N1JA 5AVCA 1P3AB 3KUYB 4X23D 3EPKA 1P3FC 3REJB 1EQZC 1F1EA 5B31D 5F99D 5CP6D 2YFWA 3KUYD 3REJD 1M19C 2NZDB 5B24A 5AV6A 1KX4B 5BT1C 4KUDC 4G91B 4KGCC 3MGQC 3REHB 4EO5B 3AZGC 3A6NC 2JE5A 4H9NA 1HTAA 4YM6B 3AZJA 3AN2B 2NZDD 3B6GB 1KX4D 2FJ7B 1ULYA 3REHD 1P3LA 1KX3C 1N1JB 3UT9C 3LJAC 4JJNC 5DNMD 4YM6D 4HGAC 3O62C 3AZIC 5AV9D 2FJ7D 4J8WA 1P3FB 2YFWB 4AWLC 5B2IA 1M1AC 5FUGA 5CPIC 3AL0C 5DNNA 3MGSD 5B24B 3AZMC 5B40B 5CPJA 1F66C 1M18C 3AV1A 1P3FD 3AZEC 4H9NB 5KDMA 5B0ZC 4M6BA 3AZJB 5B1LC 5B40D 3TU4A 4KUDB 3NQUA 4ZBJB 3WTPA 1M19D 3AZJD 1BH8B 2Y2IA 4KUDD 4KGCD 3MGQD 3WKJA 1WWSA 5B1MB 4J8WB 3A6ND 3WA9A 3LJAB 4WU8C 5JRGC 2PYOA 5B2IB 3IP4C 5FUGB 1P3MA 1S32A 1KX5C 5DNNB 1KX3D 3AZNA 5GXQA 5B1MD 3LJAD 2ZY2A 5AY8A 4JJND 2XD1A 3REKB 5DNND 4H9SA 3AZMB 3NQUB 4Z66A 2Y2NA 1M18B 3AZEB 4H9PA 4Z2MG 5CPID 2Y2HA 3WTPB 3REKD 3AZMD 5B31G 4WJ3C 3WAAC 3REIA 5BNVA 3AV2C 3P5JB 1F66D 1U35C 1M18D 3WA9B 1TZYA 3AZED 2PYOB 3WTPD 5B1LD 1S32B 1KU5A 4J8XA 4NE6A 3X1VA 3AZKA 3AZFC 3AZNB 5GXQB 3WA9D 4WU8B 4ZUXA 4XUJC 5AY8B 3C1BA 1S32D 3X1UA 3VH5A 2JCHA 4J8VC 4WU8D 2LY8A 5AVBC 3KWQC 4H9PB 3W96C 4WU9A 3MNNC 5AV5B 1P3PC 2F8NB 4WNNA 3MGPA 3KFUG 4X23A 2ZY5A 5AV8C 2L5AA 4XZQC 5B31A 5AV5D 4J8XB 3X1VB 5F99A 3WTPE 3AZKB 2F8ND 5CP6A 3LELA 3KUYA 3W99C 2NQBC 3REJA 4Z5TA 1H3OB 5GSUC 1AOIC 3AZKD 3KSYA 1U35D 3VH5W 3X1SA 5CPKC 1P3IC 4H9OB 4WU9B 3W98C 2FFFB 1KX4A 3REHA 4WNNB 5BO0B 3MGPB 4XUJD 4X23B 5DNMA 4WU9D 3H0LC 1P3BC 1PZRA 5AV9A 1P3PB 5F99B 4J8VD 3MGPD 5CP6B 4DRBA 1ZLAC 3KWQD 3LELB 1P3GC 1T3UA 4DRAA 4Z5TB 3B0CT 5BS7A 3MGSA 4YS3A 3KXBC 1P3PD 3H0MC 2CV5C 4WV4B 1W2EA 1P3FA 3LELD 3X1SB 4NFTA 4Z5TD 3MGRC 1EQZA 5AV8D 3C1CC 4XZQD 5B40A 3X1TC 4R8PB 3AYWC 3X1SD 5CPKB 4Z2MH 5DNMB 1M19A 2VQRA 5E5AC 5AV9B 5GSUD 5B0YC 5B32C 3MVDC 1AOID 3MGQA 4R8PD 4KUDA 4KGCA 3AZGA 3A6NA 5CPKD 1P3ID 1Q9CA 3W98D 3MGSB 3UTBC 1BH8A 4YS3B 1KX3A 5B1MA 3LJAA 5B33C 3A1IA 4JJNA 3O62A 1EQZB 5GT3C 4YS3D 4J8UC 3AFAC 1P3LC 1ZLAD 1M1AA 5G49B 5CPIA 1M19B 3REKA 1EQZD 3AZMA 5B2JC 2CV5D 1F66A 4KGCB 3MGQB 2F8NG 1M18A 3AZGB 4E45A 3A6NB 3AZEA 2UWXA 2HIOC 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYM A;  3MGR D;  5B1L A;  3C1C D;  5CHL B;  5CPJ C;  5BT1 D;  3VH6 A;  1KX3 B;  3AZG D;  3UT9 B;  4JJN B;  4HGA B;  3O62 B;  3UTB B;  3AZI B;  1P3K C;  4G92 C;  3UT9 D;  5B33 B;  4WU8 A;  5JRG A;  4AWL B;  1M1A B;  5CPI B;  3O62 D;  3UTB D;  3AZI D;  1F66 B;  1HQ3 C;  5B33 D;  3LZ1 C;  1M1A D;  5B0Z B;  2BYM B;  5B1L B;  5GT3 D;  4J8U D;  1P3O C;  3AFA D;  5B2J B;  5AV5 A;  3B0D C;  2F8N A;  4QLC C;  2RVQ C;  2ARO C;  5B0Z D;  3VH6 W;  1P34 C;  3W97 C;  5B2J D;  3WAA A;  3AV2 A;  1U35 A;  1ID3 C;  5JRG B;  1KX5 B;  3REL C;  1H3O A;  3AZF A;  4G92 B;  3AZH C;  5JRG D;  4XUJ A;  3AZL C;  4H9O A;  1KX5 D;  5BNX B;  3LZ0 C;  4UUZ B;  1P3K D;  4J8V A;  5BO0 A;  5AVB A;  2IO5 C;  5C3I C;  3KWQ A;  3W96 A;  3UTA C;  3R45 A;  3X1U C;  5GT0 C;  3B6F C;  1P3P A;  3WAA B;  3AV2 B;  1HQ3 D;  1U35 B;  3LZ1 D;  2ARO B;  5AV8 A;  1P3O D;  3W97 B;  4XZQ A;  3WAA D;  3AV2 D;  4NE5 A;  4QLC D;  3AZF B;  4LD9 C;  1ID3 B;  3W99 A;  2NQB A;  2ARO D;  4CAY A;  4XUJ B;  1P34 D;  3REL B;  1BH9 A;  3W97 D;  5B31 C;  5GSU A;  1AOI A;  1P3A C;  4R8P A;  3AZF D;  1JFI A;  1ID3 D;  2F8N H;  4J8V B;  5AVB B;  3REJ C;  3KWQ B;  5CPK A;  1P3I A;  3W96 B;  3REL D;  3W98 A;  3R45 B;  3MNN B;  4WZS B;  5AVB D;  1R4V A;  3AZL D;  3W96 D;  3UTA B;  2NZD C;  3B6F B;  4H9Q B;  5AV8 B;  3MNN D;  1KX4 C;  3VH5 T;  4E44 A;  4XZQ B;  4G91 C;  3B0C W;  4EO5 C;  1ZLA A;  1P3G A;  3W99 B;  2NQB B;  4CAY B;  4YM6 C;  3AN2 C;  3UTA D;  3B6F D;  5GT0 D;  3B6G C;  1BH9 B;  3KXB A;  2FJ7 C;  5GSU B;  2CV5 A;  1AOI B;  5AVC C;  4LD9 B;  2JSS A;  1JFI B;  3W99 D;  2NQB D;  5G49 A;  1P3I B;  1B67 A;  3MGR A;  3W98 B;  3C1C A;  3X1T A;  4LD9 D;  3AYW A;  1P3B B;  5E5A A;  5B24 C;  5AV6 C;  5B0Y A;  5B32 A;  3MVD A;  5B40 C;  1P3A D;  4KHA B;  3UT9 A;  1ZLA B;  1P3G B;  3AZJ C;  1P3B D;  3UTB A;  3AZI A;  3KXB B;  1BFM A;  2CV5 B;  5B33 A;  4ZBJ C;  1P3G D;  3MGR B;  5GT3 A;  4J8U A;  3C1C B;  3KXB D;  3AFA A;  3X1T B;  5AVC B;  5B1M C;  4J8W C;  3AYW B;  5B2I C;  5B0Z A;  3AN2 D;  3B6G D;  5DNN C;  5E5A B;  5B2J A;  4CSR A;  5B0Y B;  5B32 B;  3X1T D;  5AVC D;  3MVD B;  3AYW D;  3AV1 C;  2HIO A;  3NQJ A;  5JA4 A;  3REK C;  5E5A D;  5AV6 B;  3MVD D;  5B0Y D;  5B32 D;  3TU4 C;  3B0B A;  3WTP C;  1KX5 A;  5B24 D;  2YFV A;  5GT3 B;  4J8U B;  5AV6 D;  3AFA B;  3WKJ C;  1P3K A;  1P3L B;  3WA9 C;  1TAF A;  2PYO C;  1P3M C;  5BNX A;  1S32 C;  4UUZ A;  4CSR B;  1P3L D;  3AZN C;  5GXQ C;  1HQ3 A;  4NE3 A;  3LZ1 A;  1WWI A;  5AY8 C;  2HIO B;  3NQJ B;  2HUE B;  5JA4 B;  1P3O A;  2BYK A;  4H9S C;  5CPJ B;  4J8W D;  4QLC A;  4Z66 C;  3AV1 B;  2ARO A;  5KDM B;  2HIO D;  5B2I D;  1P34 A;  3V9R A;  2YFV B;  3W97 A;  5AV5 C;  5CPJ D;  3TU4 B;  3REI C;  1P3K B;  1ID3 A;  3AV1 D;  1TZY C;  1TAF B;  3REL A;  4J8X C;  2F8N K;  3X1V C;  3TU4 D;  3WKJ B;  3AZK C;  3VH6 T;  1HQ3 B;  3AZH A;  4ZUX C;  3LZ1 B;  3AZL A;  1P3M B;  3C1B C;  3MNN A;  1P3O B;  3LZ0 A;  2BYK B;  3WKJ D;  3B0D B;  4QLC B;  2PYO D;  4WU9 C;  1P34 B;  3UTA A;  1P3M D;  3B6F A;  5GT0 A;  4H9Q A;  3V9R B;  1B6W A;  3AZN D;  5GXQ D;  4Z66 B;  3MGP C;  2RVQ D;  5AY8 D;  4X23 C;  4H9R A;  5BNV B;  3REI B;  5F99 C;  4Z66 D;  4LD9 A;  5CP6 C;  1TZY B;  3LEL C;  3KUY C;  3AZH B;  4Z5T C;  3AZL B;  3LZ0 B;  3REI D;  5B32 G;  1P3A A;  1TZY D;  4ZUX B;  3AZH D;  3X1S C;  2IO5 B;  5C3I B;  3C1B B;  1P3B A;  3X1U B;  5GT0 B;  4J8X D;  3X1V D;  3LZ0 D;  4KHA A;  4R8P C;  3REH C;  4ZUX D;  5DNM C;  1A7W A;  3C1B D;  2NZD A;  3X1U D;  2CWE A;  5AV9 C;  4H9R B;  4YM6 A;  3AN2 A;  3B6G A;  5BS7 C;  4YS3 C;  3MGS C;  2FJ7 A;  5B31 B;  1N1J A;  5AVC A;  1P3A B;  3KUY B;  4X23 D;  1P3F C;  3REJ B;  1EQZ C;  1F1E A;  5B31 D;  5F99 D;  5CP6 D;  2YFW A;  3KUY D;  3REJ D;  1M19 C;  2NZD B;  5B24 A;  5AV6 A;  1KX4 B;  5BT1 C;  4KUD C;  4G91 B;  4KGC C;  3MGQ C;  3REH B;  4EO5 B;  3AZG C;  3A6N C;  4H9N A;  1HTA A;  4YM6 B;  3AZJ A;  3AN2 B;  2NZD D;  3B6G B;  1KX4 D;  2FJ7 B;  1ULY A;  3REH D;  1P3L A;  1KX3 C;  1N1J B;  3UT9 C;  3LJA C;  4JJN C;  5DNM D;  4YM6 D;  4HGA C;  3O62 C;  3AZI C;  5AV9 D;  2FJ7 D;  4J8W A;  1P3F B;  2YFW B;  4AWL C;  5B2I A;  1M1A C;  5FUG A;  5CPI C;  5DNN A;  3MGS D;  5B24 B;  3AZM C;  5B40 B;  5CPJ A;  1F66 C;  1M18 C;  3AV1 A;  1P3F D;  3AZE C;  4H9N B;  5KDM A;  5B0Z C;  4M6B A;  3AZJ B;  5B1L C;  5B40 D;  3TU4 A;  4KUD B;  3NQU A;  4ZBJ B;  3WTP A;  1M19 D;  3AZJ D;  1BH8 B;  4KUD D;  4KGC D;  3MGQ D;  3WKJ A;  1WWS A;  5B1M B;  4J8W B;  3A6N D;  3WA9 A;  3LJA B;  4WU8 C;  5JRG C;  2PYO A;  5B2I B;  5FUG B;  1P3M A;  1KX5 C;  1S32 A;  5DNN B;  1KX3 D;  3AZN A;  5GXQ A;  5B1M D;  3LJA D;  5AY8 A;  4JJN D;  3REK B;  5DNN D;  4H9S A;  3AZM B;  3NQU B;  4Z66 A;  1M18 B;  3AZE B;  4H9P A;  4Z2M G;  5CPI D;  3WTP B;  3REK D;  3AZM D;  5B31 G;  3WAA C;  3REI A;  5BNV A;  3AV2 C;  1F66 D;  1U35 C;  1M18 D;  3WA9 B;  1TZY A;  3AZE D;  2PYO B;  3WTP D;  5B1L D;  1S32 B;  1KU5 A;  4J8X A;  4NE6 A;  3X1V A;  3AZK A;  3AZF C;  3AZN B;  5GXQ B;  3WA9 D;  4WU8 B;  4ZUX A;  4XUJ C;  5AY8 B;  3C1B A;  1S32 D;  3X1U A;  3VH5 A;  4J8V C;  4WU8 D;  2LY8 A;  5AVB C;  3KWQ C;  4H9P B;  3W96 C;  4WU9 A;  3MNN C;  5AV5 B;  1P3P C;  2F8N B;  4WNN A;  3MGP A;  4X23 A;  5AV8 C;  2L5A A;  4XZQ C;  5B31 A;  5AV5 D;  4J8X B;  3X1V B;  5F99 A;  3WTP E;  3AZK B;  2F8N D;  5CP6 A;  3LEL A;  3KUY A;  3W99 C;  2NQB C;  3REJ A;  4Z5T A;  1H3O B;  5GSU C;  1AOI C;  3AZK D;  3KSY A;  1U35 D;  3VH5 W;  3X1S A;  5CPK C;  1P3I C;  4H9O B;  4WU9 B;  3W98 C;  1KX4 A;  3REH A;  4WNN B;  5BO0 B;  3MGP B;  4XUJ D;  4X23 B;  5DNM A;  4WU9 D;  1P3B C;  5AV9 A;  1P3P B;  5F99 B;  4J8V D;  3MGP D;  5CP6 B;  4DRB A;  1ZLA C;  3KWQ D;  3LEL B;  1P3G C;  4DRA A;  4Z5T B;  3B0C T;  5BS7 A;  3MGS A;  4YS3 A;  3KXB C;  1P3P D;  2CV5 C;  4WV4 B;  1P3F A;  3LEL D;  3X1S B;  4NFT A;  4Z5T D;  3MGR C;  1EQZ A;  5AV8 D;  3C1C C;  4XZQ D;  5B40 A;  3X1T C;  4R8P B;  3AYW C;  3X1S D;  5CPK B;  4Z2M H;  5DNM B;  1M19 A;  5E5A C;  5AV9 B;  5GSU D;  5B0Y C;  5B32 C;  3MVD C;  1AOI D;  3MGQ A;  4R8P D;  4KUD A;  4KGC A;  3AZG A;  3A6N A;  5CPK D;  1P3I D;  1Q9C A;  3W98 D;  3MGS B;  3UTB C;  1BH8 A;  4YS3 B;  1KX3 A;  5B1M A;  3LJA A;  5B33 C;  4JJN A;  3O62 A;  1EQZ B;  5GT3 C;  4YS3 D;  4J8U C;  3AFA C;  1P3L C;  1ZLA D;  1M1A A;  5G49 B;  5CPI A;  1M19 B;  3REK A;  1EQZ D;  3AZM A;  5B2J C;  2CV5 D;  1F66 A;  4KGC B;  3MGQ B;  2F8N G;  1M18 A;  3AZG B;  4E45 A;  3A6N B;  3AZE A;  2HIO C;  2HUE C; 
#chains in the Genus database with same CATH topology
 2BYM A;  3MGR D;  5B1L A;  3C1C D;  5CHL B;  5CPJ C;  5BT1 D;  3VH6 A;  1KX3 B;  3AZG D;  3UT9 B;  4JJN B;  4HGA B;  3O62 B;  3UTB B;  3AZI B;  1P3K C;  2W8S A;  4G92 C;  3UT9 D;  5B33 B;  4WU8 A;  5JRG A;  4AWL B;  1M1A B;  5CPI B;  3O62 D;  3UTB D;  3AZI D;  1F66 B;  1HQ3 C;  5B33 D;  3LZ1 C;  1M1A D;  5B0Z B;  2BYM B;  2HUE C;  5B1L B;  5GT3 D;  4J8U D;  1P3O C;  3AFA D;  5B2J B;  5AV5 A;  3B0D C;  2F8N A;  4QLC C;  2RVQ C;  2ARO C;  5B0Z D;  3VH6 W;  1P34 C;  3W97 C;  5B2J D;  3WAA A;  3AV2 A;  1U35 A;  1ID3 C;  5JRG B;  2G5H C;  1KX5 B;  3REL C;  1H3O A;  3AZF A;  4G92 B;  2F2A C;  3AZH C;  5JRG D;  4XUJ A;  3AZL C;  4H9O A;  1KX5 D;  5BNX B;  2Y2K A;  3LZ0 C;  4UUZ B;  1P3K D;  4J8V A;  5BO0 A;  2Y2J A;  2IO5 C;  5C3I C;  5AVB A;  3KWQ A;  3W96 A;  3UTA C;  3R45 A;  3X1U C;  5GT0 C;  3B6F C;  2DQN C;  1P3P A;  2Y2P A;  3WAA B;  3F6T A;  3AV2 B;  1HQ3 D;  3A1K A;  1U35 B;  3LZ1 D;  2ARO B;  5AV8 A;  1P3O D;  3W97 B;  4XZQ A;  3WAA D;  3AV2 D;  2BG1 A;  4NE5 A;  4QLC D;  3AZF B;  4LD9 C;  1ID3 B;  3W99 A;  2NQB A;  2ARO D;  2Y2L A;  4CAY A;  4XUJ B;  1P34 D;  3REL B;  1BH9 A;  3W97 D;  5B31 C;  5GSU A;  1AOI A;  1P3A C;  4R8P A;  3AZF D;  1JFI A;  1ID3 D;  2F8N H;  4J8V B;  2Y2O A;  5AVB B;  3REJ C;  3KWQ B;  5CPK A;  1P3I A;  3W96 B;  3REL D;  3W98 A;  3R45 B;  3MNN B;  4WZS B;  5AVB D;  1R4V A;  3AZL D;  3W96 D;  3UTA B;  2NZD C;  3B6F B;  4H9Q B;  5AV8 B;  3MNN D;  1KX4 C;  3VH5 T;  4E44 A;  4XZQ B;  4G91 C;  3B0C W;  4EO5 C;  1ZLA A;  1P3G A;  3W99 B;  2NQB B;  4CAY B;  4YM6 C;  3AN2 C;  3UTA D;  3B6F D;  5GT0 D;  3B6G C;  1BH9 B;  3KXB A;  2FJ7 C;  5GSU B;  2CV5 A;  1AOI B;  5AVC C;  4LD9 B;  2JSS A;  1JFI B;  3W99 D;  2NQB D;  5G49 A;  1P3I B;  1B67 A;  3MGR A;  3W98 B;  3C1C A;  3X1T A;  4LD9 D;  3AYW A;  1P3B B;  5E5A A;  5B24 C;  5AV6 C;  5B0Y A;  5B32 A;  3MVD A;  5B40 C;  1P3A D;  4KHA B;  3UT9 A;  1ZLA B;  1P3G B;  3AZJ C;  1P3B D;  3UTB A;  3AZI A;  3KXB B;  1BFM A;  2CV5 B;  5B33 A;  4ZBJ C;  1P3G D;  3MGR B;  5GT3 A;  4J8U A;  3C1C B;  3KXB D;  3AFA A;  3X1T B;  5AVC B;  5B1M C;  4J8W C;  3AYW B;  3EPH A;  5B2I C;  5B0Z A;  3AN2 D;  3B6G D;  3EPJ A;  5DNN C;  5E5A B;  5B2J A;  4CSR A;  5B0Y B;  5B32 B;  3X1T D;  5AVC D;  3MVD B;  4UPK A;  3AYW D;  3AV1 C;  2HIO A;  3NQJ A;  5JA4 A;  3REK C;  5E5A D;  4DQY B;  5AV6 B;  3MVD D;  5B0Y D;  5B32 D;  3TU4 C;  3B0B A;  3WTP C;  1KX5 A;  5B24 D;  2YFV A;  5GT3 B;  4J8U B;  5AV6 D;  2ZM5 A;  3AFA B;  3WKJ C;  1P3K A;  1P3L B;  3WA9 C;  1TAF A;  2PYO C;  1P3M C;  5BNX A;  1S32 C;  3EG5 B;  4UUZ A;  4CSR B;  1P3L D;  3AZN C;  2DF4 C;  5GXQ C;  1HQ3 A;  4NE3 A;  2XD5 A;  3LZ1 A;  1WWI A;  5AY8 C;  2HIO B;  3NQJ B;  2HUE B;  5JA4 B;  1P3O A;  2BYK A;  4H9S C;  5CPJ B;  4J8W D;  4QLC A;  2RIQ A;  2J8P A;  2Y2Q A;  4Z66 C;  3AV1 B;  2ZY4 A;  2ARO A;  5KDM B;  2HIO D;  5B2I D;  1P34 A;  3V9R A;  2YFV B;  3W97 A;  5AV5 C;  5CPJ D;  3TU4 B;  3REI C;  1P3K B;  1ID3 A;  3AV1 D;  1TZY C;  1TAF B;  3REL A;  4J8X C;  2F8N K;  3X1V C;  3TU4 D;  3WKJ B;  3AZK C;  3VH6 T;  1Z2C B;  2Y2G A;  1HQ3 B;  3AZH A;  4ZUX C;  3LZ1 B;  3AZL A;  1P3M B;  3C1B C;  3MNN A;  1P3O B;  3LZ0 A;  2BYK B;  3WKJ D;  3B0D B;  4QLC B;  2PYO D;  4WU9 C;  1P34 B;  3UTA A;  1P3M D;  3B6F A;  5GT0 A;  4H9Q A;  3V9R B;  1B6W A;  3AZN D;  5GXQ D;  2Y2M A;  4Z66 B;  3MGP C;  2RVQ D;  5AY8 D;  4X23 C;  3H0R C;  3EPL A;  4H9R A;  5BNV B;  3REI B;  5F99 C;  4Z66 D;  4LD9 A;  5CP6 C;  1TZY B;  3LEL C;  3KUY C;  3AZH B;  2G5I C;  4Z5T C;  3AZL B;  3LZ0 B;  3REI D;  5B32 G;  1P3A A;  1TZY D;  4ZUX B;  3AZH D;  3X1S C;  2IO5 B;  5C3I B;  3C1B B;  1P3B A;  3X1U B;  5GT0 B;  4J8X D;  3X1V D;  3LZ0 D;  4KHA A;  4R8P C;  3REH C;  3FDD A;  4ZUX D;  5DNM C;  1A7W A;  3C1B D;  2NZD A;  3X1U D;  2CWE A;  5AV9 C;  4H9R B;  4YM6 A;  3AN2 A;  3B6G A;  5BS7 C;  4YS3 C;  3MGS C;  2FJ7 A;  5B31 B;  1N1J A;  5AVC A;  1P3A B;  3KUY B;  4X23 D;  3EPK A;  1P3F C;  3REJ B;  1EQZ C;  1F1E A;  5B31 D;  5F99 D;  5CP6 D;  2YFW A;  3KUY D;  3REJ D;  1M19 C;  2NZD B;  5B24 A;  5AV6 A;  1KX4 B;  5BT1 C;  4KUD C;  4G91 B;  4KGC C;  3MGQ C;  3REH B;  4EO5 B;  3AZG C;  3A6N C;  2JE5 A;  4H9N A;  1HTA A;  4YM6 B;  3AZJ A;  3AN2 B;  2NZD D;  3B6G B;  1KX4 D;  2FJ7 B;  1ULY A;  3REH D;  1P3L A;  1KX3 C;  1N1J B;  3UT9 C;  3LJA C;  4JJN C;  5DNM D;  4YM6 D;  4HGA C;  3O62 C;  3AZI C;  5AV9 D;  2FJ7 D;  4J8W A;  1P3F B;  2YFW B;  4AWL C;  5B2I A;  1M1A C;  5FUG A;  5CPI C;  3AL0 C;  5DNN A;  3MGS D;  5B24 B;  3AZM C;  5B40 B;  5CPJ A;  1F66 C;  1M18 C;  3AV1 A;  1P3F D;  3AZE C;  4H9N B;  5KDM A;  5B0Z C;  4M6B A;  3AZJ B;  5B1L C;  5B40 D;  3TU4 A;  4KUD B;  3NQU A;  4ZBJ B;  3WTP A;  1M19 D;  3AZJ D;  1BH8 B;  2Y2I A;  4KUD D;  4KGC D;  3MGQ D;  3WKJ A;  1WWS A;  5B1M B;  4J8W B;  3A6N D;  3WA9 A;  3LJA B;  4WU8 C;  5JRG C;  2PYO A;  5B2I B;  3IP4 C;  5FUG B;  1P3M A;  1S32 A;  1KX5 C;  5DNN B;  1KX3 D;  3AZN A;  5GXQ A;  5B1M D;  3LJA D;  2ZY2 A;  5AY8 A;  4JJN D;  2XD1 A;  3REK B;  5DNN D;  4H9S A;  3AZM B;  3NQU B;  4Z66 A;  2Y2N A;  1M18 B;  3AZE B;  4H9P A;  4Z2M G;  5CPI D;  2Y2H A;  3WTP B;  3REK D;  3AZM D;  5B31 G;  4WJ3 C;  3WAA C;  3REI A;  5BNV A;  3AV2 C;  3P5J B;  1F66 D;  1U35 C;  1M18 D;  3WA9 B;  1TZY A;  3AZE D;  2PYO B;  3WTP D;  5B1L D;  1S32 B;  1KU5 A;  4J8X A;  4NE6 A;  3X1V A;  3AZK A;  3AZF C;  3AZN B;  5GXQ B;  3WA9 D;  4WU8 B;  4ZUX A;  4XUJ C;  5AY8 B;  3C1B A;  1S32 D;  3X1U A;  3VH5 A;  2JCH A;  4J8V C;  4WU8 D;  2LY8 A;  5AVB C;  3KWQ C;  4H9P B;  3W96 C;  4WU9 A;  3MNN C;  5AV5 B;  1P3P C;  2F8N B;  4WNN A;  3MGP A;  3KFU G;  4X23 A;  2ZY5 A;  5AV8 C;  2L5A A;  4XZQ C;  5B31 A;  5AV5 D;  4J8X B;  3X1V B;  5F99 A;  3WTP E;  3AZK B;  2F8N D;  5CP6 A;  3LEL A;  3KUY A;  3W99 C;  2NQB C;  3REJ A;  4Z5T A;  1H3O B;  5GSU C;  1AOI C;  3AZK D;  3KSY A;  1U35 D;  3VH5 W;  3X1S A;  5CPK C;  1P3I C;  4H9O B;  4WU9 B;  3W98 C;  2FFF B;  1KX4 A;  3REH A;  4WNN B;  5BO0 B;  3MGP B;  4XUJ D;  4X23 B;  5DNM A;  4WU9 D;  3H0L C;  1P3B C;  1PZR A;  5AV9 A;  1P3P B;  5F99 B;  4J8V D;  3MGP D;  5CP6 B;  4DRB A;  1ZLA C;  3KWQ D;  3LEL B;  1P3G C;  1T3U A;  4DRA A;  4Z5T B;  3B0C T;  5BS7 A;  3MGS A;  4YS3 A;  3KXB C;  1P3P D;  3H0M C;  2CV5 C;  4WV4 B;  1W2E A;  1P3F A;  3LEL D;  3X1S B;  4NFT A;  4Z5T D;  3MGR C;  1EQZ A;  5AV8 D;  3C1C C;  4XZQ D;  5B40 A;  3X1T C;  4R8P B;  3AYW C;  3X1S D;  5CPK B;  4Z2M H;  5DNM B;  1M19 A;  2VQR A;  5E5A C;  5AV9 B;  5GSU D;  5B0Y C;  5B32 C;  3MVD C;  1AOI D;  3MGQ A;  4R8P D;  4KUD A;  4KGC A;  3AZG A;  3A6N A;  5CPK D;  1P3I D;  1Q9C A;  3W98 D;  3MGS B;  3UTB C;  1BH8 A;  4YS3 B;  1KX3 A;  5B1M A;  3LJA A;  5B33 C;  3A1I A;  4JJN A;  3O62 A;  1EQZ B;  5GT3 C;  4YS3 D;  4J8U C;  3AFA C;  1P3L C;  1ZLA D;  1M1A A;  5G49 B;  5CPI A;  1M19 B;  3REK A;  1EQZ D;  3AZM A;  5B2J C;  2CV5 D;  1F66 A;  4KGC B;  3MGQ B;  2F8N G;  1M18 A;  3AZG B;  4E45 A;  3A6N B;  3AZE A;  2UWX A;  2HIO C;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 2BYM A;  3MGR D;  5B1L A;  3C1C D;  5CHL B;  5CPJ C;  5BT1 D;  3VH6 A;  1KX3 B;  3AZG D;  3UT9 B;  4JJN B;  4HGA B;  3O62 B;  3UTB B;  3AZI B;  1P3K C;  2W8S A;  4G92 C;  3UT9 D;  5B33 B;  4WU8 A;  5JRG A;  4AWL B;  1M1A B;  5CPI B;  3O62 D;  3UTB D;  3AZI D;  1F66 B;  1HQ3 C;  5B33 D;  3LZ1 C;  1M1A D;  5B0Z B;  2BYM B;  2HUE C;  5B1L B;  5GT3 D;  4J8U D;  1P3O C;  3AFA D;  5B2J B;  5AV5 A;  3B0D C;  2F8N A;  4QLC C;  2RVQ C;  2ARO C;  5B0Z D;  3VH6 W;  1P34 C;  3W97 C;  5B2J D;  3WAA A;  3AV2 A;  1U35 A;  1ID3 C;  5JRG B;  2G5H C;  1KX5 B;  3REL C;  1H3O A;  3AZF A;  4G92 B;  2F2A C;  3AZH C;  5JRG D;  4XUJ A;  3AZL C;  4H9O A;  1KX5 D;  5BNX B;  2Y2K A;  3LZ0 C;  4UUZ B;  1P3K D;  4J8V A;  5BO0 A;  2Y2J A;  2IO5 C;  5C3I C;  5AVB A;  3KWQ A;  3W96 A;  3UTA C;  3R45 A;  3X1U C;  5GT0 C;  3B6F C;  2DQN C;  1P3P A;  2Y2P A;  3WAA B;  3F6T A;  3AV2 B;  1HQ3 D;  3A1K A;  1U35 B;  3LZ1 D;  2ARO B;  5AV8 A;  1P3O D;  3W97 B;  4XZQ A;  3WAA D;  3AV2 D;  2BG1 A;  4NE5 A;  4QLC D;  3AZF B;  4LD9 C;  1ID3 B;  3W99 A;  2NQB A;  2ARO D;  2Y2L A;  4CAY A;  4XUJ B;  1P34 D;  3REL B;  1BH9 A;  3W97 D;  5B31 C;  5GSU A;  1AOI A;  1P3A C;  4R8P A;  3AZF D;  1JFI A;  1ID3 D;  2F8N H;  4J8V B;  2Y2O A;  5AVB B;  3REJ C;  3KWQ B;  5CPK A;  1P3I A;  3W96 B;  3REL D;  3W98 A;  3R45 B;  3MNN B;  4WZS B;  5AVB D;  1R4V A;  3AZL D;  3W96 D;  3UTA B;  2NZD C;  3B6F B;  4H9Q B;  5AV8 B;  3MNN D;  1KX4 C;  3VH5 T;  4E44 A;  4XZQ B;  4G91 C;  3B0C W;  4EO5 C;  1ZLA A;  1P3G A;  3W99 B;  2NQB B;  4CAY B;  4YM6 C;  3AN2 C;  3UTA D;  3B6F D;  5GT0 D;  3B6G C;  1BH9 B;  3KXB A;  2FJ7 C;  5GSU B;  2CV5 A;  1AOI B;  5AVC C;  4LD9 B;  2JSS A;  1JFI B;  3W99 D;  2NQB D;  5G49 A;  1P3I B;  1B67 A;  3MGR A;  3W98 B;  3C1C A;  3X1T A;  4LD9 D;  3AYW A;  1P3B B;  5E5A A;  5B24 C;  5AV6 C;  5B0Y A;  5B32 A;  3MVD A;  5B40 C;  1P3A D;  4KHA B;  3UT9 A;  1ZLA B;  1P3G B;  3AZJ C;  1P3B D;  3UTB A;  3AZI A;  3KXB B;  1BFM A;  2CV5 B;  5B33 A;  4ZBJ C;  1P3G D;  3MGR B;  5GT3 A;  4J8U A;  3C1C B;  3KXB D;  3AFA A;  3X1T B;  5AVC B;  5B1M C;  4J8W C;  3AYW B;  3EPH A;  5B2I C;  5B0Z A;  3AN2 D;  3B6G D;  3EPJ A;  5DNN C;  5E5A B;  5B2J A;  4CSR A;  5B0Y B;  5B32 B;  3X1T D;  5AVC D;  3MVD B;  4UPK A;  3AYW D;  3AV1 C;  2HIO A;  3NQJ A;  5JA4 A;  3REK C;  5E5A D;  4DQY B;  5AV6 B;  3MVD D;  5B0Y D;  5B32 D;  3TU4 C;  3B0B A;  3WTP C;  1KX5 A;  5B24 D;  2YFV A;  5GT3 B;  4J8U B;  5AV6 D;  2ZM5 A;  3AFA B;  3WKJ C;  1P3K A;  1P3L B;  3WA9 C;  1TAF A;  2PYO C;  1P3M C;  5BNX A;  1S32 C;  3EG5 B;  4UUZ A;  4CSR B;  1P3L D;  3AZN C;  2DF4 C;  5GXQ C;  1HQ3 A;  4NE3 A;  2XD5 A;  3LZ1 A;  1WWI A;  5AY8 C;  2HIO B;  3NQJ B;  2HUE B;  5JA4 B;  1P3O A;  2BYK A;  4H9S C;  5CPJ B;  4J8W D;  4QLC A;  2RIQ A;  2J8P A;  2Y2Q A;  4Z66 C;  3AV1 B;  2ZY4 A;  2ARO A;  5KDM B;  2HIO D;  5B2I D;  1P34 A;  3V9R A;  2YFV B;  3W97 A;  5AV5 C;  5CPJ D;  3TU4 B;  3REI C;  1P3K B;  1ID3 A;  3AV1 D;  1TZY C;  1TAF B;  3REL A;  4J8X C;  2F8N K;  3X1V C;  3TU4 D;  3WKJ B;  3AZK C;  3VH6 T;  1Z2C B;  2Y2G A;  1HQ3 B;  3AZH A;  4ZUX C;  3LZ1 B;  3AZL A;  1P3M B;  3C1B C;  3MNN A;  1P3O B;  3LZ0 A;  2BYK B;  3WKJ D;  3B0D B;  4QLC B;  2PYO D;  4WU9 C;  1P34 B;  3UTA A;  1P3M D;  3B6F A;  5GT0 A;  4H9Q A;  3V9R B;  1B6W A;  3AZN D;  5GXQ D;  2Y2M A;  4Z66 B;  3MGP C;  2RVQ D;  5AY8 D;  4X23 C;  3H0R C;  3EPL A;  4H9R A;  5BNV B;  3REI B;  5F99 C;  4Z66 D;  4LD9 A;  5CP6 C;  1TZY B;  3LEL C;  3KUY C;  3AZH B;  2G5I C;  4Z5T C;  3AZL B;  3LZ0 B;  3REI D;  5B32 G;  1P3A A;  1TZY D;  4ZUX B;  3AZH D;  3X1S C;  2IO5 B;  5C3I B;  3C1B B;  1P3B A;  3X1U B;  5GT0 B;  4J8X D;  3X1V D;  3LZ0 D;  4KHA A;  4R8P C;  3REH C;  3FDD A;  4ZUX D;  5DNM C;  1A7W A;  3C1B D;  2NZD A;  3X1U D;  2CWE A;  5AV9 C;  4H9R B;  4YM6 A;  3AN2 A;  3B6G A;  5BS7 C;  4YS3 C;  3MGS C;  2FJ7 A;  5B31 B;  1N1J A;  5AVC A;  1P3A B;  3KUY B;  4X23 D;  3EPK A;  1P3F C;  3REJ B;  1EQZ C;  1F1E A;  5B31 D;  5F99 D;  5CP6 D;  2YFW A;  3KUY D;  3REJ D;  1M19 C;  2NZD B;  5B24 A;  5AV6 A;  1KX4 B;  5BT1 C;  4KUD C;  4G91 B;  4KGC C;  3MGQ C;  3REH B;  4EO5 B;  3AZG C;  3A6N C;  2JE5 A;  4H9N A;  1HTA A;  4YM6 B;  3AZJ A;  3AN2 B;  2NZD D;  3B6G B;  1KX4 D;  2FJ7 B;  1ULY A;  3REH D;  1P3L A;  1KX3 C;  1N1J B;  3UT9 C;  3LJA C;  4JJN C;  5DNM D;  4YM6 D;  4HGA C;  3O62 C;  3AZI C;  5AV9 D;  2FJ7 D;  4J8W A;  1P3F B;  2YFW B;  4AWL C;  5B2I A;  1M1A C;  5FUG A;  5CPI C;  3AL0 C;  5DNN A;  3MGS D;  5B24 B;  3AZM C;  5B40 B;  5CPJ A;  1F66 C;  1M18 C;  3AV1 A;  1P3F D;  3AZE C;  4H9N B;  5KDM A;  5B0Z C;  4M6B A;  3AZJ B;  5B1L C;  5B40 D;  3TU4 A;  4KUD B;  3NQU A;  4ZBJ B;  3WTP A;  1M19 D;  3AZJ D;  1BH8 B;  2Y2I A;  4KUD D;  4KGC D;  3MGQ D;  3WKJ A;  1WWS A;  5B1M B;  4J8W B;  3A6N D;  3WA9 A;  3LJA B;  4WU8 C;  5JRG C;  2PYO A;  5B2I B;  3IP4 C;  5FUG B;  1P3M A;  1S32 A;  1KX5 C;  5DNN B;  1KX3 D;  3AZN A;  5GXQ A;  5B1M D;  3LJA D;  2ZY2 A;  5AY8 A;  4JJN D;  2XD1 A;  3REK B;  5DNN D;  4H9S A;  3AZM B;  3NQU B;  4Z66 A;  2Y2N A;  1M18 B;  3AZE B;  4H9P A;  4Z2M G;  5CPI D;  2Y2H A;  3WTP B;  3REK D;  3AZM D;  5B31 G;  4WJ3 C;  3WAA C;  3REI A;  5BNV A;  3AV2 C;  3P5J B;  1F66 D;  1U35 C;  1M18 D;  3WA9 B;  1TZY A;  3AZE D;  2PYO B;  3WTP D;  5B1L D;  1S32 B;  1KU5 A;  4J8X A;  4NE6 A;  3X1V A;  3AZK A;  3AZF C;  3AZN B;  5GXQ B;  3WA9 D;  4WU8 B;  4ZUX A;  4XUJ C;  5AY8 B;  3C1B A;  1S32 D;  3X1U A;  3VH5 A;  2JCH A;  4J8V C;  4WU8 D;  2LY8 A;  5AVB C;  3KWQ C;  4H9P B;  3W96 C;  4WU9 A;  3MNN C;  5AV5 B;  1P3P C;  2F8N B;  4WNN A;  3MGP A;  3KFU G;  4X23 A;  2ZY5 A;  5AV8 C;  2L5A A;  4XZQ C;  5B31 A;  5AV5 D;  4J8X B;  3X1V B;  5F99 A;  3WTP E;  3AZK B;  2F8N D;  5CP6 A;  3LEL A;  3KUY A;  3W99 C;  2NQB C;  3REJ A;  4Z5T A;  1H3O B;  5GSU C;  1AOI C;  3AZK D;  3KSY A;  1U35 D;  3VH5 W;  3X1S A;  5CPK C;  1P3I C;  4H9O B;  4WU9 B;  3W98 C;  2FFF B;  1KX4 A;  3REH A;  4WNN B;  5BO0 B;  3MGP B;  4XUJ D;  4X23 B;  5DNM A;  4WU9 D;  3H0L C;  1P3B C;  1PZR A;  5AV9 A;  1P3P B;  5F99 B;  4J8V D;  3MGP D;  5CP6 B;  4DRB A;  1ZLA C;  3KWQ D;  3LEL B;  1P3G C;  1T3U A;  4DRA A;  4Z5T B;  3B0C T;  5BS7 A;  3MGS A;  4YS3 A;  3KXB C;  1P3P D;  3H0M C;  2CV5 C;  4WV4 B;  1W2E A;  1P3F A;  3LEL D;  3X1S B;  4NFT A;  4Z5T D;  3MGR C;  1EQZ A;  5AV8 D;  3C1C C;  4XZQ D;  5B40 A;  3X1T C;  4R8P B;  3AYW C;  3X1S D;  5CPK B;  4Z2M H;  5DNM B;  1M19 A;  2VQR A;  5E5A C;  5AV9 B;  5GSU D;  5B0Y C;  5B32 C;  3MVD C;  1AOI D;  3MGQ A;  4R8P D;  4KUD A;  4KGC A;  3AZG A;  3A6N A;  5CPK D;  1P3I D;  1Q9C A;  3W98 D;  3MGS B;  3UTB C;  1BH8 A;  4YS3 B;  1KX3 A;  5B1M A;  3LJA A;  5B33 C;  3A1I A;  4JJN A;  3O62 A;  1EQZ B;  5GT3 C;  4YS3 D;  4J8U C;  3AFA C;  1P3L C;  1ZLA D;  1M1A A;  5G49 B;  5CPI A;  1M19 B;  3REK A;  1EQZ D;  3AZM A;  5B2J C;  2CV5 D;  1F66 A;  4KGC B;  3MGQ B;  2F8N G;  1M18 A;  3AZG B;  4E45 A;  3A6N B;  3AZE A;  2UWX A;  2HIO C;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...