3B6GA

Nucleosome core particle treated with oxaliplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gA00
4XUJB 3X1VD 3AZKA 5B33C 1S32B 3REKB 5B2JD 1P3MC 3KXBB 3W96B 3TU4C 1P3GA 1U35D 4JJND 4XZQD 3MGSA 4WU8B 3C1CD 1P3LC 5AVCA 1KU5A 2LY8A 3X1SC 4ZUXB 1KX3A 5JRGA 4H9RB 3RELC 5DNND 1ID3D 1P3OD 2NQBC 5DNMA 3KUYA 3AZFA 1S32C 4ZBJC 3AYWD 3V9RA 3UTAD 3UT9B 3X1TB 5FUGB 5B31D 3LJAC 1P3FC 4Z66A 4QLCB 1KX5A 4YM6A 3AZLB 3NQUA 2AROA 3O62A 5E5AA 3MGRD 3W98B 1BH8A 1ULYA 3MNND 4ZUXC 4G92B 1P3BC 2HIOB 4CSRA 1EQZD 4KUDA 4H9SA 4H9QA 5AY8D 5AV9D 3UTBA 4LD9B 5CPJB 1F66C 4G91B 3VH5W 1AOIB 1M18D 5GT3B 2F8NB 3WKJD 5BS7A 4CAYA 5KDMB 4J8UB 3MGPC 3AV2C 4J8WC 2PYOA 1HTAA 3W97B 4HGAC 2YFWB 4KHAB 4WU9A 1AOIC 5B40A 1JFIB 1P3KD 5B1MD 5B1LC 3NQJA 5F99A 2CV5B 1P3IA 1ZLAA 3AV1A 2RVQC 5BNVB 5B2IA 4J8XA 5C3IC 5GT0A 4KGCD 3VH6A 4E45A 5AV5C 3LELB 3AZKB 3LZ1D 1TZYA 3AZID 4UUZA 1N1JB 4YS3D 1P3GB 2NZDA 1BFMA 5AV8C 3AZHB 1WWSA 5B0YB 3AZMD 1P3PD 1KX4D 3B6GA 3WTPA 3B6FD 5CPKB 4Z5TA 5GXQA 5GSUD 5DNMB 3AZFB 3REIA 5B32D 3AZGC 5B0ZA 1P3GC 3WAAA 3MVDC 3MGSC 3AZNA 2AROB 2BYKA 4H9NA 5AVCC 1M19D 5CPID 1BH8B 1KX3C 3MGQB 5JRGC 4NE5A 1HQ3D 4KUDB 5B2JA 3AN2A 3KUYC 1F66A 4JJNA 4XZQA 4Z66C 2FJ7B 3X1UD 3C1CA 1KX5C 4YM6C 2AROC 3KWQD 3O62C 5E5AC 4R8PC 3W99D 4EO5C 5AV6D 5DNNA 3VH6T 5AVBD 1P3OA 1ID3A 1R4VA 3AFAA 3AYWA 4H9SC 3UTAA 3AZJB 5B31A 3UTBC 5B24A 3A6NB 1P34D 2PYOB 3B0CW 2HUEB 4WU9B 2JSSA 5B31G 3MNNA 3KSYA 5F99B 3REJA 5BS7C 3AV1B 1M1AD 3AZED 5AY8A 5AV9A 4H9OB 4J8XB 5BO0A 4J8VD 5B33B 1B6WA 1M18A 1P3MB 5B40C 3C1BD 5JA4A 3TU4B 3WKJA 1P3IC 1ZLAC 1P3LB 5B2IC 4J8XC 5GT0C 5CP6D 3X1SB 3RELB 2NQBB 3TU4D 1H3OB 1TAFA 1TZYC 5B1MA 4ZBJB 5CHLB 3LJAB 3AZGA 1P3FB 3MVDA 2F8NG 4XUJD 2NZDC 3WA9A 2BYKB 4H9NB 3B6GC 1S32D 3REKD 3KXBD 3W96D 3LZ1A 5BNXA 1P3BB 3WTPC 2BYMB 4Z5TC 5GXQC 1P3FD 4WU8D 3REIC 4M6BA 1F66B 5B0ZC 3WAAC 3AZMA 3AZNC 4ZUXD 1P3PA 5G49A 1KX4A 4R8PA 1WWIA 3X1VC 1BH9A 3B6FA 3X1TD 3UT9D 3MGPB 4QLCD 5B2JC 3AFAB 3AV2B 3AN2C 4J8WB 3AZLD 5B24B 1U35C 4X23A 4XZQC 4HGAB 4JJNC 3W98D 3C1CC 2YFVB 2HIOD 1M19A 5CPIA 1Q9CA 5B1LB 5B32G 3AV2D 3REJB 5DNNC 1ID3C 1P3OC 4LD9D 5CPJD 5C3IB 3AFAC 5AV5B 3AYWC 3UTAC 1AOID 5B31C 5B24C 5GT3D 2F8ND 3LZ0A 4WNNA 3KWQA 3MGRC 3W99A 4J8UD 3WTPE 3MNNC 3REJC 4NE6A 1EQZC 5AV8B 3W97D 5AY8C 5AV9C 1P34A 3REHA 5BT1D 2CV5D 1M18C 3WKJC 3AZGB 3MVDB 3MGSB 1A7WA 3LELD 3B0DC 5AVCB 3AZKD 4J8VA 1KX3B 5JRGB 1P3AA 1P3GD 3KUYB 1P3KC 5B1MC 3V9RB 3AZHD 5B0YD 4Z66B 2F8NH 1KX5B 4YM6B 4KGCC 3NQUB 5G49B 5JRGD 5CP6A 3O62B 5E5AB 4R8PB 3X1VA 5CPKD 3WA9C 5DNMD 3AZFD 4EO5B 3LZ1C 4CSRB 4H9QB 3UTBB 1U35A 4YS3C 2F8NK 2AROD 4XUJA 3AZMC 3MGQD 1P3PC 1F1EA 1KX4C 4KUDD 3REKA 3KXBA 4DRBA 3W96A 3UTBD 4CAYB 3B6FC 4DRAA 5GSUC 4WU8A 2FJ7D 3VH5A 4X23C 4H9RA 3LZ0B 3MGRA 5B40B 1M19C 5CPIC 3NQJB 1P3IB 3X1TA 3B0BA 1ZLAB 3AZJD 5FUGA 1EQZA 3A6ND 1HQ3C 2PYOD 4QLCA 5B2IB 5GT0B 3AZLA 4WU9D 3REHB 5B40D 3W98A 3X1UC 5F99D 1TZYB 2HIOA 3LZ0C 3AV1D 3KWQC 4UUZB 3W99C 4J8XD 5AV6C 5AVBC 4LD9A 5CPJA 2NZDB 5B33D 3B6GB 1P34C 5GT3A 3REHC 1P3MD 2F8NA 3WTPB 5KDMA 4Z5TB 4WZSB 5GXQB 4AWLC 1P3KA 4J8UA 2L5AA 3REIB 1P3LD 1M1AC 5B0ZB 3X1SD 3WAAB 3AZEC 3W97A 3AZNB 4KGCA 3R45A 3RELD 2NQBD 2YFWA 4KHAA 1JFIA 3X1VB 2CWEA 4J8VC 2CV5A 3LJAD 3AZIA 1P3AC 5B2JB 5BNVA 3WAAD 3VH5T 3AN2B 4YS3A 1U35B 4JJNB 4XZQB 4NFTA 3LELA 3C1CB 1P3BD 5CP6C 3AN2D 1N1JA 5DNNB 1ID3B 1P3OB 5GSUA 4Z2MG 1F66D 2IO5C 3AYWB 3AZHA 3UTAB 5B0YA 5B31B 5B32A 4XUJC 5CPKA 3MGRB 3MNNB 3MGPD 3AFAD 3REKC 3KXBC 3W96C 1HQ3A 4J8WD 1EQZB 4WV4B 5B24D 1B67A 4E44A 5AY8B 5AV9B 4WU8C 5BO0B 3X1UA 5B1LD 3MGQA 3REJD 1M18B 2RVQD 5JA4B 3WKJB 5AV6A 5AV5D 5AVBA 3UT9C 3X1TC 2FJ7A 4QLCC 3B0DB 3AZLC 3W98C 1TAFB 4G92C 2HIOC 1P3KB 5B1MB 5AV8D 3AZJA 1M1AA 3A6NA 3AZEA 4LD9C 5CPJC 4KGCB 4H9PA 3R45B 3WA9B 4G91C 5GT3C 3LZ1B 5BNXB 3AZGD 3AZIB 3C1BA 3MVDD 3MGSD 4J8UC 4H9OA 4YS3B 3WA9D 5AVCD 3AZMB 3W97C 1KX3D 5B33A 1P3PB 1KX4B 1P3MA 3KUYD 1BH9B 3TU4A 3B6FB 5BT1C 2CV5C 5GSUB 4Z66D 3AZIC 3B0CT 1P3LA 1KX5D 4YM6D 5B32B 3X1SA 4X23B 5E5AD 4R8PD 3O62D 3LELC 3RELA 2NQBA 1H3OA 3AZKC 1M19B 5CPIB 1S32A 3LJAA 1HQ3B 1P3FA 4Z2MH 4X23D 3AZHC 5B0YC 5B32C 3X1UB 4ZUXA 1P3BA 4WNNB 5CPKC 2BYMA 3KWQB 3W99B 5DNMC 3AZFC 5AV6B 3UT9A 5AVBB 3LZ0D 1P34B 4NE3A 4AWLB 1P3ID 1ZLAD 3MGQC 4KUDC 3MGPA 5B2ID 3AV2A 5GT0D 4J8WA 1M1AB 3AZEB 3REHD 4H9PB 2FJ7C 1AOIA 2YFVA 1TZYD 5B1LA 4J8VB 1P3AB 3C1BB 2NZDD 5AV5A 3AZJC 3VH6W 3A6NC 3B6GD 2PYOC 3WTPD 5CP6B 4Z5TD 2HUEC 5GXQD 4WU9C 1P3AD 3REID 5F99C 2IO5B 3AV1C 5B0ZD 5AV8A 3C1BC 3AZND
chains in the Genus database with same CATH superfamily
4XUJB 3X1VD 3AZKA 5B33C 2Y2QA 1S32B 3REKB 5B2JD 1P3MC 3KXBB 3W96B 3TU4C 2DF4C 1P3GA 1U35D 4JJND 4XZQD 3MGSA 4WU8B 3C1CD 1P3LC 5AVCA 3P5JB 3AL0C 1KU5A 2LY8A 3X1SC 4ZUXB 1KX3A 5JRGA 4H9RB 3RELC 5DNND 4UPKA 1P3OD 1ID3D 2NQBC 5DNMA 3KUYA 3AZFA 1S32C 4ZBJC 3AYWD 3V9RA 3UTAD 3UT9B 3X1TB 5FUGB 5B31D 3LJAC 1P3FC 4Z66A 4QLCB 1KX5A 4YM6A 3AZLB 4WJ3C 3NQUA 2AROA 3O62A 5E5AA 3MGRD 3W98B 1BH8A 1ULYA 3MNND 4ZUXC 3EPLA 4G92B 1P3BC 2HIOB 4CSRA 2BG1A 1EQZD 4KUDA 4H9SA 4H9QA 5AY8D 5AV9D 3UTBA 4LD9B 5CPJB 1F66C 2VQRA 4G91B 3VH5W 1AOIB 1M18D 5GT3B 2F8NB 2F2AC 3WKJD 5BS7A 4CAYA 5KDMB 4J8UB 3EPHA 3MGPC 3AV2C 4J8WC 2PYOA 1HTAA 2Y2NA 3W97B 4HGAC 2YFWB 4KHAB 4WU9A 1AOIC 5B40A 1JFIB 1P3KD 5B1MD 5B1LC 3NQJA 5F99A 2CV5B 1P3IA 1ZLAA 3AV1A 2RVQC 5BNVB 5B2IA 4J8XA 5C3IC 5GT0A 4KGCD 3VH6A 4E45A 5AV5C 3LELB 3AZKB 3LZ1D 1TZYA 3AZID 4UUZA 1N1JB 4YS3D 1P3GB 2NZDA 1BFMA 5AV8C 3AZHB 1WWSA 5B0YB 4DQYB 3AZMD 1P3PD 1T3UA 1KX4D 3B6GA 3WTPA 3B6FD 5CPKB 2DQNC 4Z5TA 5GXQA 5GSUD 5DNMB 3AZFB 3REIA 2Y2HA 5B32D 3AZGC 5B0ZA 1P3GC 3WAAA 3MVDC 3MGSC 3AZNA 2AROB 2BYKA 4H9NA 5AVCC 1M19D 5CPID 1BH8B 1KX3C 3MGQB 5JRGC 4NE5A 1HQ3D 4KUDB 5B2JA 2Y2MA 3AN2A 3KUYC 1F66A 4JJNA 4XZQA 4Z66C 2FJ7B 3X1UD 3C1CA 1KX5C 4YM6C 2AROC 3KWQD 3O62C 5E5AC 4R8PC 3W99D 4EO5C 5AV6D 5DNNA 3VH6T 5AVBD 1P3OA 1ID3A 1R4VA 3AFAA 3AYWA 4H9SC 3UTAA 3AZJB 5B31A 3UTBC 5B24A 3A6NB 1P34D 2PYOB 3B0CW 2HUEB 4WU9B 2JSSA 5B31G 3MNNA 3KSYA 5F99B 3REJA 5BS7C 3AV1B 1M1AD 2FFFB 3AZED 5AY8A 5AV9A 4H9OB 4J8XB 5BO0A 2Y2LA 2G5HC 4J8VD 5B33B 1B6WA 1M18A 1P3MB 5B40C 3C1BD 5JA4A 3TU4B 3WKJA 1P3IC 1ZLAC 1P3LB 5B2IC 4J8XC 5GT0C 2UWXA 5CP6D 3X1SB 3RELB 2NQBB 3TU4D 1H3OB 1TAFA 1W2EA 1TZYC 5B1MA 4ZBJB 5CHLB 1Z2CB 3LJAB 3AZGA 1P3FB 3MVDA 2F8NG 4XUJD 2NZDC 3WA9A 2BYKB 4H9NB 3B6GC 1S32D 3REKD 3KXBD 3W96D 3LZ1A 5BNXA 1P3BB 3WTPC 2BYMB 4Z5TC 5GXQC 1P3FD 4WU8D 3REIC 4M6BA 1F66B 5B0ZC 3WAAC 3AZMA 3AZNC 4ZUXD 1P3PA 5G49A 1KX4A 4R8PA 1WWIA 3X1VC 1BH9A 3B6FA 3X1TD 3UT9D 3F6TA 3MGPB 4QLCD 5B2JC 3AFAB 3AV2B 2JE5A 3AN2C 4J8WB 3AZLD 5B24B 1U35C 4X23A 4XZQC 4HGAB 4JJNC 3W98D 3C1CC 2YFVB 2HIOD 1M19A 5CPIA 1Q9CA 5B1LB 5B32G 3AV2D 3REJB 5DNNC 1ID3C 1P3OC 4LD9D 5CPJD 5C3IB 3A1KA 3AFAC 5AV5B 3AYWC 3UTAC 1AOID 2ZY3A 5B31C 5B24C 5GT3D 2F8ND 3LZ0A 4WNNA 3KWQA 3MGRC 3W99A 2ZY5A 4J8UD 3WTPE 3MNNC 3H0RC 3REJC 4NE6A 1EQZC 5AV8B 3W97D 5AY8C 5AV9C 1P34A 3REHA 5BT1D 2CV5D 1M18C 3WKJC 3AZGB 3MVDB 2G5IC 3MGSB 1A7WA 3LELD 3B0DC 5AVCB 3AZKD 4J8VA 1KX3B 5JRGB 2W8SA 1P3AA 1P3GD 3H0LC 3KUYB 1P3KC 5B1MC 3V9RB 3AZHD 5B0YD 4Z66B 2F8NH 1KX5B 4YM6B 4KGCC 3NQUB 5G49B 5JRGD 5CP6A 3O62B 5E5AB 4R8PB 3X1VA 5CPKD 3WA9C 5DNMD 3AZFD 4EO5B 3LZ1C 4CSRB 4H9QB 3UTBB 1U35A 4YS3C 2F8NK 2AROD 4XUJA 3AZMC 3MGQD 1P3PC 1F1EA 1KX4C 4KUDD 3REKA 3KXBA 4DRBA 3W96A 3UTBD 4CAYB 3B6FC 4DRAA 5GSUC 3FDDA 4WU8A 2FJ7D 2Y2OA 3VH5A 4X23C 2Y2GA 4H9RA 3LZ0B 3MGRA 2Y2KA 5B40B 1M19C 5CPIC 3NQJB 1P3IB 3X1TA 3B0BA 1ZLAB 3AZJD 5FUGA 1EQZA 3A6ND 1HQ3C 2PYOD 4QLCA 5B2IB 5GT0B 3AZLA 2ZY4A 4WU9D 3REHB 5B40D 3W98A 3X1UC 5F99D 1TZYB 2HIOA 3LZ0C 3AV1D 3KWQC 4UUZB 3W99C 4J8XD 5AV6C 5AVBC 4LD9A 5CPJA 2NZDB 5B33D 3B6GB 1P34C 5GT3A 3REHC 1P3MD 1PZRA 2F8NA 3WTPB 5KDMA 4Z5TB 4WZSB 5GXQB 3H0MC 4AWLC 1P3KA 4J8UA 2L5AA 3REIB 1P3LD 1M1AC 5B0ZB 3X1SD 3WAAB 3AZEC 3W97A 3AZNB 4KGCA 3R45A 3RELD 2NQBD 2YFWA 4KHAA 1JFIA 3X1VB 2CWEA 4J8VC 2CV5A 3LJAD 3AZIA 3EPJA 1P3AC 5B2JB 5BNVA 3WAAD 3VH5T 3AN2B 4YS3A 2RIQA 1U35B 4JJNB 4XZQB 2JCHA 4NFTA 3LELA 3C1CB 1P3BD 5CP6C 3AN2D 1N1JA 5DNNB 1ID3B 1P3OB 5GSUA 4Z2MG 1F66D 3EPKA 2IO5C 3AYWB 3AZHA 3UTAB 5B0YA 5B31B 5B32A 2ZY2A 4XUJC 5CPKA 3MGRB 3MNNB 3MGPD 3AFAD 3REKC 3KXBC 3EG5B 3W96C 1HQ3A 4J8WD 1EQZB 4WV4B 5B24D 1B67A 4E44A 5AY8B 5AV9B 4WU8C 5BO0B 3X1UA 5B1LD 3MGQA 3REJD 1M18B 2Y2JA 2RVQD 5JA4B 3WKJB 5AV6A 5AV5D 5AVBA 3UT9C 3X1TC 2FJ7A 4QLCC 3B0DB 3AZLC 3W98C 1TAFB 4G92C 2HIOC 1P3KB 5B1MB 5AV8D 3AZJA 1M1AA 3A6NA 3AZEA 2ZM5A 4LD9C 5CPJC 4KGCB 4H9PA 3R45B 3WA9B 4G91C 2XD5A 5GT3C 3LZ1B 5BNXB 3AZGD 3AZIB 3C1BA 3MVDD 3MGSD 4J8UC 4H9OA 4YS3B 3WA9D 5AVCD 3AZMB 3W97C 1KX3D 5B33A 1P3PB 1KX4B 1P3MA 3A1IA 3KUYD 1BH9B 3TU4A 3B6FB 5BT1C 2CV5C 5GSUB 4Z66D 3AZIC 3B0CT 1P3LA 1KX5D 4YM6D 5B32B 3X1SA 4X23B 5E5AD 4R8PD 3O62D 3LELC 3RELA 2NQBA 1H3OA 3AZKC 1M19B 5CPIB 1S32A 3LJAA 1HQ3B 1P3FA 4Z2MH 4X23D 2Y2PA 3AZHC 5B0YC 5B32C 3X1UB 4ZUXA 1P3BA 4WNNB 5CPKC 2BYMA 3KWQB 3W99B 5DNMC 3AZFC 5AV6B 3UT9A 5AVBB 3KFUG 2J8PA 3LZ0D 1P34B 4NE3A 4AWLB 1P3ID 1ZLAD 3MGQC 4KUDC 3MGPA 5B2ID 3AV2A 5GT0D 4J8WA 1M1AB 3AZEB 3REHD 4H9PB 2FJ7C 1AOIA 2Y2IA 2YFVA 1TZYD 5B1LA 3IP4C 4J8VB 1P3AB 3C1BB 2NZDD 5AV5A 3AZJC 3VH6W 3A6NC 3B6GD 2PYOC 3WTPD 5CP6B 4Z5TD 2HUEC 5GXQD 2XD1A 4WU9C 1P3AD 3REID 5F99C 2IO5B 3AV1C 5B0ZD 5AV8A 3C1BC 3AZND
chains in the Genus database with same CATH topology
4XUJB 3X1VD 3AZKA 5B33C 2Y2QA 1S32B 3REKB 5B2JD 1P3MC 3KXBB 3W96B 3TU4C 2DF4C 1P3GA 1U35D 4JJND 4XZQD 3MGSA 4WU8B 3C1CD 1P3LC 5AVCA 3P5JB 3AL0C 1KU5A 2LY8A 3X1SC 4ZUXB 1KX3A 5JRGA 4H9RB 3RELC 5DNND 4UPKA 1P3OD 1ID3D 2NQBC 5DNMA 3KUYA 3AZFA 1S32C 4ZBJC 3AYWD 3V9RA 3UTAD 3UT9B 3X1TB 5FUGB 5B31D 3LJAC 1P3FC 4Z66A 4QLCB 1KX5A 4YM6A 3AZLB 4WJ3C 3NQUA 2AROA 3O62A 5E5AA 3MGRD 3W98B 1BH8A 1ULYA 3MNND 4ZUXC 3EPLA 4G92B 1P3BC 2HIOB 4CSRA 2BG1A 1EQZD 4KUDA 4H9SA 4H9QA 5AY8D 5AV9D 3UTBA 4LD9B 5CPJB 1F66C 2VQRA 4G91B 3VH5W 1AOIB 1M18D 5GT3B 2F8NB 2F2AC 3WKJD 5BS7A 4CAYA 5KDMB 4J8UB 3EPHA 3MGPC 3AV2C 4J8WC 2PYOA 1HTAA 2Y2NA 3W97B 4HGAC 2YFWB 4KHAB 4WU9A 1AOIC 5B40A 1JFIB 1P3KD 5B1MD 5B1LC 3NQJA 5F99A 2CV5B 1P3IA 1ZLAA 3AV1A 2RVQC 5BNVB 5B2IA 4J8XA 5C3IC 5GT0A 4KGCD 3VH6A 4E45A 5AV5C 3LELB 3AZKB 3LZ1D 1TZYA 3AZID 4UUZA 1N1JB 4YS3D 1P3GB 2NZDA 1BFMA 5AV8C 3AZHB 1WWSA 5B0YB 4DQYB 3AZMD 1P3PD 1T3UA 1KX4D 3B6GA 3WTPA 3B6FD 5CPKB 2DQNC 4Z5TA 5GXQA 5GSUD 5DNMB 3AZFB 3REIA 2Y2HA 5B32D 3AZGC 5B0ZA 1P3GC 3WAAA 3MVDC 3MGSC 3AZNA 2AROB 2BYKA 4H9NA 5AVCC 1M19D 5CPID 1BH8B 1KX3C 3MGQB 5JRGC 4NE5A 1HQ3D 4KUDB 5B2JA 2Y2MA 3AN2A 3KUYC 1F66A 4JJNA 4XZQA 4Z66C 2FJ7B 3X1UD 3C1CA 1KX5C 4YM6C 2AROC 3KWQD 3O62C 5E5AC 4R8PC 3W99D 4EO5C 5AV6D 5DNNA 3VH6T 5AVBD 1P3OA 1ID3A 1R4VA 3AFAA 3AYWA 4H9SC 3UTAA 3AZJB 5B31A 3UTBC 5B24A 3A6NB 1P34D 2PYOB 3B0CW 2HUEB 4WU9B 2JSSA 5B31G 3MNNA 3KSYA 5F99B 3REJA 5BS7C 3AV1B 1M1AD 2FFFB 3AZED 5AY8A 5AV9A 4H9OB 4J8XB 5BO0A 2Y2LA 2G5HC 4J8VD 5B33B 1B6WA 1M18A 1P3MB 5B40C 3C1BD 5JA4A 3TU4B 3WKJA 1P3IC 1ZLAC 1P3LB 5B2IC 4J8XC 5GT0C 2UWXA 5CP6D 3X1SB 3RELB 2NQBB 3TU4D 1H3OB 1TAFA 1W2EA 1TZYC 5B1MA 4ZBJB 5CHLB 1Z2CB 3LJAB 3AZGA 1P3FB 3MVDA 2F8NG 4XUJD 2NZDC 3WA9A 2BYKB 4H9NB 3B6GC 1S32D 3REKD 3KXBD 3W96D 3LZ1A 5BNXA 1P3BB 3WTPC 2BYMB 4Z5TC 5GXQC 1P3FD 4WU8D 3REIC 4M6BA 1F66B 5B0ZC 3WAAC 3AZMA 3AZNC 4ZUXD 1P3PA 5G49A 1KX4A 4R8PA 1WWIA 3X1VC 1BH9A 3B6FA 3X1TD 3UT9D 3F6TA 3MGPB 4QLCD 5B2JC 3AFAB 3AV2B 2JE5A 3AN2C 4J8WB 3AZLD 5B24B 1U35C 4X23A 4XZQC 4HGAB 4JJNC 3W98D 3C1CC 2YFVB 2HIOD 1M19A 5CPIA 1Q9CA 5B1LB 5B32G 3AV2D 3REJB 5DNNC 1ID3C 1P3OC 4LD9D 5CPJD 5C3IB 3A1KA 3AFAC 5AV5B 3AYWC 3UTAC 1AOID 2ZY3A 5B31C 5B24C 5GT3D 2F8ND 3LZ0A 4WNNA 3KWQA 3MGRC 3W99A 2ZY5A 4J8UD 3WTPE 3MNNC 3H0RC 3REJC 4NE6A 1EQZC 5AV8B 3W97D 5AY8C 5AV9C 1P34A 3REHA 5BT1D 2CV5D 1M18C 3WKJC 3AZGB 3MVDB 2G5IC 3MGSB 1A7WA 3LELD 3B0DC 5AVCB 3AZKD 4J8VA 1KX3B 5JRGB 2W8SA 1P3AA 1P3GD 3H0LC 3KUYB 1P3KC 5B1MC 3V9RB 3AZHD 5B0YD 4Z66B 2F8NH 1KX5B 4YM6B 4KGCC 3NQUB 5G49B 5JRGD 5CP6A 3O62B 5E5AB 4R8PB 3X1VA 5CPKD 3WA9C 5DNMD 3AZFD 4EO5B 3LZ1C 4CSRB 4H9QB 3UTBB 1U35A 4YS3C 2F8NK 2AROD 4XUJA 3AZMC 3MGQD 1P3PC 1F1EA 1KX4C 4KUDD 3REKA 3KXBA 4DRBA 3W96A 3UTBD 4CAYB 3B6FC 4DRAA 5GSUC 3FDDA 4WU8A 2FJ7D 2Y2OA 3VH5A 4X23C 2Y2GA 4H9RA 3LZ0B 3MGRA 2Y2KA 5B40B 1M19C 5CPIC 3NQJB 1P3IB 3X1TA 3B0BA 1ZLAB 3AZJD 5FUGA 1EQZA 3A6ND 1HQ3C 2PYOD 4QLCA 5B2IB 5GT0B 3AZLA 2ZY4A 4WU9D 3REHB 5B40D 3W98A 3X1UC 5F99D 1TZYB 2HIOA 3LZ0C 3AV1D 3KWQC 4UUZB 3W99C 4J8XD 5AV6C 5AVBC 4LD9A 5CPJA 2NZDB 5B33D 3B6GB 1P34C 5GT3A 3REHC 1P3MD 1PZRA 2F8NA 3WTPB 5KDMA 4Z5TB 4WZSB 5GXQB 3H0MC 4AWLC 1P3KA 4J8UA 2L5AA 3REIB 1P3LD 1M1AC 5B0ZB 3X1SD 3WAAB 3AZEC 3W97A 3AZNB 4KGCA 3R45A 3RELD 2NQBD 2YFWA 4KHAA 1JFIA 3X1VB 2CWEA 4J8VC 2CV5A 3LJAD 3AZIA 3EPJA 1P3AC 5B2JB 5BNVA 3WAAD 3VH5T 3AN2B 4YS3A 2RIQA 1U35B 4JJNB 4XZQB 2JCHA 4NFTA 3LELA 3C1CB 1P3BD 5CP6C 3AN2D 1N1JA 5DNNB 1ID3B 1P3OB 5GSUA 4Z2MG 1F66D 3EPKA 2IO5C 3AYWB 3AZHA 3UTAB 5B0YA 5B31B 5B32A 2ZY2A 4XUJC 5CPKA 3MGRB 3MNNB 3MGPD 3AFAD 3REKC 3KXBC 3EG5B 3W96C 1HQ3A 4J8WD 1EQZB 4WV4B 5B24D 1B67A 4E44A 5AY8B 5AV9B 4WU8C 5BO0B 3X1UA 5B1LD 3MGQA 3REJD 1M18B 2Y2JA 2RVQD 5JA4B 3WKJB 5AV6A 5AV5D 5AVBA 3UT9C 3X1TC 2FJ7A 4QLCC 3B0DB 3AZLC 3W98C 1TAFB 4G92C 2HIOC 1P3KB 5B1MB 5AV8D 3AZJA 1M1AA 3A6NA 3AZEA 2ZM5A 4LD9C 5CPJC 4KGCB 4H9PA 3R45B 3WA9B 4G91C 2XD5A 5GT3C 3LZ1B 5BNXB 3AZGD 3AZIB 3C1BA 3MVDD 3MGSD 4J8UC 4H9OA 4YS3B 3WA9D 5AVCD 3AZMB 3W97C 1KX3D 5B33A 1P3PB 1KX4B 1P3MA 3A1IA 3KUYD 1BH9B 3TU4A 3B6FB 5BT1C 2CV5C 5GSUB 4Z66D 3AZIC 3B0CT 1P3LA 1KX5D 4YM6D 5B32B 3X1SA 4X23B 5E5AD 4R8PD 3O62D 3LELC 3RELA 2NQBA 1H3OA 3AZKC 1M19B 5CPIB 1S32A 3LJAA 1HQ3B 1P3FA 4Z2MH 4X23D 2Y2PA 3AZHC 5B0YC 5B32C 3X1UB 4ZUXA 1P3BA 4WNNB 5CPKC 2BYMA 3KWQB 3W99B 5DNMC 3AZFC 5AV6B 3UT9A 5AVBB 3KFUG 2J8PA 3LZ0D 1P34B 4NE3A 4AWLB 1P3ID 1ZLAD 3MGQC 4KUDC 3MGPA 5B2ID 3AV2A 5GT0D 4J8WA 1M1AB 3AZEB 3REHD 4H9PB 2FJ7C 1AOIA 2Y2IA 2YFVA 1TZYD 5B1LA 3IP4C 4J8VB 1P3AB 3C1BB 2NZDD 5AV5A 3AZJC 3VH6W 3A6NC 3B6GD 2PYOC 3WTPD 5CP6B 4Z5TD 2HUEC 5GXQD 2XD1A 4WU9C 1P3AD 3REID 5F99C 2IO5B 3AV1C 5B0ZD 5AV8A 3C1BC 3AZND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ B;  3X1V D;  3AZK A;  5B33 C;  1S32 B;  3REK B;  5B2J D;  1P3M C;  3KXB B;  3W96 B;  3TU4 C;  1P3G A;  1U35 D;  4JJN D;  4XZQ D;  3MGS A;  4WU8 B;  3C1C D;  1P3L C;  5AVC A;  1KU5 A;  2LY8 A;  3X1S C;  4ZUX B;  1KX3 A;  5JRG A;  4H9R B;  3REL C;  5DNN D;  1ID3 D;  1P3O D;  2NQB C;  5DNM A;  3KUY A;  3AZF A;  1S32 C;  4ZBJ C;  3AYW D;  3V9R A;  3UTA D;  3UT9 B;  3X1T B;  5FUG B;  5B31 D;  3LJA C;  1P3F C;  4Z66 A;  4QLC B;  1KX5 A;  4YM6 A;  3AZL B;  3NQU A;  2ARO A;  3O62 A;  5E5A A;  3MGR D;  3W98 B;  1BH8 A;  1ULY A;  3MNN D;  4ZUX C;  4G92 B;  1P3B C;  2HIO B;  4CSR A;  1EQZ D;  4KUD A;  4H9S A;  4H9Q A;  5AY8 D;  5AV9 D;  3UTB A;  4LD9 B;  5CPJ B;  1F66 C;  4G91 B;  3VH5 W;  1AOI B;  1M18 D;  5GT3 B;  2F8N B;  3WKJ D;  5BS7 A;  4CAY A;  5KDM B;  4J8U B;  3MGP C;  3AV2 C;  4J8W C;  2PYO A;  1HTA A;  3W97 B;  4HGA C;  2YFW B;  4KHA B;  4WU9 A;  1AOI C;  5B40 A;  1JFI B;  1P3K D;  5B1M D;  5B1L C;  3NQJ A;  5F99 A;  2CV5 B;  1P3I A;  1ZLA A;  3AV1 A;  2RVQ C;  5BNV B;  5B2I A;  4J8X A;  5C3I C;  5GT0 A;  4KGC D;  3VH6 A;  4E45 A;  5AV5 C;  3LEL B;  3AZK B;  3LZ1 D;  1TZY A;  3AZI D;  4UUZ A;  1N1J B;  4YS3 D;  1P3G B;  2NZD A;  1BFM A;  5AV8 C;  3AZH B;  1WWS A;  5B0Y B;  3AZM D;  1P3P D;  1KX4 D;  3B6G A;  3WTP A;  3B6F D;  5CPK B;  4Z5T A;  5GXQ A;  5GSU D;  5DNM B;  3AZF B;  3REI A;  5B32 D;  3AZG C;  5B0Z A;  1P3G C;  3WAA A;  3MVD C;  3MGS C;  3AZN A;  2ARO B;  2BYK A;  4H9N A;  5AVC C;  1M19 D;  5CPI D;  1BH8 B;  1KX3 C;  3MGQ B;  5JRG C;  4NE5 A;  1HQ3 D;  4KUD B;  5B2J A;  3AN2 A;  3KUY C;  1F66 A;  4JJN A;  4XZQ A;  4Z66 C;  2FJ7 B;  3X1U D;  3C1C A;  1KX5 C;  4YM6 C;  2ARO C;  3KWQ D;  3O62 C;  5E5A C;  4R8P C;  3W99 D;  4EO5 C;  5AV6 D;  5DNN A;  3VH6 T;  5AVB D;  1P3O A;  1ID3 A;  1R4V A;  3AFA A;  3AYW A;  4H9S C;  3UTA A;  3AZJ B;  5B31 A;  3UTB C;  5B24 A;  3A6N B;  1P34 D;  2PYO B;  3B0C W;  2HUE B;  4WU9 B;  2JSS A;  5B31 G;  3MNN A;  3KSY A;  5F99 B;  3REJ A;  5BS7 C;  3AV1 B;  1M1A D;  3AZE D;  5AY8 A;  5AV9 A;  4H9O B;  4J8X B;  5BO0 A;  4J8V D;  5B33 B;  1B6W A;  1M18 A;  1P3M B;  5B40 C;  3C1B D;  5JA4 A;  3TU4 B;  3WKJ A;  1P3I C;  1ZLA C;  1P3L B;  5B2I C;  4J8X C;  5GT0 C;  5CP6 D;  3X1S B;  3REL B;  2NQB B;  3TU4 D;  1H3O B;  1TAF A;  1TZY C;  5B1M A;  4ZBJ B;  5CHL B;  3LJA B;  3AZG A;  1P3F B;  3MVD A;  2F8N G;  4XUJ D;  2NZD C;  3WA9 A;  2BYK B;  4H9N B;  3B6G C;  1S32 D;  3REK D;  3KXB D;  3W96 D;  3LZ1 A;  5BNX A;  1P3B B;  3WTP C;  2BYM B;  4Z5T C;  5GXQ C;  1P3F D;  4WU8 D;  3REI C;  4M6B A;  1F66 B;  5B0Z C;  3WAA C;  3AZM A;  3AZN C;  4ZUX D;  1P3P A;  5G49 A;  1KX4 A;  4R8P A;  1WWI A;  3X1V C;  1BH9 A;  3B6F A;  3X1T D;  3UT9 D;  3MGP B;  4QLC D;  5B2J C;  3AFA B;  3AV2 B;  3AN2 C;  4J8W B;  3AZL D;  5B24 B;  1U35 C;  4X23 A;  4XZQ C;  4HGA B;  4JJN C;  3W98 D;  3C1C C;  2YFV B;  2HIO D;  1M19 A;  5CPI A;  1Q9C A;  5B1L B;  5B32 G;  3AV2 D;  3REJ B;  5DNN C;  1ID3 C;  1P3O C;  4LD9 D;  5CPJ D;  5C3I B;  3AFA C;  5AV5 B;  3AYW C;  3UTA C;  1AOI D;  5B31 C;  5B24 C;  5GT3 D;  2F8N D;  3LZ0 A;  4WNN A;  3KWQ A;  3MGR C;  3W99 A;  4J8U D;  3WTP E;  3MNN C;  3REJ C;  4NE6 A;  1EQZ C;  5AV8 B;  3W97 D;  5AY8 C;  5AV9 C;  1P34 A;  3REH A;  5BT1 D;  2CV5 D;  1M18 C;  3WKJ C;  3AZG B;  3MVD B;  3MGS B;  1A7W A;  3LEL D;  3B0D C;  5AVC B;  3AZK D;  4J8V A;  1KX3 B;  5JRG B;  1P3A A;  1P3G D;  3KUY B;  1P3K C;  5B1M C;  3V9R B;  3AZH D;  5B0Y D;  4Z66 B;  2F8N H;  1KX5 B;  4YM6 B;  4KGC C;  3NQU B;  5G49 B;  5JRG D;  5CP6 A;  3O62 B;  5E5A B;  4R8P B;  3X1V A;  5CPK D;  3WA9 C;  5DNM D;  3AZF D;  4EO5 B;  3LZ1 C;  4CSR B;  4H9Q B;  3UTB B;  1U35 A;  4YS3 C;  2F8N K;  2ARO D;  4XUJ A;  3AZM C;  3MGQ D;  1P3P C;  1F1E A;  1KX4 C;  4KUD D;  3REK A;  3KXB A;  4DRB A;  3W96 A;  3UTB D;  4CAY B;  3B6F C;  4DRA A;  5GSU C;  4WU8 A;  2FJ7 D;  3VH5 A;  4X23 C;  4H9R A;  3LZ0 B;  3MGR A;  5B40 B;  1M19 C;  5CPI C;  3NQJ B;  1P3I B;  3X1T A;  3B0B A;  1ZLA B;  3AZJ D;  5FUG A;  1EQZ A;  3A6N D;  1HQ3 C;  2PYO D;  4QLC A;  5B2I B;  5GT0 B;  3AZL A;  4WU9 D;  3REH B;  5B40 D;  3W98 A;  3X1U C;  5F99 D;  1TZY B;  2HIO A;  3LZ0 C;  3AV1 D;  3KWQ C;  4UUZ B;  3W99 C;  4J8X D;  5AV6 C;  5AVB C;  4LD9 A;  5CPJ A;  2NZD B;  5B33 D;  3B6G B;  1P34 C;  5GT3 A;  3REH C;  1P3M D;  2F8N A;  3WTP B;  5KDM A;  4Z5T B;  4WZS B;  5GXQ B;  4AWL C;  1P3K A;  4J8U A;  2L5A A;  3REI B;  1P3L D;  1M1A C;  5B0Z B;  3X1S D;  3WAA B;  3AZE C;  3W97 A;  3AZN B;  4KGC A;  3R45 A;  3REL D;  2NQB D;  2YFW A;  4KHA A;  1JFI A;  3X1V B;  2CWE A;  4J8V C;  2CV5 A;  3LJA D;  3AZI A;  1P3A C;  5B2J B;  5BNV A;  3WAA D;  3VH5 T;  3AN2 B;  4YS3 A;  1U35 B;  4JJN B;  4XZQ B;  4NFT A;  3LEL A;  3C1C B;  1P3B D;  5CP6 C;  3AN2 D;  1N1J A;  5DNN B;  1ID3 B;  1P3O B;  5GSU A;  4Z2M G;  1F66 D;  2IO5 C;  3AYW B;  3AZH A;  3UTA B;  5B0Y A;  5B31 B;  5B32 A;  4XUJ C;  5CPK A;  3MGR B;  3MNN B;  3MGP D;  3AFA D;  3REK C;  3KXB C;  3W96 C;  1HQ3 A;  4J8W D;  1EQZ B;  4WV4 B;  5B24 D;  1B67 A;  4E44 A;  5AY8 B;  5AV9 B;  4WU8 C;  5BO0 B;  3X1U A;  5B1L D;  3MGQ A;  3REJ D;  1M18 B;  2RVQ D;  5JA4 B;  3WKJ B;  5AV6 A;  5AV5 D;  5AVB A;  3UT9 C;  3X1T C;  2FJ7 A;  4QLC C;  3B0D B;  3AZL C;  3W98 C;  1TAF B;  4G92 C;  2HIO C;  1P3K B;  5B1M B;  5AV8 D;  3AZJ A;  1M1A A;  3A6N A;  3AZE A;  4LD9 C;  5CPJ C;  4KGC B;  4H9P A;  3R45 B;  3WA9 B;  4G91 C;  5GT3 C;  3LZ1 B;  5BNX B;  3AZG D;  3AZI B;  3C1B A;  3MVD D;  3MGS D;  4J8U C;  4H9O A;  4YS3 B;  3WA9 D;  5AVC D;  3AZM B;  3W97 C;  1KX3 D;  5B33 A;  1P3P B;  1KX4 B;  1P3M A;  3KUY D;  1BH9 B;  3TU4 A;  3B6F B;  5BT1 C;  2CV5 C;  5GSU B;  4Z66 D;  3AZI C;  3B0C T;  1P3L A;  1KX5 D;  4YM6 D;  5B32 B;  3X1S A;  4X23 B;  5E5A D;  4R8P D;  3O62 D;  3LEL C;  3REL A;  2NQB A;  1H3O A;  3AZK C;  1M19 B;  5CPI B;  1S32 A;  3LJA A;  1HQ3 B;  1P3F A;  4Z2M H;  4X23 D;  3AZH C;  5B0Y C;  5B32 C;  3X1U B;  4ZUX A;  1P3B A;  4WNN B;  5CPK C;  2BYM A;  3KWQ B;  3W99 B;  5DNM C;  3AZF C;  5AV6 B;  3UT9 A;  5AVB B;  3LZ0 D;  1P34 B;  4NE3 A;  4AWL B;  1P3I D;  1ZLA D;  3MGQ C;  4KUD C;  3MGP A;  5B2I D;  3AV2 A;  5GT0 D;  4J8W A;  1M1A B;  3AZE B;  3REH D;  4H9P B;  2FJ7 C;  1AOI A;  2YFV A;  1TZY D;  5B1L A;  4J8V B;  1P3A B;  3C1B B;  2NZD D;  5AV5 A;  3AZJ C;  3VH6 W;  3A6N C;  3B6G D;  2PYO C;  3WTP D;  5CP6 B;  4Z5T D;  2HUE C;  5GXQ D;  4WU9 C;  1P3A D;  3REI D;  5F99 C;  2IO5 B;  3AV1 C;  5B0Z D;  5AV8 A;  3C1B C;  3AZN D; 
#chains in the Genus database with same CATH topology
 4XUJ B;  3X1V D;  3AZK A;  5B33 C;  2Y2Q A;  1S32 B;  3REK B;  5B2J D;  1P3M C;  3KXB B;  3W96 B;  3TU4 C;  2DF4 C;  1P3G A;  1U35 D;  4JJN D;  4XZQ D;  3MGS A;  4WU8 B;  3C1C D;  1P3L C;  5AVC A;  3P5J B;  3AL0 C;  1KU5 A;  2LY8 A;  3X1S C;  4ZUX B;  1KX3 A;  5JRG A;  4H9R B;  3REL C;  5DNN D;  4UPK A;  1P3O D;  1ID3 D;  2NQB C;  5DNM A;  3KUY A;  3AZF A;  1S32 C;  4ZBJ C;  3AYW D;  3V9R A;  3UTA D;  3UT9 B;  3X1T B;  5FUG B;  5B31 D;  3LJA C;  1P3F C;  4Z66 A;  4QLC B;  1KX5 A;  4YM6 A;  3AZL B;  4WJ3 C;  3NQU A;  2ARO A;  3O62 A;  5E5A A;  3MGR D;  3W98 B;  1BH8 A;  1ULY A;  3MNN D;  4ZUX C;  3EPL A;  4G92 B;  1P3B C;  2HIO B;  4CSR A;  2BG1 A;  1EQZ D;  4KUD A;  4H9S A;  4H9Q A;  5AY8 D;  5AV9 D;  3UTB A;  4LD9 B;  5CPJ B;  1F66 C;  2VQR A;  4G91 B;  3VH5 W;  1AOI B;  1M18 D;  5GT3 B;  2F8N B;  2F2A C;  3WKJ D;  5BS7 A;  4CAY A;  5KDM B;  4J8U B;  3EPH A;  3MGP C;  3AV2 C;  4J8W C;  2PYO A;  1HTA A;  2Y2N A;  3W97 B;  4HGA C;  2YFW B;  4KHA B;  4WU9 A;  1AOI C;  5B40 A;  1JFI B;  1P3K D;  5B1M D;  5B1L C;  3NQJ A;  5F99 A;  2CV5 B;  1P3I A;  1ZLA A;  3AV1 A;  2RVQ C;  5BNV B;  5B2I A;  4J8X A;  5C3I C;  5GT0 A;  4KGC D;  3VH6 A;  4E45 A;  5AV5 C;  3LEL B;  3AZK B;  3LZ1 D;  1TZY A;  3AZI D;  4UUZ A;  1N1J B;  4YS3 D;  1P3G B;  2NZD A;  1BFM A;  5AV8 C;  3AZH B;  1WWS A;  5B0Y B;  4DQY B;  3AZM D;  1P3P D;  1T3U A;  1KX4 D;  3B6G A;  3WTP A;  3B6F D;  5CPK B;  2DQN C;  4Z5T A;  5GXQ A;  5GSU D;  5DNM B;  3AZF B;  3REI A;  2Y2H A;  5B32 D;  3AZG C;  5B0Z A;  1P3G C;  3WAA A;  3MVD C;  3MGS C;  3AZN A;  2ARO B;  2BYK A;  4H9N A;  5AVC C;  1M19 D;  5CPI D;  1BH8 B;  1KX3 C;  3MGQ B;  5JRG C;  4NE5 A;  1HQ3 D;  4KUD B;  5B2J A;  2Y2M A;  3AN2 A;  3KUY C;  1F66 A;  4JJN A;  4XZQ A;  4Z66 C;  2FJ7 B;  3X1U D;  3C1C A;  1KX5 C;  4YM6 C;  2ARO C;  3KWQ D;  3O62 C;  5E5A C;  4R8P C;  3W99 D;  4EO5 C;  5AV6 D;  5DNN A;  3VH6 T;  5AVB D;  1P3O A;  1ID3 A;  1R4V A;  3AFA A;  3AYW A;  4H9S C;  3UTA A;  3AZJ B;  5B31 A;  3UTB C;  5B24 A;  3A6N B;  1P34 D;  2PYO B;  3B0C W;  2HUE B;  4WU9 B;  2JSS A;  5B31 G;  3MNN A;  3KSY A;  5F99 B;  3REJ A;  5BS7 C;  3AV1 B;  1M1A D;  2FFF B;  3AZE D;  5AY8 A;  5AV9 A;  4H9O B;  4J8X B;  5BO0 A;  2Y2L A;  2G5H C;  4J8V D;  5B33 B;  1B6W A;  1M18 A;  1P3M B;  5B40 C;  3C1B D;  5JA4 A;  3TU4 B;  3WKJ A;  1P3I C;  1ZLA C;  1P3L B;  5B2I C;  4J8X C;  5GT0 C;  2UWX A;  5CP6 D;  3X1S B;  3REL B;  2NQB B;  3TU4 D;  1H3O B;  1TAF A;  1W2E A;  1TZY C;  5B1M A;  4ZBJ B;  5CHL B;  1Z2C B;  3LJA B;  3AZG A;  1P3F B;  3MVD A;  2F8N G;  4XUJ D;  2NZD C;  3WA9 A;  2BYK B;  4H9N B;  3B6G C;  1S32 D;  3REK D;  3KXB D;  3W96 D;  3LZ1 A;  5BNX A;  1P3B B;  3WTP C;  2BYM B;  4Z5T C;  5GXQ C;  1P3F D;  4WU8 D;  3REI C;  4M6B A;  1F66 B;  5B0Z C;  3WAA C;  3AZM A;  3AZN C;  4ZUX D;  1P3P A;  5G49 A;  1KX4 A;  4R8P A;  1WWI A;  3X1V C;  1BH9 A;  3B6F A;  3X1T D;  3UT9 D;  3F6T A;  3MGP B;  4QLC D;  5B2J C;  3AFA B;  3AV2 B;  2JE5 A;  3AN2 C;  4J8W B;  3AZL D;  5B24 B;  1U35 C;  4X23 A;  4XZQ C;  4HGA B;  4JJN C;  3W98 D;  3C1C C;  2YFV B;  2HIO D;  1M19 A;  5CPI A;  1Q9C A;  5B1L B;  5B32 G;  3AV2 D;  3REJ B;  5DNN C;  1ID3 C;  1P3O C;  4LD9 D;  5CPJ D;  5C3I B;  3A1K A;  3AFA C;  5AV5 B;  3AYW C;  3UTA C;  1AOI D;  2ZY3 A;  5B31 C;  5B24 C;  5GT3 D;  2F8N D;  3LZ0 A;  4WNN A;  3KWQ A;  3MGR C;  3W99 A;  2ZY5 A;  4J8U D;  3WTP E;  3MNN C;  3H0R C;  3REJ C;  4NE6 A;  1EQZ C;  5AV8 B;  3W97 D;  5AY8 C;  5AV9 C;  1P34 A;  3REH A;  5BT1 D;  2CV5 D;  1M18 C;  3WKJ C;  3AZG B;  3MVD B;  2G5I C;  3MGS B;  1A7W A;  3LEL D;  3B0D C;  5AVC B;  3AZK D;  4J8V A;  1KX3 B;  5JRG B;  2W8S A;  1P3A A;  1P3G D;  3H0L C;  3KUY B;  1P3K C;  5B1M C;  3V9R B;  3AZH D;  5B0Y D;  4Z66 B;  2F8N H;  1KX5 B;  4YM6 B;  4KGC C;  3NQU B;  5G49 B;  5JRG D;  5CP6 A;  3O62 B;  5E5A B;  4R8P B;  3X1V A;  5CPK D;  3WA9 C;  5DNM D;  3AZF D;  4EO5 B;  3LZ1 C;  4CSR B;  4H9Q B;  3UTB B;  1U35 A;  4YS3 C;  2F8N K;  2ARO D;  4XUJ A;  3AZM C;  3MGQ D;  1P3P C;  1F1E A;  1KX4 C;  4KUD D;  3REK A;  3KXB A;  4DRB A;  3W96 A;  3UTB D;  4CAY B;  3B6F C;  4DRA A;  5GSU C;  3FDD A;  4WU8 A;  2FJ7 D;  2Y2O A;  3VH5 A;  4X23 C;  2Y2G A;  4H9R A;  3LZ0 B;  3MGR A;  2Y2K A;  5B40 B;  1M19 C;  5CPI C;  3NQJ B;  1P3I B;  3X1T A;  3B0B A;  1ZLA B;  3AZJ D;  5FUG A;  1EQZ A;  3A6N D;  1HQ3 C;  2PYO D;  4QLC A;  5B2I B;  5GT0 B;  3AZL A;  2ZY4 A;  4WU9 D;  3REH B;  5B40 D;  3W98 A;  3X1U C;  5F99 D;  1TZY B;  2HIO A;  3LZ0 C;  3AV1 D;  3KWQ C;  4UUZ B;  3W99 C;  4J8X D;  5AV6 C;  5AVB C;  4LD9 A;  5CPJ A;  2NZD B;  5B33 D;  3B6G B;  1P34 C;  5GT3 A;  3REH C;  1P3M D;  1PZR A;  2F8N A;  3WTP B;  5KDM A;  4Z5T B;  4WZS B;  5GXQ B;  3H0M C;  4AWL C;  1P3K A;  4J8U A;  2L5A A;  3REI B;  1P3L D;  1M1A C;  5B0Z B;  3X1S D;  3WAA B;  3AZE C;  3W97 A;  3AZN B;  4KGC A;  3R45 A;  3REL D;  2NQB D;  2YFW A;  4KHA A;  1JFI A;  3X1V B;  2CWE A;  4J8V C;  2CV5 A;  3LJA D;  3AZI A;  3EPJ A;  1P3A C;  5B2J B;  5BNV A;  3WAA D;  3VH5 T;  3AN2 B;  4YS3 A;  2RIQ A;  1U35 B;  4JJN B;  4XZQ B;  2JCH A;  4NFT A;  3LEL A;  3C1C B;  1P3B D;  5CP6 C;  3AN2 D;  1N1J A;  5DNN B;  1ID3 B;  1P3O B;  5GSU A;  4Z2M G;  1F66 D;  3EPK A;  2IO5 C;  3AYW B;  3AZH A;  3UTA B;  5B0Y A;  5B31 B;  5B32 A;  2ZY2 A;  4XUJ C;  5CPK A;  3MGR B;  3MNN B;  3MGP D;  3AFA D;  3REK C;  3KXB C;  3EG5 B;  3W96 C;  1HQ3 A;  4J8W D;  1EQZ B;  4WV4 B;  5B24 D;  1B67 A;  4E44 A;  5AY8 B;  5AV9 B;  4WU8 C;  5BO0 B;  3X1U A;  5B1L D;  3MGQ A;  3REJ D;  1M18 B;  2Y2J A;  2RVQ D;  5JA4 B;  3WKJ B;  5AV6 A;  5AV5 D;  5AVB A;  3UT9 C;  3X1T C;  2FJ7 A;  4QLC C;  3B0D B;  3AZL C;  3W98 C;  1TAF B;  4G92 C;  2HIO C;  1P3K B;  5B1M B;  5AV8 D;  3AZJ A;  1M1A A;  3A6N A;  3AZE A;  2ZM5 A;  4LD9 C;  5CPJ C;  4KGC B;  4H9P A;  3R45 B;  3WA9 B;  4G91 C;  2XD5 A;  5GT3 C;  3LZ1 B;  5BNX B;  3AZG D;  3AZI B;  3C1B A;  3MVD D;  3MGS D;  4J8U C;  4H9O A;  4YS3 B;  3WA9 D;  5AVC D;  3AZM B;  3W97 C;  1KX3 D;  5B33 A;  1P3P B;  1KX4 B;  1P3M A;  3A1I A;  3KUY D;  1BH9 B;  3TU4 A;  3B6F B;  5BT1 C;  2CV5 C;  5GSU B;  4Z66 D;  3AZI C;  3B0C T;  1P3L A;  1KX5 D;  4YM6 D;  5B32 B;  3X1S A;  4X23 B;  5E5A D;  4R8P D;  3O62 D;  3LEL C;  3REL A;  2NQB A;  1H3O A;  3AZK C;  1M19 B;  5CPI B;  1S32 A;  3LJA A;  1HQ3 B;  1P3F A;  4Z2M H;  4X23 D;  2Y2P A;  3AZH C;  5B0Y C;  5B32 C;  3X1U B;  4ZUX A;  1P3B A;  4WNN B;  5CPK C;  2BYM A;  3KWQ B;  3W99 B;  5DNM C;  3AZF C;  5AV6 B;  3UT9 A;  5AVB B;  3KFU G;  2J8P A;  3LZ0 D;  1P34 B;  4NE3 A;  4AWL B;  1P3I D;  1ZLA D;  3MGQ C;  4KUD C;  3MGP A;  5B2I D;  3AV2 A;  5GT0 D;  4J8W A;  1M1A B;  3AZE B;  3REH D;  4H9P B;  2FJ7 C;  1AOI A;  2Y2I A;  2YFV A;  1TZY D;  5B1L A;  3IP4 C;  4J8V B;  1P3A B;  3C1B B;  2NZD D;  5AV5 A;  3AZJ C;  3VH6 W;  3A6N C;  3B6G D;  2PYO C;  3WTP D;  5CP6 B;  4Z5T D;  2HUE C;  5GXQ D;  2XD1 A;  4WU9 C;  1P3A D;  3REI D;  5F99 C;  2IO5 B;  3AV1 C;  5B0Z D;  5AV8 A;  3C1B C;  3AZN D; 
#chains in the Genus database with same CATH homology
 4XUJ B;  3X1V D;  3AZK A;  5B33 C;  2Y2Q A;  1S32 B;  3REK B;  5B2J D;  1P3M C;  3KXB B;  3W96 B;  3TU4 C;  2DF4 C;  1P3G A;  1U35 D;  4JJN D;  4XZQ D;  3MGS A;  4WU8 B;  3C1C D;  1P3L C;  5AVC A;  3P5J B;  3AL0 C;  1KU5 A;  2LY8 A;  3X1S C;  4ZUX B;  1KX3 A;  5JRG A;  4H9R B;  3REL C;  5DNN D;  4UPK A;  1P3O D;  1ID3 D;  2NQB C;  5DNM A;  3KUY A;  3AZF A;  1S32 C;  4ZBJ C;  3AYW D;  3V9R A;  3UTA D;  3UT9 B;  3X1T B;  5FUG B;  5B31 D;  3LJA C;  1P3F C;  4Z66 A;  4QLC B;  1KX5 A;  4YM6 A;  3AZL B;  4WJ3 C;  3NQU A;  2ARO A;  3O62 A;  5E5A A;  3MGR D;  3W98 B;  1BH8 A;  1ULY A;  3MNN D;  4ZUX C;  3EPL A;  4G92 B;  1P3B C;  2HIO B;  4CSR A;  2BG1 A;  1EQZ D;  4KUD A;  4H9S A;  4H9Q A;  5AY8 D;  5AV9 D;  3UTB A;  4LD9 B;  5CPJ B;  1F66 C;  2VQR A;  4G91 B;  3VH5 W;  1AOI B;  1M18 D;  5GT3 B;  2F8N B;  2F2A C;  3WKJ D;  5BS7 A;  4CAY A;  5KDM B;  4J8U B;  3EPH A;  3MGP C;  3AV2 C;  4J8W C;  2PYO A;  1HTA A;  2Y2N A;  3W97 B;  4HGA C;  2YFW B;  4KHA B;  4WU9 A;  1AOI C;  5B40 A;  1JFI B;  1P3K D;  5B1M D;  5B1L C;  3NQJ A;  5F99 A;  2CV5 B;  1P3I A;  1ZLA A;  3AV1 A;  2RVQ C;  5BNV B;  5B2I A;  4J8X A;  5C3I C;  5GT0 A;  4KGC D;  3VH6 A;  4E45 A;  5AV5 C;  3LEL B;  3AZK B;  3LZ1 D;  1TZY A;  3AZI D;  4UUZ A;  1N1J B;  4YS3 D;  1P3G B;  2NZD A;  1BFM A;  5AV8 C;  3AZH B;  1WWS A;  5B0Y B;  4DQY B;  3AZM D;  1P3P D;  1T3U A;  1KX4 D;  3B6G A;  3WTP A;  3B6F D;  5CPK B;  2DQN C;  4Z5T A;  5GXQ A;  5GSU D;  5DNM B;  3AZF B;  3REI A;  2Y2H A;  5B32 D;  3AZG C;  5B0Z A;  1P3G C;  3WAA A;  3MVD C;  3MGS C;  3AZN A;  2ARO B;  2BYK A;  4H9N A;  5AVC C;  1M19 D;  5CPI D;  1BH8 B;  1KX3 C;  3MGQ B;  5JRG C;  4NE5 A;  1HQ3 D;  4KUD B;  5B2J A;  2Y2M A;  3AN2 A;  3KUY C;  1F66 A;  4JJN A;  4XZQ A;  4Z66 C;  2FJ7 B;  3X1U D;  3C1C A;  1KX5 C;  4YM6 C;  2ARO C;  3KWQ D;  3O62 C;  5E5A C;  4R8P C;  3W99 D;  4EO5 C;  5AV6 D;  5DNN A;  3VH6 T;  5AVB D;  1P3O A;  1ID3 A;  1R4V A;  3AFA A;  3AYW A;  4H9S C;  3UTA A;  3AZJ B;  5B31 A;  3UTB C;  5B24 A;  3A6N B;  1P34 D;  2PYO B;  3B0C W;  2HUE B;  4WU9 B;  2JSS A;  5B31 G;  3MNN A;  3KSY A;  5F99 B;  3REJ A;  5BS7 C;  3AV1 B;  1M1A D;  2FFF B;  3AZE D;  5AY8 A;  5AV9 A;  4H9O B;  4J8X B;  5BO0 A;  2Y2L A;  2G5H C;  4J8V D;  5B33 B;  1B6W A;  1M18 A;  1P3M B;  5B40 C;  3C1B D;  5JA4 A;  3TU4 B;  3WKJ A;  1P3I C;  1ZLA C;  1P3L B;  5B2I C;  4J8X C;  5GT0 C;  2UWX A;  5CP6 D;  3X1S B;  3REL B;  2NQB B;  3TU4 D;  1H3O B;  1TAF A;  1W2E A;  1TZY C;  5B1M A;  4ZBJ B;  5CHL B;  1Z2C B;  3LJA B;  3AZG A;  1P3F B;  3MVD A;  2F8N G;  4XUJ D;  2NZD C;  3WA9 A;  2BYK B;  4H9N B;  3B6G C;  1S32 D;  3REK D;  3KXB D;  3W96 D;  3LZ1 A;  5BNX A;  1P3B B;  3WTP C;  2BYM B;  4Z5T C;  5GXQ C;  1P3F D;  4WU8 D;  3REI C;  4M6B A;  1F66 B;  5B0Z C;  3WAA C;  3AZM A;  3AZN C;  4ZUX D;  1P3P A;  5G49 A;  1KX4 A;  4R8P A;  1WWI A;  3X1V C;  1BH9 A;  3B6F A;  3X1T D;  3UT9 D;  3F6T A;  3MGP B;  4QLC D;  5B2J C;  3AFA B;  3AV2 B;  2JE5 A;  3AN2 C;  4J8W B;  3AZL D;  5B24 B;  1U35 C;  4X23 A;  4XZQ C;  4HGA B;  4JJN C;  3W98 D;  3C1C C;  2YFV B;  2HIO D;  1M19 A;  5CPI A;  1Q9C A;  5B1L B;  5B32 G;  3AV2 D;  3REJ B;  5DNN C;  1ID3 C;  1P3O C;  4LD9 D;  5CPJ D;  5C3I B;  3A1K A;  3AFA C;  5AV5 B;  3AYW C;  3UTA C;  1AOI D;  2ZY3 A;  5B31 C;  5B24 C;  5GT3 D;  2F8N D;  3LZ0 A;  4WNN A;  3KWQ A;  3MGR C;  3W99 A;  2ZY5 A;  4J8U D;  3WTP E;  3MNN C;  3H0R C;  3REJ C;  4NE6 A;  1EQZ C;  5AV8 B;  3W97 D;  5AY8 C;  5AV9 C;  1P34 A;  3REH A;  5BT1 D;  2CV5 D;  1M18 C;  3WKJ C;  3AZG B;  3MVD B;  2G5I C;  3MGS B;  1A7W A;  3LEL D;  3B0D C;  5AVC B;  3AZK D;  4J8V A;  1KX3 B;  5JRG B;  2W8S A;  1P3A A;  1P3G D;  3H0L C;  3KUY B;  1P3K C;  5B1M C;  3V9R B;  3AZH D;  5B0Y D;  4Z66 B;  2F8N H;  1KX5 B;  4YM6 B;  4KGC C;  3NQU B;  5G49 B;  5JRG D;  5CP6 A;  3O62 B;  5E5A B;  4R8P B;  3X1V A;  5CPK D;  3WA9 C;  5DNM D;  3AZF D;  4EO5 B;  3LZ1 C;  4CSR B;  4H9Q B;  3UTB B;  1U35 A;  4YS3 C;  2F8N K;  2ARO D;  4XUJ A;  3AZM C;  3MGQ D;  1P3P C;  1F1E A;  1KX4 C;  4KUD D;  3REK A;  3KXB A;  4DRB A;  3W96 A;  3UTB D;  4CAY B;  3B6F C;  4DRA A;  5GSU C;  3FDD A;  4WU8 A;  2FJ7 D;  2Y2O A;  3VH5 A;  4X23 C;  2Y2G A;  4H9R A;  3LZ0 B;  3MGR A;  2Y2K A;  5B40 B;  1M19 C;  5CPI C;  3NQJ B;  1P3I B;  3X1T A;  3B0B A;  1ZLA B;  3AZJ D;  5FUG A;  1EQZ A;  3A6N D;  1HQ3 C;  2PYO D;  4QLC A;  5B2I B;  5GT0 B;  3AZL A;  2ZY4 A;  4WU9 D;  3REH B;  5B40 D;  3W98 A;  3X1U C;  5F99 D;  1TZY B;  2HIO A;  3LZ0 C;  3AV1 D;  3KWQ C;  4UUZ B;  3W99 C;  4J8X D;  5AV6 C;  5AVB C;  4LD9 A;  5CPJ A;  2NZD B;  5B33 D;  3B6G B;  1P34 C;  5GT3 A;  3REH C;  1P3M D;  1PZR A;  2F8N A;  3WTP B;  5KDM A;  4Z5T B;  4WZS B;  5GXQ B;  3H0M C;  4AWL C;  1P3K A;  4J8U A;  2L5A A;  3REI B;  1P3L D;  1M1A C;  5B0Z B;  3X1S D;  3WAA B;  3AZE C;  3W97 A;  3AZN B;  4KGC A;  3R45 A;  3REL D;  2NQB D;  2YFW A;  4KHA A;  1JFI A;  3X1V B;  2CWE A;  4J8V C;  2CV5 A;  3LJA D;  3AZI A;  3EPJ A;  1P3A C;  5B2J B;  5BNV A;  3WAA D;  3VH5 T;  3AN2 B;  4YS3 A;  2RIQ A;  1U35 B;  4JJN B;  4XZQ B;  2JCH A;  4NFT A;  3LEL A;  3C1C B;  1P3B D;  5CP6 C;  3AN2 D;  1N1J A;  5DNN B;  1ID3 B;  1P3O B;  5GSU A;  4Z2M G;  1F66 D;  3EPK A;  2IO5 C;  3AYW B;  3AZH A;  3UTA B;  5B0Y A;  5B31 B;  5B32 A;  2ZY2 A;  4XUJ C;  5CPK A;  3MGR B;  3MNN B;  3MGP D;  3AFA D;  3REK C;  3KXB C;  3EG5 B;  3W96 C;  1HQ3 A;  4J8W D;  1EQZ B;  4WV4 B;  5B24 D;  1B67 A;  4E44 A;  5AY8 B;  5AV9 B;  4WU8 C;  5BO0 B;  3X1U A;  5B1L D;  3MGQ A;  3REJ D;  1M18 B;  2Y2J A;  2RVQ D;  5JA4 B;  3WKJ B;  5AV6 A;  5AV5 D;  5AVB A;  3UT9 C;  3X1T C;  2FJ7 A;  4QLC C;  3B0D B;  3AZL C;  3W98 C;  1TAF B;  4G92 C;  2HIO C;  1P3K B;  5B1M B;  5AV8 D;  3AZJ A;  1M1A A;  3A6N A;  3AZE A;  2ZM5 A;  4LD9 C;  5CPJ C;  4KGC B;  4H9P A;  3R45 B;  3WA9 B;  4G91 C;  2XD5 A;  5GT3 C;  3LZ1 B;  5BNX B;  3AZG D;  3AZI B;  3C1B A;  3MVD D;  3MGS D;  4J8U C;  4H9O A;  4YS3 B;  3WA9 D;  5AVC D;  3AZM B;  3W97 C;  1KX3 D;  5B33 A;  1P3P B;  1KX4 B;  1P3M A;  3A1I A;  3KUY D;  1BH9 B;  3TU4 A;  3B6F B;  5BT1 C;  2CV5 C;  5GSU B;  4Z66 D;  3AZI C;  3B0C T;  1P3L A;  1KX5 D;  4YM6 D;  5B32 B;  3X1S A;  4X23 B;  5E5A D;  4R8P D;  3O62 D;  3LEL C;  3REL A;  2NQB A;  1H3O A;  3AZK C;  1M19 B;  5CPI B;  1S32 A;  3LJA A;  1HQ3 B;  1P3F A;  4Z2M H;  4X23 D;  2Y2P A;  3AZH C;  5B0Y C;  5B32 C;  3X1U B;  4ZUX A;  1P3B A;  4WNN B;  5CPK C;  2BYM A;  3KWQ B;  3W99 B;  5DNM C;  3AZF C;  5AV6 B;  3UT9 A;  5AVB B;  3KFU G;  2J8P A;  3LZ0 D;  1P34 B;  4NE3 A;  4AWL B;  1P3I D;  1ZLA D;  3MGQ C;  4KUD C;  3MGP A;  5B2I D;  3AV2 A;  5GT0 D;  4J8W A;  1M1A B;  3AZE B;  3REH D;  4H9P B;  2FJ7 C;  1AOI A;  2Y2I A;  2YFV A;  1TZY D;  5B1L A;  3IP4 C;  4J8V B;  1P3A B;  3C1B B;  2NZD D;  5AV5 A;  3AZJ C;  3VH6 W;  3A6N C;  3B6G D;  2PYO C;  3WTP D;  5CP6 B;  4Z5T D;  2HUE C;  5GXQ D;  2XD1 A;  4WU9 C;  1P3A D;  3REI D;  5F99 C;  2IO5 B;  3AV1 C;  5B0Z D;  5AV8 A;  3C1B C;  3AZN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...