3B6GA

Nucleosome core particle treated with oxaliplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 103
sequence length 103
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6gA00
3AZNB 2HUEB 5B1LA 1P3BA 3LJAA 3X1UB 5B2IA 5FUGB 1JFIB 4H9RB 3WAAB 2NQBC 3LELB 2NQBD 3V9RB 3W99C 4H9OA 3W99D 4E45A 3REKC 3REKD 1TZYA 5AVCA 3AZIA 3O62C 3O62D 3AZNC 3KUYA 4J8WC 3AZND 4J8WD 5B32G 4X23A 1M19B 1ID3B 5AV8A 3C1CB 3R45A 1KX4C 5B2JC 5C3IB 1KX4D 5B2JD 1EQZA 2YFWA 5B24B 3X1SB 5AV6D 3LELC 1P3IC 3LELD 1P3ID 4XZQB 3MGQB 1HTAA 1BH9B 3A6NB 3VH6A 2NQBA 3W99A 3REKA 3WA9B 5B0YB 1M19C 3W98C 1M19D 3W98D 2YFVB 5CPIC 3C1CC 1P3GB 5CPID 1N1JA 1U35B 3AV2C 3AV2D 5B24C 3O62A 3X1SC 3X1SD 3AZNA 4J8WA 3MGQC 3X1TB 4WU9B 3MGQD 1P3PC 1P3PD 5JA4A 1KX4A 5B2JA 3KWQC 3KWQD 4H9NA 3LELA 4DRBA 1P3IA 5CP6C 5CP6D 4R8PC 3UT9C 4R8PD 3UT9D 1M1AB 2BYMA 3W97C 1P3GC 1WWIA 3UTBB 5B31G 1B6WA 1P3GD 5BNVA 1M18B 3B6GB 3MGRB 3W97D 1P3KD 3X1VB 3UTAC 4WZSB 2IO5C 4QLCB 3UTAD 4M6BA 3X1TC 4WU9C 3X1TD 4WU9D 1M19A 3W98A 4ZBJB 3C1CA 5CPIA 1P3FC 5GXQB 5GT3C 1P3FD 3AV2A 5GT3D 5G49A 3X1SA 5BT1C 3MGQA 5B33C 1P3PA 5B33D 5B1LB 3LJAB 3AZJC 1M1AC 1M1AD 3LZ0C 3AZJD 2F8ND 1P3LC 3LZ0D 4G91C 1P3LD 3KWQA 3TU4B 1P3MB 5BNXA 5CP6A 4R8PA 3UT9A 3VH6T 4QLCC 4QLCD 4NFTA 1TZYB 3AZIB 3W97A 1P3GA 3AZGD 4HGAC 1P3KA 4H9QA 4JJND 3UTAA 3X1TA 4WU9A 4Z2MH 2AROD 3R45B 1P3FA 5GT3A 3AZLC 4J8UC 5E5AC 5CPJD 4J8UD 2YFWB 5E5AD 3TU4C 5JRGC 3MNNC 4J8VC 3TU4D 5JRGD 3MNND 4J8VD 1P3MC 1P3MD 5B0ZB 5B33A 4YS3C 1ZLAC 3VH5T 1P34B 4YS3D 1ZLAD 1M1AA 3AZJA 2F8NA 3LZ0A 1P3LA 4E44A 3AZLD 5CPKC 3REHD 5CPKD 3W99B 2CV5C 4QLCA 3REKB 2CV5D 1P3OD 3AZGA 1N1JB 4JJNA 3RELC 3O62B 3RELD 4J8WB 5B0ZC 3MGSC 5B0ZD 3MGSD 1P34C 1P34D 3C1BC 5JA4B 3C1BD 1KX4B 3AZLA 2BYKA 2LY8A 5B2JB 5E5AA 4J8UA 3TU4A 5AV6B 5JRGA 4H9NB 3MNNA 4J8VA 4XUJC 1P3MA 1P3IB 4XUJD 4YS3A 5DNNC 1ZLAA 3WKJB 1KU5A 5DNND 2RVQD 2BYMB 4NE3A 3REHA 1R4VA 5CPKA 5BNVB 5DNMD 2CV5A 2F8NH 3W98B 5CPIB 5B1MC 4J8XB 3AV2B 5B1MD 5G49B 5AV6C 3RELA 1B67A 5B0ZA 3MGSA 3WKJC 1P34A 1P3PB 3WKJD 3C1BA 3KXBC 3KXBD 3KWQB 4XUJA 5AVBC 5BNXB 5CP6B 5AVBD 4R8PB 5DNNA 3B0CT 3UT9B 3AN2C 3AN2D 2CWEA 1P3AC 1P3AD 3W97B 4G92C 4J8XC 3REIC 4J8XD 5DNMA 3REID 1P3KB 1KX5C 4H9QB 3LZ1C 1KX5D 2FJ7C 3LZ1D 3B0BA 3UTAB 2FJ7D 2IO5B 1KX3C 4CAYA 3AZKC 2HIOD 2L5AA 1KX3D 3AZKD 5B31C 1BFMA 5B31D 3REJC 1P3FB 5B1MA 5GT3B 3REJD 3VH5A 3WTPC 5AV6A 3WTPD 5B33B 3WKJA 1BH8A 2F8NB 3AZJB 3LZ0B 3KXBA 1P3LB 4G91B 5AV9C 4AWLB 3MGPC 5AV9D 3MGPD 4Z2MG 5AVBA 1P3KC 3MVDB 3AN2A 4WV4B 1P3AA 3AZGB 4J8XA 3REIA 4HGAB 1KX5A 4JJNB 3LZ1A 4YM6C 2FJ7A 4YM6D 1KX3A 3VH6W 3AZKA 2AROB 5B31A 5KDMA 1Q9CA 3REJA 3AZLB 2BYKB 4J8UB 5CPJB 5E5AB 3WTPA 5JRGB 3MNNB 4J8VB 3WTPE 4AWLC 4YS3B 1ZLAB 3MVDC 1EQZB 3MVDD 1H3OB 4KUDB 1TAFA 5AV9A 3AZGC 3MGPA 3REHB 5CPKB 1F66C 4JJNC 1F66D 3AZMC 3AZMD 2CV5B 4ZUXB 1P3OB 2PYOC 3B6FB 3VH5W 2PYOD 2AROC 3AFAB 1HQ3C 1A7WA 5CPJC 1HQ3D 3RELB 4YM6A 3MGSB 5BO0A 4H9PA 5F99B 4KUDC 3C1BB 4WU8C 4KUDD 4EO5C 4WU8D 4XUJB 5B32B 3REHC 5AV5B 3NQUA 4WNNA 5DNNB 3MVDA 3AZHB 4ZUXC 1P3OC 5CHLB 4ZUXD 3B6FC 3B6FD 4Z5TB 3AFAC 3AFAD 5DNMB 1F66A 4KGCB 5B40C 3AZMA 5B40D 2PYOA 4CAYB 5F99C 2AROA 5AY8C 5F99D 5AY8D 1HQ3A 5B1MB 5CPJA 4DRAA 4LD9B 3B0DC 5GT0B 5B32C 3AYWC 5B32D 3AYWD 4Z66C 5AV5C 4Z66D 4NE5A 5AV5D 3AZHC 1BH8B 2RVQC 1H3OA 3AZHD 4KUDA 4WU8A 3KXBB 3KUYD 2NZDB 4Z5TC 4Z5TD 5AVBB 5DNMC 3W96C 2JSSA 4KGCC 3W96D 4KGCD 1F1EA 3AN2B 4CSRB 4ZUXA 1P3OA 3B6FA 1S32C 1S32D 1P3AB 3AFAA 4G92B 3REIB 3AZEC 3NQJB 1KX5B 3LZ1B 5B40A 3AZED 3AV1C 3AV1D 5GT0C 2FJ7B 4LD9C 4LD9D 5GT0D 1KX3B 2HIOB 3B0CW 3AZKB 5F99A 5AY8A 5B31B 5KDMB 3REJB 2NZDC 2NZDD 3AZFC 3WTPB 3AZFD 5B32A 3AYWA 4Z66A 5AV5A 3AZHA 1TAFB 2HUEC 4Z5TA 3X1UC 5AV9B 3X1UD 3MGPB 3W96A 4KGCA 3WAAC 3WAAD 2HIOC 1S32A 3AZEA 3AV1A 4YM6B 4LD9A 5GT0A 5BO0B 4H9PB 4KHAA 4UUZA 2NZDA 3AZFA 1ID3C 1ID3D 3C1CD 5C3IC 3NQUB 4WNNB 4CSRA 5B24D 5GSUB 4XZQC 5BS7C 4XZQD 3X1UA 3A6NC 5FUGA 3A6ND 3NQJA 1JFIA 4H9RA 1F66B 3AZMB 1WWSA 3WAAA 2PYOB 3V9RA 2HIOA 3WA9C 1HQ3B 5B0YC 3WA9D 5B0YD 1ULYA 1U35C 1U35D 4H9SC 4WU8B 5GSUC 4EO5B 5GSUD 1AOIB 1ID3A 5B24A 4XZQA 5BT1D 5BS7A 1BH9A 1P3BB 5B2IB 3A6NA 2F8NK 5B40B 3UTBC 3B6GC 3UTBD 1M18C 3B6GD 3MGRC 1M18D 4H9OB 3X1VC 3MGRD 5AY8B 3X1VD 3WA9A 5B0YA 1AOIC 1AOID 5AVCB 2YFVA 3B0DB 4ZBJC 5GXQC 3AYWB 2F8NG 1U35A 5GXQD 4Z66B 4H9SA 4NE6A 3KUYB 5GSUA 4X23B 5B1LC 1P3BC 3LJAC 5B1LD 1P3BD 5AV8B 5B2IC 3LJAD 5B2ID 3W96B 1S32B 3AZEB 3AV1B 1TZYC 5AVCC 3AZIC 1TZYD 5AVCD 3UTBA 3AZID 3KSYA 3B6GA 2NQBB 1M18A 3MGRA 3X1VA 3KUYC 4KHAB 4UUZB 4X23C 1AOIA 3AZFB 4X23D 5AV8C 5AV8D 5GXQA 1EQZC 1EQZD
chains in the Genus database with same CATH superfamily
3AZNB 2HUEB 5B1LA 1P3BA 3LJAA 3X1UB 5B2IA 4WJ3C 5FUGB 1JFIB 4H9RB 3WAAB 2NQBC 3LELB 2NQBD 3V9RB 3W99C 4H9OA 3W99D 4E45A 3REKC 3REKD 2Y2HA 1TZYA 5AVCA 3AZIA 3O62C 3O62D 3AZNC 3KUYA 4J8WC 3AZND 4J8WD 5B32G 4X23A 1M19B 1ID3B 5AV8A 3C1CB 3R45A 1KX4C 5B2JC 5C3IB 1KX4D 5B2JD 1EQZA 2YFWA 5B24B 3X1SB 5AV6D 3LELC 1P3IC 3LELD 1P3ID 4XZQB 3MGQB 1HTAA 1BH9B 3A6NB 3VH6A 2VQRA 2NQBA 2DQNC 3W99A 2ZM5A 2XD1A 3EG5B 3REKA 3WA9B 5B0YB 1M19C 3W98C 1M19D 3W98D 2YFVB 5CPIC 3C1CC 1P3GB 5CPID 1N1JA 1U35B 3AV2C 3AV2D 5B24C 3O62A 3X1SC 3X1SD 3AZNA 4J8WA 3MGQC 4DQYB 3X1TB 4UPKA 3MGQD 4WU9B 1P3PC 1P3PD 3H0MC 5JA4A 1KX4A 5B2JA 3KWQC 3KWQD 1W2EA 4H9NA 3LELA 4DRBA 1P3IA 5CP6C 5CP6D 4R8PC 3UT9C 4R8PD 3UT9D 1M1AB 2BYMA 3W97C 1P3GC 1WWIA 3UTBB 5B31G 1B6WA 1P3GD 5BNVA 1M18B 3B6GB 3MGRB 3W97D 1P3KD 3X1VB 3UTAC 4WZSB 2IO5C 4QLCB 3UTAD 4M6BA 3X1TC 4WU9C 3X1TD 4WU9D 1M19A 3W98A 1Z2CB 4ZBJB 3C1CA 5CPIA 1P3FC 5GXQB 5GT3C 1P3FD 3AV2A 5GT3D 5G49A 3X1SA 5BT1C 3MGQA 5B33C 1P3PA 5B33D 5B1LB 2ZY5A 3LJAB 3AZJC 1M1AC 1M1AD 3LZ0C 3AZJD 2F8ND 1P3LC 3LZ0D 4G91C 1P3LD 3P5JB 3KWQA 3TU4B 1P3MB 2Y2OA 5BNXA 5CP6A 4R8PA 3UT9A 3VH6T 4QLCC 4QLCD 4NFTA 1TZYB 3AZIB 3W97A 1P3GA 3AZGD 4HGAC 1P3KA 4H9QA 4JJND 3UTAA 3X1TA 4WU9A 4Z2MH 2AROD 3R45B 2JCHA 1P3FA 5GT3A 3AZLC 4J8UC 5E5AC 5CPJD 4J8UD 2YFWB 5E5AD 3TU4C 5JRGC 3MNNC 4J8VC 3TU4D 5JRGD 3MNND 4J8VD 1P3MC 1P3MD 5B0ZB 5B33A 4YS3C 1ZLAC 3VH5T 1P34B 4YS3D 3H0LC 1ZLAD 1M1AA 3AZJA 2F8NA 3LZ0A 2ZY4A 1P3LA 4E44A 3AZLD 5CPKC 2ZY3A 3F6TA 3REHD 5CPKD 3W99B 3A1IA 2CV5C 4QLCA 3REKB 2CV5D 1P3OD 3AZGA 1N1JB 4JJNA 3RELC 3O62B 3RELD 4J8WB 5B0ZC 3MGSC 5B0ZD 3MGSD 1P34C 1P34D 3C1BC 5JA4B 3C1BD 1KX4B 3AZLA 2BYKA 2LY8A 5B2JB 5E5AA 4J8UA 3TU4A 5AV6B 5JRGA 4H9NB 3MNNA 4J8VA 4XUJC 1P3MA 1P3IB 4XUJD 4YS3A 5DNNC 1ZLAA 3WKJB 1KU5A 5DNND 2RVQD 2BYMB 4NE3A 3REHA 1R4VA 5CPKA 5BNVB 5DNMD 2CV5A 3EPJA 2F8NH 3W98B 5CPIB 5B1MC 4J8XB 3AV2B 2J8PA 5B1MD 3EPKA 5G49B 5AV6C 3RELA 1B67A 5B0ZA 3MGSA 3WKJC 1P34A 1P3PB 3WKJD 3C1BA 3KXBC 3KXBD 3EPHA 3KWQB 4XUJA 5AVBC 5BNXB 5CP6B 2BG1A 5AVBD 4R8PB 5DNNA 3B0CT 3UT9B 3AN2C 3AN2D 2CWEA 1P3AC 1P3AD 3W97B 4G92C 4J8XC 3REIC 4J8XD 5DNMA 3REID 1P3KB 1KX5C 4H9QB 3LZ1C 1KX5D 2FJ7C 3LZ1D 3B0BA 3UTAB 2FJ7D 2IO5B 1KX3C 4CAYA 3AZKC 2HIOD 2L5AA 1KX3D 3AZKD 5B31C 2Y2IA 1BFMA 5B31D 3REJC 1P3FB 5B1MA 5GT3B 3REJD 3VH5A 3WTPC 5AV6A 3WTPD 2Y2LA 5B33B 3WKJA 1BH8A 2F8NB 3AZJB 3LZ0B 3KXBA 1P3LB 4G91B 5AV9C 4AWLB 3MGPC 5AV9D 3MGPD 4Z2MG 2RIQA 5AVBA 1P3KC 3MVDB 3AN2A 3EPLA 4WV4B 1P3AA 3AZGB 4J8XA 3REIA 4HGAB 1KX5A 4JJNB 3LZ1A 4YM6C 2FJ7A 4YM6D 1KX3A 2DF4C 3VH6W 3AZKA 2AROB 5B31A 5KDMA 1Q9CA 3REJA 3AZLB 2BYKB 4J8UB 5CPJB 5E5AB 3WTPA 2W8SA 2G5IC 5JRGB 3WTPE 3MNNB 4J8VB 4AWLC 4YS3B 1ZLAB 3MVDC 1EQZB 3MVDD 1H3OB 4KUDB 1TAFA 2Y2JA 5AV9A 3AZGC 3MGPA 3REHB 5CPKB 1F66C 4JJNC 1F66D 3AZMC 3AZMD 2CV5B 4ZUXB 1P3OB 2PYOC 3B6FB 3VH5W 2PYOD 2AROC 3AFAB 1HQ3C 1A7WA 5CPJC 1HQ3D 3RELB 4YM6A 3MGSB 5BO0A 4H9PA 5F99B 2FFFB 4KUDC 3C1BB 4WU8C 4KUDD 4EO5C 4WU8D 4XUJB 5B32B 3REHC 5AV5B 3NQUA 4WNNA 5DNNB 3MVDA 3AZHB 4ZUXC 1P3OC 5CHLB 4ZUXD 3B6FC 3B6FD 4Z5TB 3AFAC 3AFAD 5DNMB 1F66A 4KGCB 5B40C 3AZMA 5B40D 2PYOA 4CAYB 2Y2PA 5F99C 2AROA 5AY8C 5F99D 5AY8D 1HQ3A 5B1MB 5CPJA 4DRAA 4LD9B 3B0DC 5GT0B 5B32C 3AYWC 5B32D 3AYWD 4Z66C 5AV5C 4Z66D 4NE5A 5AV5D 3AZHC 1BH8B 2RVQC 1H3OA 3AZHD 4KUDA 4WU8A 3KXBB 3KUYD 2NZDB 4Z5TC 4Z5TD 5AVBB 5DNMC 3W96C 2JSSA 4KGCC 3W96D 4KGCD 1F1EA 3AN2B 4CSRB 4ZUXA 1P3OA 3B6FA 1S32C 1S32D 1P3AB 3AFAA 4G92B 3REIB 3AZEC 3NQJB 1KX5B 3LZ1B 5B40A 3AZED 3AV1C 2Y2MA 5GT0C 3AV1D 2FJ7B 4LD9C 5GT0D 4LD9D 3KFUG 1KX3B 2HIOB 3B0CW 3AZKB 5F99A 3AL0C 5AY8A 5B31B 5KDMB 3REJB 2NZDC 2NZDD 3AZFC 3WTPB 3AZFD 5B32A 3AYWA 4Z66A 5AV5A 3AZHA 1TAFB 2HUEC 4Z5TA 3X1UC 5AV9B 3X1UD 3MGPB 3W96A 4KGCA 3WAAC 3WAAD 2HIOC 1S32A 3AZEA 3AV1A 4YM6B 1T3UA 3A1KA 4LD9A 5GT0A 5BO0B 4H9PB 4KHAA 4UUZA 2NZDA 3AZFA 1ID3C 1ID3D 3H0RC 3C1CD 5C3IC 3NQUB 4WNNB 2ZY2A 4CSRA 5B24D 5GSUB 4XZQC 5BS7C 4XZQD 3X1UA 3A6NC 5FUGA 3A6ND 3NQJA 1JFIA 4H9RA 1F66B 3AZMB 1WWSA 3WAAA 2PYOB 3V9RA 2HIOA 3WA9C 1HQ3B 5B0YC 3WA9D 5B0YD 1ULYA 1U35C 1U35D 4H9SC 4WU8B 5GSUC 4EO5B 5GSUD 1AOIB 1ID3A 3FDDA 2XD5A 5B24A 4XZQA 5BT1D 5BS7A 2UWXA 1BH9A 1P3BB 5B2IB 3A6NA 2F8NK 5B40B 3UTBC 3B6GC 3UTBD 1M18C 3B6GD 3MGRC 1M18D 4H9OB 3X1VC 3MGRD 5AY8B 3X1VD 3WA9A 5B0YA 1AOIC 1AOID 5AVCB 2YFVA 3B0DB 4ZBJC 5GXQC 3AYWB 2F8NG 1U35A 5GXQD 4Z66B 2Y2QA 4H9SA 4NE6A 3KUYB 5GSUA 4X23B 5B1LC 1P3BC 3LJAC 5B1LD 1P3BD 5AV8B 5B2IC 2G5HC 3LJAD 5B2ID 2Y2NA 3W96B 1S32B 3IP4C 1PZRA 3AZEB 2Y2KA 1TZYC 5AVCC 3AZIC 3AV1B 1TZYD 5AVCD 3UTBA 3AZID 2F2AC 3KSYA 3B6GA 1M18A 2NQBB 3MGRA 3X1VA 2JE5A 3KUYC 4KHAB 4UUZB 4X23C 1AOIA 3AZFB 2Y2GA 4X23D 5AV8C 5AV8D 5GXQA 1EQZC 1EQZD
chains in the Genus database with same CATH topology
3AZNB 2HUEB 5B1LA 1P3BA 3LJAA 3X1UB 5B2IA 4WJ3C 5FUGB 1JFIB 4H9RB 3WAAB 2NQBC 3LELB 2NQBD 3V9RB 3W99C 4H9OA 3W99D 4E45A 3REKC 3REKD 2Y2HA 1TZYA 5AVCA 3AZIA 3O62C 3O62D 3AZNC 3KUYA 4J8WC 3AZND 4J8WD 5B32G 4X23A 1M19B 1ID3B 5AV8A 3C1CB 3R45A 1KX4C 5B2JC 5C3IB 1KX4D 5B2JD 1EQZA 2YFWA 5B24B 3X1SB 5AV6D 3LELC 1P3IC 3LELD 1P3ID 4XZQB 3MGQB 1HTAA 1BH9B 3A6NB 3VH6A 2VQRA 2NQBA 2DQNC 3W99A 2ZM5A 2XD1A 3EG5B 3REKA 3WA9B 5B0YB 1M19C 3W98C 1M19D 3W98D 2YFVB 5CPIC 3C1CC 1P3GB 5CPID 1N1JA 1U35B 3AV2C 3AV2D 5B24C 3O62A 3X1SC 3X1SD 3AZNA 4J8WA 3MGQC 4DQYB 3X1TB 4UPKA 3MGQD 4WU9B 1P3PC 1P3PD 3H0MC 5JA4A 1KX4A 5B2JA 3KWQC 3KWQD 1W2EA 4H9NA 3LELA 4DRBA 1P3IA 5CP6C 5CP6D 4R8PC 3UT9C 4R8PD 3UT9D 1M1AB 2BYMA 3W97C 1P3GC 1WWIA 3UTBB 5B31G 1B6WA 1P3GD 5BNVA 1M18B 3B6GB 3MGRB 3W97D 1P3KD 3X1VB 3UTAC 4WZSB 2IO5C 4QLCB 3UTAD 4M6BA 3X1TC 4WU9C 3X1TD 4WU9D 1M19A 3W98A 1Z2CB 4ZBJB 3C1CA 5CPIA 1P3FC 5GXQB 5GT3C 1P3FD 3AV2A 5GT3D 5G49A 3X1SA 5BT1C 3MGQA 5B33C 1P3PA 5B33D 5B1LB 2ZY5A 3LJAB 3AZJC 1M1AC 1M1AD 3LZ0C 3AZJD 2F8ND 1P3LC 3LZ0D 4G91C 1P3LD 3P5JB 3KWQA 3TU4B 1P3MB 2Y2OA 5BNXA 5CP6A 4R8PA 3UT9A 3VH6T 4QLCC 4QLCD 4NFTA 1TZYB 3AZIB 3W97A 1P3GA 3AZGD 4HGAC 1P3KA 4H9QA 4JJND 3UTAA 3X1TA 4WU9A 4Z2MH 2AROD 3R45B 2JCHA 1P3FA 5GT3A 3AZLC 4J8UC 5E5AC 5CPJD 4J8UD 2YFWB 5E5AD 3TU4C 5JRGC 3MNNC 4J8VC 3TU4D 5JRGD 3MNND 4J8VD 1P3MC 1P3MD 5B0ZB 5B33A 4YS3C 1ZLAC 3VH5T 1P34B 4YS3D 3H0LC 1ZLAD 1M1AA 3AZJA 2F8NA 3LZ0A 2ZY4A 1P3LA 4E44A 3AZLD 5CPKC 2ZY3A 3F6TA 3REHD 5CPKD 3W99B 3A1IA 2CV5C 4QLCA 3REKB 2CV5D 1P3OD 3AZGA 1N1JB 4JJNA 3RELC 3O62B 3RELD 4J8WB 5B0ZC 3MGSC 5B0ZD 3MGSD 1P34C 1P34D 3C1BC 5JA4B 3C1BD 1KX4B 3AZLA 2BYKA 2LY8A 5B2JB 5E5AA 4J8UA 3TU4A 5AV6B 5JRGA 4H9NB 3MNNA 4J8VA 4XUJC 1P3MA 1P3IB 4XUJD 4YS3A 5DNNC 1ZLAA 3WKJB 1KU5A 5DNND 2RVQD 2BYMB 4NE3A 3REHA 1R4VA 5CPKA 5BNVB 5DNMD 2CV5A 3EPJA 2F8NH 3W98B 5CPIB 5B1MC 4J8XB 3AV2B 2J8PA 5B1MD 3EPKA 5G49B 5AV6C 3RELA 1B67A 5B0ZA 3MGSA 3WKJC 1P34A 1P3PB 3WKJD 3C1BA 3KXBC 3KXBD 3EPHA 3KWQB 4XUJA 5AVBC 5BNXB 5CP6B 2BG1A 5AVBD 4R8PB 5DNNA 3B0CT 3UT9B 3AN2C 3AN2D 2CWEA 1P3AC 1P3AD 3W97B 4G92C 4J8XC 3REIC 4J8XD 5DNMA 3REID 1P3KB 1KX5C 4H9QB 3LZ1C 1KX5D 2FJ7C 3LZ1D 3B0BA 3UTAB 2FJ7D 2IO5B 1KX3C 4CAYA 3AZKC 2HIOD 2L5AA 1KX3D 3AZKD 5B31C 2Y2IA 1BFMA 5B31D 3REJC 1P3FB 5B1MA 5GT3B 3REJD 3VH5A 3WTPC 5AV6A 3WTPD 2Y2LA 5B33B 3WKJA 1BH8A 2F8NB 3AZJB 3LZ0B 3KXBA 1P3LB 4G91B 5AV9C 4AWLB 3MGPC 5AV9D 3MGPD 4Z2MG 2RIQA 5AVBA 1P3KC 3MVDB 3AN2A 3EPLA 4WV4B 1P3AA 3AZGB 4J8XA 3REIA 4HGAB 1KX5A 4JJNB 3LZ1A 4YM6C 2FJ7A 4YM6D 1KX3A 2DF4C 3VH6W 3AZKA 2AROB 5B31A 5KDMA 1Q9CA 3REJA 3AZLB 2BYKB 4J8UB 5CPJB 5E5AB 3WTPA 2W8SA 2G5IC 5JRGB 3WTPE 3MNNB 4J8VB 4AWLC 4YS3B 1ZLAB 3MVDC 1EQZB 3MVDD 1H3OB 4KUDB 1TAFA 2Y2JA 5AV9A 3AZGC 3MGPA 3REHB 5CPKB 1F66C 4JJNC 1F66D 3AZMC 3AZMD 2CV5B 4ZUXB 1P3OB 2PYOC 3B6FB 3VH5W 2PYOD 2AROC 3AFAB 1HQ3C 1A7WA 5CPJC 1HQ3D 3RELB 4YM6A 3MGSB 5BO0A 4H9PA 5F99B 2FFFB 4KUDC 3C1BB 4WU8C 4KUDD 4EO5C 4WU8D 4XUJB 5B32B 3REHC 5AV5B 3NQUA 4WNNA 5DNNB 3MVDA 3AZHB 4ZUXC 1P3OC 5CHLB 4ZUXD 3B6FC 3B6FD 4Z5TB 3AFAC 3AFAD 5DNMB 1F66A 4KGCB 5B40C 3AZMA 5B40D 2PYOA 4CAYB 2Y2PA 5F99C 2AROA 5AY8C 5F99D 5AY8D 1HQ3A 5B1MB 5CPJA 4DRAA 4LD9B 3B0DC 5GT0B 5B32C 3AYWC 5B32D 3AYWD 4Z66C 5AV5C 4Z66D 4NE5A 5AV5D 3AZHC 1BH8B 2RVQC 1H3OA 3AZHD 4KUDA 4WU8A 3KXBB 3KUYD 2NZDB 4Z5TC 4Z5TD 5AVBB 5DNMC 3W96C 2JSSA 4KGCC 3W96D 4KGCD 1F1EA 3AN2B 4CSRB 4ZUXA 1P3OA 3B6FA 1S32C 1S32D 1P3AB 3AFAA 4G92B 3REIB 3AZEC 3NQJB 1KX5B 3LZ1B 5B40A 3AZED 3AV1C 2Y2MA 5GT0C 3AV1D 2FJ7B 4LD9C 5GT0D 4LD9D 3KFUG 1KX3B 2HIOB 3B0CW 3AZKB 5F99A 3AL0C 5AY8A 5B31B 5KDMB 3REJB 2NZDC 2NZDD 3AZFC 3WTPB 3AZFD 5B32A 3AYWA 4Z66A 5AV5A 3AZHA 1TAFB 2HUEC 4Z5TA 3X1UC 5AV9B 3X1UD 3MGPB 3W96A 4KGCA 3WAAC 3WAAD 2HIOC 1S32A 3AZEA 3AV1A 4YM6B 1T3UA 3A1KA 4LD9A 5GT0A 5BO0B 4H9PB 4KHAA 4UUZA 2NZDA 3AZFA 1ID3C 1ID3D 3H0RC 3C1CD 5C3IC 3NQUB 4WNNB 2ZY2A 4CSRA 5B24D 5GSUB 4XZQC 5BS7C 4XZQD 3X1UA 3A6NC 5FUGA 3A6ND 3NQJA 1JFIA 4H9RA 1F66B 3AZMB 1WWSA 3WAAA 2PYOB 3V9RA 2HIOA 3WA9C 1HQ3B 5B0YC 3WA9D 5B0YD 1ULYA 1U35C 1U35D 4H9SC 4WU8B 5GSUC 4EO5B 5GSUD 1AOIB 1ID3A 3FDDA 2XD5A 5B24A 4XZQA 5BT1D 5BS7A 2UWXA 1BH9A 1P3BB 5B2IB 3A6NA 2F8NK 5B40B 3UTBC 3B6GC 3UTBD 1M18C 3B6GD 3MGRC 1M18D 4H9OB 3X1VC 3MGRD 5AY8B 3X1VD 3WA9A 5B0YA 1AOIC 1AOID 5AVCB 2YFVA 3B0DB 4ZBJC 5GXQC 3AYWB 2F8NG 1U35A 5GXQD 4Z66B 2Y2QA 4H9SA 4NE6A 3KUYB 5GSUA 4X23B 5B1LC 1P3BC 3LJAC 5B1LD 1P3BD 5AV8B 5B2IC 2G5HC 3LJAD 5B2ID 2Y2NA 3W96B 1S32B 3IP4C 1PZRA 3AZEB 2Y2KA 1TZYC 5AVCC 3AZIC 3AV1B 1TZYD 5AVCD 3UTBA 3AZID 2F2AC 3KSYA 3B6GA 1M18A 2NQBB 3MGRA 3X1VA 2JE5A 3KUYC 4KHAB 4UUZB 4X23C 1AOIA 3AZFB 2Y2GA 4X23D 5AV8C 5AV8D 5GXQA 1EQZC 1EQZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  2HUE B;  5B1L A;  1P3B A;  3LJA A;  3X1U B;  5B2I A;  5FUG B;  1JFI B;  4H9R B;  3WAA B;  2NQB C;  3LEL B;  2NQB D;  3V9R B;  3W99 C;  4H9O A;  3W99 D;  4E45 A;  3REK C;  3REK D;  1TZY A;  5AVC A;  3AZI A;  3O62 C;  3O62 D;  3AZN C;  3KUY A;  4J8W C;  3AZN D;  4J8W D;  5B32 G;  4X23 A;  1M19 B;  1ID3 B;  5AV8 A;  3C1C B;  3R45 A;  1KX4 C;  5B2J C;  5C3I B;  1KX4 D;  5B2J D;  1EQZ A;  2YFW A;  5B24 B;  3X1S B;  5AV6 D;  3LEL C;  1P3I C;  3LEL D;  1P3I D;  4XZQ B;  3MGQ B;  1HTA A;  1BH9 B;  3A6N B;  3VH6 A;  2NQB A;  3W99 A;  3REK A;  3WA9 B;  5B0Y B;  1M19 C;  3W98 C;  1M19 D;  3W98 D;  2YFV B;  5CPI C;  3C1C C;  1P3G B;  5CPI D;  1N1J A;  1U35 B;  3AV2 C;  3AV2 D;  5B24 C;  3O62 A;  3X1S C;  3X1S D;  3AZN A;  4J8W A;  3MGQ C;  3X1T B;  4WU9 B;  3MGQ D;  1P3P C;  1P3P D;  5JA4 A;  1KX4 A;  5B2J A;  3KWQ C;  3KWQ D;  4H9N A;  3LEL A;  4DRB A;  1P3I A;  5CP6 C;  5CP6 D;  4R8P C;  3UT9 C;  4R8P D;  3UT9 D;  1M1A B;  2BYM A;  3W97 C;  1P3G C;  1WWI A;  3UTB B;  5B31 G;  1B6W A;  1P3G D;  5BNV A;  1M18 B;  3B6G B;  3MGR B;  3W97 D;  1P3K D;  3X1V B;  3UTA C;  4WZS B;  2IO5 C;  4QLC B;  3UTA D;  4M6B A;  3X1T C;  4WU9 C;  3X1T D;  4WU9 D;  1M19 A;  3W98 A;  4ZBJ B;  3C1C A;  5CPI A;  1P3F C;  5GXQ B;  5GT3 C;  1P3F D;  3AV2 A;  5GT3 D;  5G49 A;  3X1S A;  5BT1 C;  3MGQ A;  5B33 C;  1P3P A;  5B33 D;  5B1L B;  3LJA B;  3AZJ C;  1M1A C;  1M1A D;  3LZ0 C;  3AZJ D;  2F8N D;  1P3L C;  3LZ0 D;  4G91 C;  1P3L D;  3KWQ A;  3TU4 B;  1P3M B;  5BNX A;  5CP6 A;  4R8P A;  3UT9 A;  3VH6 T;  4QLC C;  4QLC D;  4NFT A;  1TZY B;  3AZI B;  3W97 A;  1P3G A;  3AZG D;  4HGA C;  1P3K A;  4H9Q A;  4JJN D;  3UTA A;  3X1T A;  4WU9 A;  4Z2M H;  2ARO D;  3R45 B;  1P3F A;  5GT3 A;  3AZL C;  4J8U C;  5E5A C;  5CPJ D;  4J8U D;  2YFW B;  5E5A D;  3TU4 C;  5JRG C;  3MNN C;  4J8V C;  3TU4 D;  5JRG D;  3MNN D;  4J8V D;  1P3M C;  1P3M D;  5B0Z B;  5B33 A;  4YS3 C;  1ZLA C;  3VH5 T;  1P34 B;  4YS3 D;  1ZLA D;  1M1A A;  3AZJ A;  2F8N A;  3LZ0 A;  1P3L A;  4E44 A;  3AZL D;  5CPK C;  3REH D;  5CPK D;  3W99 B;  2CV5 C;  4QLC A;  3REK B;  2CV5 D;  1P3O D;  3AZG A;  1N1J B;  4JJN A;  3REL C;  3O62 B;  3REL D;  4J8W B;  5B0Z C;  3MGS C;  5B0Z D;  3MGS D;  1P34 C;  1P34 D;  3C1B C;  5JA4 B;  3C1B D;  1KX4 B;  3AZL A;  2BYK A;  2LY8 A;  5B2J B;  5E5A A;  4J8U A;  3TU4 A;  5AV6 B;  5JRG A;  4H9N B;  3MNN A;  4J8V A;  4XUJ C;  1P3M A;  1P3I B;  4XUJ D;  4YS3 A;  5DNN C;  1ZLA A;  3WKJ B;  1KU5 A;  5DNN D;  2RVQ D;  2BYM B;  4NE3 A;  3REH A;  1R4V A;  5CPK A;  5BNV B;  5DNM D;  2CV5 A;  2F8N H;  3W98 B;  5CPI B;  5B1M C;  4J8X B;  3AV2 B;  5B1M D;  5G49 B;  5AV6 C;  3REL A;  1B67 A;  5B0Z A;  3MGS A;  3WKJ C;  1P34 A;  1P3P B;  3WKJ D;  3C1B A;  3KXB C;  3KXB D;  3KWQ B;  4XUJ A;  5AVB C;  5BNX B;  5CP6 B;  5AVB D;  4R8P B;  5DNN A;  3B0C T;  3UT9 B;  3AN2 C;  3AN2 D;  2CWE A;  1P3A C;  1P3A D;  3W97 B;  4G92 C;  4J8X C;  3REI C;  4J8X D;  5DNM A;  3REI D;  1P3K B;  1KX5 C;  4H9Q B;  3LZ1 C;  1KX5 D;  2FJ7 C;  3LZ1 D;  3B0B A;  3UTA B;  2FJ7 D;  2IO5 B;  1KX3 C;  4CAY A;  3AZK C;  2HIO D;  2L5A A;  1KX3 D;  3AZK D;  5B31 C;  1BFM A;  5B31 D;  3REJ C;  1P3F B;  5B1M A;  5GT3 B;  3REJ D;  3VH5 A;  3WTP C;  5AV6 A;  3WTP D;  5B33 B;  3WKJ A;  1BH8 A;  2F8N B;  3AZJ B;  3LZ0 B;  3KXB A;  1P3L B;  4G91 B;  5AV9 C;  4AWL B;  3MGP C;  5AV9 D;  3MGP D;  4Z2M G;  5AVB A;  1P3K C;  3MVD B;  3AN2 A;  4WV4 B;  1P3A A;  3AZG B;  4J8X A;  3REI A;  4HGA B;  1KX5 A;  4JJN B;  3LZ1 A;  4YM6 C;  2FJ7 A;  4YM6 D;  1KX3 A;  3VH6 W;  3AZK A;  2ARO B;  5B31 A;  5KDM A;  1Q9C A;  3REJ A;  3AZL B;  2BYK B;  4J8U B;  5CPJ B;  5E5A B;  3WTP A;  5JRG B;  3MNN B;  4J8V B;  3WTP E;  4AWL C;  4YS3 B;  1ZLA B;  3MVD C;  1EQZ B;  3MVD D;  1H3O B;  4KUD B;  1TAF A;  5AV9 A;  3AZG C;  3MGP A;  3REH B;  5CPK B;  1F66 C;  4JJN C;  1F66 D;  3AZM C;  3AZM D;  2CV5 B;  4ZUX B;  1P3O B;  2PYO C;  3B6F B;  3VH5 W;  2PYO D;  2ARO C;  3AFA B;  1HQ3 C;  1A7W A;  5CPJ C;  1HQ3 D;  3REL B;  4YM6 A;  3MGS B;  5BO0 A;  4H9P A;  5F99 B;  4KUD C;  3C1B B;  4WU8 C;  4KUD D;  4EO5 C;  4WU8 D;  4XUJ B;  5B32 B;  3REH C;  5AV5 B;  3NQU A;  4WNN A;  5DNN B;  3MVD A;  3AZH B;  4ZUX C;  1P3O C;  5CHL B;  4ZUX D;  3B6F C;  3B6F D;  4Z5T B;  3AFA C;  3AFA D;  5DNM B;  1F66 A;  4KGC B;  5B40 C;  3AZM A;  5B40 D;  2PYO A;  4CAY B;  5F99 C;  2ARO A;  5AY8 C;  5F99 D;  5AY8 D;  1HQ3 A;  5B1M B;  5CPJ A;  4DRA A;  4LD9 B;  3B0D C;  5GT0 B;  5B32 C;  3AYW C;  5B32 D;  3AYW D;  4Z66 C;  5AV5 C;  4Z66 D;  4NE5 A;  5AV5 D;  3AZH C;  1BH8 B;  2RVQ C;  1H3O A;  3AZH D;  4KUD A;  4WU8 A;  3KXB B;  3KUY D;  2NZD B;  4Z5T C;  4Z5T D;  5AVB B;  5DNM C;  3W96 C;  2JSS A;  4KGC C;  3W96 D;  4KGC D;  1F1E A;  3AN2 B;  4CSR B;  4ZUX A;  1P3O A;  3B6F A;  1S32 C;  1S32 D;  1P3A B;  3AFA A;  4G92 B;  3REI B;  3AZE C;  3NQJ B;  1KX5 B;  3LZ1 B;  5B40 A;  3AZE D;  3AV1 C;  3AV1 D;  5GT0 C;  2FJ7 B;  4LD9 C;  4LD9 D;  5GT0 D;  1KX3 B;  2HIO B;  3B0C W;  3AZK B;  5F99 A;  5AY8 A;  5B31 B;  5KDM B;  3REJ B;  2NZD C;  2NZD D;  3AZF C;  3WTP B;  3AZF D;  5B32 A;  3AYW A;  4Z66 A;  5AV5 A;  3AZH A;  1TAF B;  2HUE C;  4Z5T A;  3X1U C;  5AV9 B;  3X1U D;  3MGP B;  3W96 A;  4KGC A;  3WAA C;  3WAA D;  2HIO C;  1S32 A;  3AZE A;  3AV1 A;  4YM6 B;  4LD9 A;  5GT0 A;  5BO0 B;  4H9P B;  4KHA A;  4UUZ A;  2NZD A;  3AZF A;  1ID3 C;  1ID3 D;  3C1C D;  5C3I C;  3NQU B;  4WNN B;  4CSR A;  5B24 D;  5GSU B;  4XZQ C;  5BS7 C;  4XZQ D;  3X1U A;  3A6N C;  5FUG A;  3A6N D;  3NQJ A;  1JFI A;  4H9R A;  1F66 B;  3AZM B;  1WWS A;  3WAA A;  2PYO B;  3V9R A;  2HIO A;  3WA9 C;  1HQ3 B;  5B0Y C;  3WA9 D;  5B0Y D;  1ULY A;  1U35 C;  1U35 D;  4H9S C;  4WU8 B;  5GSU C;  4EO5 B;  5GSU D;  1AOI B;  1ID3 A;  5B24 A;  4XZQ A;  5BT1 D;  5BS7 A;  1BH9 A;  1P3B B;  5B2I B;  3A6N A;  2F8N K;  5B40 B;  3UTB C;  3B6G C;  3UTB D;  1M18 C;  3B6G D;  3MGR C;  1M18 D;  4H9O B;  3X1V C;  3MGR D;  5AY8 B;  3X1V D;  3WA9 A;  5B0Y A;  1AOI C;  1AOI D;  5AVC B;  2YFV A;  3B0D B;  4ZBJ C;  5GXQ C;  3AYW B;  2F8N G;  1U35 A;  5GXQ D;  4Z66 B;  4H9S A;  4NE6 A;  3KUY B;  5GSU A;  4X23 B;  5B1L C;  1P3B C;  3LJA C;  5B1L D;  1P3B D;  5AV8 B;  5B2I C;  3LJA D;  5B2I D;  3W96 B;  1S32 B;  3AZE B;  3AV1 B;  1TZY C;  5AVC C;  3AZI C;  1TZY D;  5AVC D;  3UTB A;  3AZI D;  3KSY A;  3B6G A;  2NQB B;  1M18 A;  3MGR A;  3X1V A;  3KUY C;  4KHA B;  4UUZ B;  4X23 C;  1AOI A;  3AZF B;  4X23 D;  5AV8 C;  5AV8 D;  5GXQ A;  1EQZ C;  1EQZ D; 
#chains in the Genus database with same CATH topology
 3AZN B;  2HUE B;  5B1L A;  1P3B A;  3LJA A;  3X1U B;  5B2I A;  4WJ3 C;  5FUG B;  1JFI B;  4H9R B;  3WAA B;  2NQB C;  3LEL B;  2NQB D;  3V9R B;  3W99 C;  4H9O A;  3W99 D;  4E45 A;  3REK C;  3REK D;  2Y2H A;  1TZY A;  5AVC A;  3AZI A;  3O62 C;  3O62 D;  3AZN C;  3KUY A;  4J8W C;  3AZN D;  4J8W D;  5B32 G;  4X23 A;  1M19 B;  1ID3 B;  5AV8 A;  3C1C B;  3R45 A;  1KX4 C;  5B2J C;  5C3I B;  1KX4 D;  5B2J D;  1EQZ A;  2YFW A;  5B24 B;  3X1S B;  5AV6 D;  3LEL C;  1P3I C;  3LEL D;  1P3I D;  4XZQ B;  3MGQ B;  1HTA A;  1BH9 B;  3A6N B;  3VH6 A;  2VQR A;  2NQB A;  2DQN C;  3W99 A;  2ZM5 A;  2XD1 A;  3EG5 B;  3REK A;  3WA9 B;  5B0Y B;  1M19 C;  3W98 C;  1M19 D;  3W98 D;  2YFV B;  5CPI C;  3C1C C;  1P3G B;  5CPI D;  1N1J A;  1U35 B;  3AV2 C;  3AV2 D;  5B24 C;  3O62 A;  3X1S C;  3X1S D;  3AZN A;  4J8W A;  3MGQ C;  4DQY B;  3X1T B;  4UPK A;  3MGQ D;  4WU9 B;  1P3P C;  1P3P D;  3H0M C;  5JA4 A;  1KX4 A;  5B2J A;  3KWQ C;  3KWQ D;  1W2E A;  4H9N A;  3LEL A;  4DRB A;  1P3I A;  5CP6 C;  5CP6 D;  4R8P C;  3UT9 C;  4R8P D;  3UT9 D;  1M1A B;  2BYM A;  3W97 C;  1P3G C;  1WWI A;  3UTB B;  5B31 G;  1B6W A;  1P3G D;  5BNV A;  1M18 B;  3B6G B;  3MGR B;  3W97 D;  1P3K D;  3X1V B;  3UTA C;  4WZS B;  2IO5 C;  4QLC B;  3UTA D;  4M6B A;  3X1T C;  4WU9 C;  3X1T D;  4WU9 D;  1M19 A;  3W98 A;  1Z2C B;  4ZBJ B;  3C1C A;  5CPI A;  1P3F C;  5GXQ B;  5GT3 C;  1P3F D;  3AV2 A;  5GT3 D;  5G49 A;  3X1S A;  5BT1 C;  3MGQ A;  5B33 C;  1P3P A;  5B33 D;  5B1L B;  2ZY5 A;  3LJA B;  3AZJ C;  1M1A C;  1M1A D;  3LZ0 C;  3AZJ D;  2F8N D;  1P3L C;  3LZ0 D;  4G91 C;  1P3L D;  3P5J B;  3KWQ A;  3TU4 B;  1P3M B;  2Y2O A;  5BNX A;  5CP6 A;  4R8P A;  3UT9 A;  3VH6 T;  4QLC C;  4QLC D;  4NFT A;  1TZY B;  3AZI B;  3W97 A;  1P3G A;  3AZG D;  4HGA C;  1P3K A;  4H9Q A;  4JJN D;  3UTA A;  3X1T A;  4WU9 A;  4Z2M H;  2ARO D;  3R45 B;  2JCH A;  1P3F A;  5GT3 A;  3AZL C;  4J8U C;  5E5A C;  5CPJ D;  4J8U D;  2YFW B;  5E5A D;  3TU4 C;  5JRG C;  3MNN C;  4J8V C;  3TU4 D;  5JRG D;  3MNN D;  4J8V D;  1P3M C;  1P3M D;  5B0Z B;  5B33 A;  4YS3 C;  1ZLA C;  3VH5 T;  1P34 B;  4YS3 D;  3H0L C;  1ZLA D;  1M1A A;  3AZJ A;  2F8N A;  3LZ0 A;  2ZY4 A;  1P3L A;  4E44 A;  3AZL D;  5CPK C;  2ZY3 A;  3F6T A;  3REH D;  5CPK D;  3W99 B;  3A1I A;  2CV5 C;  4QLC A;  3REK B;  2CV5 D;  1P3O D;  3AZG A;  1N1J B;  4JJN A;  3REL C;  3O62 B;  3REL D;  4J8W B;  5B0Z C;  3MGS C;  5B0Z D;  3MGS D;  1P34 C;  1P34 D;  3C1B C;  5JA4 B;  3C1B D;  1KX4 B;  3AZL A;  2BYK A;  2LY8 A;  5B2J B;  5E5A A;  4J8U A;  3TU4 A;  5AV6 B;  5JRG A;  4H9N B;  3MNN A;  4J8V A;  4XUJ C;  1P3M A;  1P3I B;  4XUJ D;  4YS3 A;  5DNN C;  1ZLA A;  3WKJ B;  1KU5 A;  5DNN D;  2RVQ D;  2BYM B;  4NE3 A;  3REH A;  1R4V A;  5CPK A;  5BNV B;  5DNM D;  2CV5 A;  3EPJ A;  2F8N H;  3W98 B;  5CPI B;  5B1M C;  4J8X B;  3AV2 B;  2J8P A;  5B1M D;  3EPK A;  5G49 B;  5AV6 C;  3REL A;  1B67 A;  5B0Z A;  3MGS A;  3WKJ C;  1P34 A;  1P3P B;  3WKJ D;  3C1B A;  3KXB C;  3KXB D;  3EPH A;  3KWQ B;  4XUJ A;  5AVB C;  5BNX B;  5CP6 B;  2BG1 A;  5AVB D;  4R8P B;  5DNN A;  3B0C T;  3UT9 B;  3AN2 C;  3AN2 D;  2CWE A;  1P3A C;  1P3A D;  3W97 B;  4G92 C;  4J8X C;  3REI C;  4J8X D;  5DNM A;  3REI D;  1P3K B;  1KX5 C;  4H9Q B;  3LZ1 C;  1KX5 D;  2FJ7 C;  3LZ1 D;  3B0B A;  3UTA B;  2FJ7 D;  2IO5 B;  1KX3 C;  4CAY A;  3AZK C;  2HIO D;  2L5A A;  1KX3 D;  3AZK D;  5B31 C;  2Y2I A;  1BFM A;  5B31 D;  3REJ C;  1P3F B;  5B1M A;  5GT3 B;  3REJ D;  3VH5 A;  3WTP C;  5AV6 A;  3WTP D;  2Y2L A;  5B33 B;  3WKJ A;  1BH8 A;  2F8N B;  3AZJ B;  3LZ0 B;  3KXB A;  1P3L B;  4G91 B;  5AV9 C;  4AWL B;  3MGP C;  5AV9 D;  3MGP D;  4Z2M G;  2RIQ A;  5AVB A;  1P3K C;  3MVD B;  3AN2 A;  3EPL A;  4WV4 B;  1P3A A;  3AZG B;  4J8X A;  3REI A;  4HGA B;  1KX5 A;  4JJN B;  3LZ1 A;  4YM6 C;  2FJ7 A;  4YM6 D;  1KX3 A;  2DF4 C;  3VH6 W;  3AZK A;  2ARO B;  5B31 A;  5KDM A;  1Q9C A;  3REJ A;  3AZL B;  2BYK B;  4J8U B;  5CPJ B;  5E5A B;  3WTP A;  2W8S A;  2G5I C;  5JRG B;  3WTP E;  3MNN B;  4J8V B;  4AWL C;  4YS3 B;  1ZLA B;  3MVD C;  1EQZ B;  3MVD D;  1H3O B;  4KUD B;  1TAF A;  2Y2J A;  5AV9 A;  3AZG C;  3MGP A;  3REH B;  5CPK B;  1F66 C;  4JJN C;  1F66 D;  3AZM C;  3AZM D;  2CV5 B;  4ZUX B;  1P3O B;  2PYO C;  3B6F B;  3VH5 W;  2PYO D;  2ARO C;  3AFA B;  1HQ3 C;  1A7W A;  5CPJ C;  1HQ3 D;  3REL B;  4YM6 A;  3MGS B;  5BO0 A;  4H9P A;  5F99 B;  2FFF B;  4KUD C;  3C1B B;  4WU8 C;  4KUD D;  4EO5 C;  4WU8 D;  4XUJ B;  5B32 B;  3REH C;  5AV5 B;  3NQU A;  4WNN A;  5DNN B;  3MVD A;  3AZH B;  4ZUX C;  1P3O C;  5CHL B;  4ZUX D;  3B6F C;  3B6F D;  4Z5T B;  3AFA C;  3AFA D;  5DNM B;  1F66 A;  4KGC B;  5B40 C;  3AZM A;  5B40 D;  2PYO A;  4CAY B;  2Y2P A;  5F99 C;  2ARO A;  5AY8 C;  5F99 D;  5AY8 D;  1HQ3 A;  5B1M B;  5CPJ A;  4DRA A;  4LD9 B;  3B0D C;  5GT0 B;  5B32 C;  3AYW C;  5B32 D;  3AYW D;  4Z66 C;  5AV5 C;  4Z66 D;  4NE5 A;  5AV5 D;  3AZH C;  1BH8 B;  2RVQ C;  1H3O A;  3AZH D;  4KUD A;  4WU8 A;  3KXB B;  3KUY D;  2NZD B;  4Z5T C;  4Z5T D;  5AVB B;  5DNM C;  3W96 C;  2JSS A;  4KGC C;  3W96 D;  4KGC D;  1F1E A;  3AN2 B;  4CSR B;  4ZUX A;  1P3O A;  3B6F A;  1S32 C;  1S32 D;  1P3A B;  3AFA A;  4G92 B;  3REI B;  3AZE C;  3NQJ B;  1KX5 B;  3LZ1 B;  5B40 A;  3AZE D;  3AV1 C;  2Y2M A;  5GT0 C;  3AV1 D;  2FJ7 B;  4LD9 C;  5GT0 D;  4LD9 D;  3KFU G;  1KX3 B;  2HIO B;  3B0C W;  3AZK B;  5F99 A;  3AL0 C;  5AY8 A;  5B31 B;  5KDM B;  3REJ B;  2NZD C;  2NZD D;  3AZF C;  3WTP B;  3AZF D;  5B32 A;  3AYW A;  4Z66 A;  5AV5 A;  3AZH A;  1TAF B;  2HUE C;  4Z5T A;  3X1U C;  5AV9 B;  3X1U D;  3MGP B;  3W96 A;  4KGC A;  3WAA C;  3WAA D;  2HIO C;  1S32 A;  3AZE A;  3AV1 A;  4YM6 B;  1T3U A;  3A1K A;  4LD9 A;  5GT0 A;  5BO0 B;  4H9P B;  4KHA A;  4UUZ A;  2NZD A;  3AZF A;  1ID3 C;  1ID3 D;  3H0R C;  3C1C D;  5C3I C;  3NQU B;  4WNN B;  2ZY2 A;  4CSR A;  5B24 D;  5GSU B;  4XZQ C;  5BS7 C;  4XZQ D;  3X1U A;  3A6N C;  5FUG A;  3A6N D;  3NQJ A;  1JFI A;  4H9R A;  1F66 B;  3AZM B;  1WWS A;  3WAA A;  2PYO B;  3V9R A;  2HIO A;  3WA9 C;  1HQ3 B;  5B0Y C;  3WA9 D;  5B0Y D;  1ULY A;  1U35 C;  1U35 D;  4H9S C;  4WU8 B;  5GSU C;  4EO5 B;  5GSU D;  1AOI B;  1ID3 A;  3FDD A;  2XD5 A;  5B24 A;  4XZQ A;  5BT1 D;  5BS7 A;  2UWX A;  1BH9 A;  1P3B B;  5B2I B;  3A6N A;  2F8N K;  5B40 B;  3UTB C;  3B6G C;  3UTB D;  1M18 C;  3B6G D;  3MGR C;  1M18 D;  4H9O B;  3X1V C;  3MGR D;  5AY8 B;  3X1V D;  3WA9 A;  5B0Y A;  1AOI C;  1AOI D;  5AVC B;  2YFV A;  3B0D B;  4ZBJ C;  5GXQ C;  3AYW B;  2F8N G;  1U35 A;  5GXQ D;  4Z66 B;  2Y2Q A;  4H9S A;  4NE6 A;  3KUY B;  5GSU A;  4X23 B;  5B1L C;  1P3B C;  3LJA C;  5B1L D;  1P3B D;  5AV8 B;  5B2I C;  2G5H C;  3LJA D;  5B2I D;  2Y2N A;  3W96 B;  1S32 B;  3IP4 C;  1PZR A;  3AZE B;  2Y2K A;  1TZY C;  5AVC C;  3AZI C;  3AV1 B;  1TZY D;  5AVC D;  3UTB A;  3AZI D;  2F2A C;  3KSY A;  3B6G A;  1M18 A;  2NQB B;  3MGR A;  3X1V A;  2JE5 A;  3KUY C;  4KHA B;  4UUZ B;  4X23 C;  1AOI A;  3AZF B;  2Y2G A;  4X23 D;  5AV8 C;  5AV8 D;  5GXQ A;  1EQZ C;  1EQZ D; 
#chains in the Genus database with same CATH homology
 3AZN B;  2HUE B;  5B1L A;  1P3B A;  3LJA A;  3X1U B;  5B2I A;  4WJ3 C;  5FUG B;  1JFI B;  4H9R B;  3WAA B;  2NQB C;  3LEL B;  2NQB D;  3V9R B;  3W99 C;  4H9O A;  3W99 D;  4E45 A;  3REK C;  3REK D;  2Y2H A;  1TZY A;  5AVC A;  3AZI A;  3O62 C;  3O62 D;  3AZN C;  3KUY A;  4J8W C;  3AZN D;  4J8W D;  5B32 G;  4X23 A;  1M19 B;  1ID3 B;  5AV8 A;  3C1C B;  3R45 A;  1KX4 C;  5B2J C;  5C3I B;  1KX4 D;  5B2J D;  1EQZ A;  2YFW A;  5B24 B;  3X1S B;  5AV6 D;  3LEL C;  1P3I C;  3LEL D;  1P3I D;  4XZQ B;  3MGQ B;  1HTA A;  1BH9 B;  3A6N B;  3VH6 A;  2VQR A;  2NQB A;  2DQN C;  3W99 A;  2ZM5 A;  2XD1 A;  3EG5 B;  3REK A;  3WA9 B;  5B0Y B;  1M19 C;  3W98 C;  1M19 D;  3W98 D;  2YFV B;  5CPI C;  3C1C C;  1P3G B;  5CPI D;  1N1J A;  1U35 B;  3AV2 C;  3AV2 D;  5B24 C;  3O62 A;  3X1S C;  3X1S D;  3AZN A;  4J8W A;  3MGQ C;  4DQY B;  3X1T B;  4UPK A;  3MGQ D;  4WU9 B;  1P3P C;  1P3P D;  3H0M C;  5JA4 A;  1KX4 A;  5B2J A;  3KWQ C;  3KWQ D;  1W2E A;  4H9N A;  3LEL A;  4DRB A;  1P3I A;  5CP6 C;  5CP6 D;  4R8P C;  3UT9 C;  4R8P D;  3UT9 D;  1M1A B;  2BYM A;  3W97 C;  1P3G C;  1WWI A;  3UTB B;  5B31 G;  1B6W A;  1P3G D;  5BNV A;  1M18 B;  3B6G B;  3MGR B;  3W97 D;  1P3K D;  3X1V B;  3UTA C;  4WZS B;  2IO5 C;  4QLC B;  3UTA D;  4M6B A;  3X1T C;  4WU9 C;  3X1T D;  4WU9 D;  1M19 A;  3W98 A;  1Z2C B;  4ZBJ B;  3C1C A;  5CPI A;  1P3F C;  5GXQ B;  5GT3 C;  1P3F D;  3AV2 A;  5GT3 D;  5G49 A;  3X1S A;  5BT1 C;  3MGQ A;  5B33 C;  1P3P A;  5B33 D;  5B1L B;  2ZY5 A;  3LJA B;  3AZJ C;  1M1A C;  1M1A D;  3LZ0 C;  3AZJ D;  2F8N D;  1P3L C;  3LZ0 D;  4G91 C;  1P3L D;  3P5J B;  3KWQ A;  3TU4 B;  1P3M B;  2Y2O A;  5BNX A;  5CP6 A;  4R8P A;  3UT9 A;  3VH6 T;  4QLC C;  4QLC D;  4NFT A;  1TZY B;  3AZI B;  3W97 A;  1P3G A;  3AZG D;  4HGA C;  1P3K A;  4H9Q A;  4JJN D;  3UTA A;  3X1T A;  4WU9 A;  4Z2M H;  2ARO D;  3R45 B;  2JCH A;  1P3F A;  5GT3 A;  3AZL C;  4J8U C;  5E5A C;  5CPJ D;  4J8U D;  2YFW B;  5E5A D;  3TU4 C;  5JRG C;  3MNN C;  4J8V C;  3TU4 D;  5JRG D;  3MNN D;  4J8V D;  1P3M C;  1P3M D;  5B0Z B;  5B33 A;  4YS3 C;  1ZLA C;  3VH5 T;  1P34 B;  4YS3 D;  3H0L C;  1ZLA D;  1M1A A;  3AZJ A;  2F8N A;  3LZ0 A;  2ZY4 A;  1P3L A;  4E44 A;  3AZL D;  5CPK C;  2ZY3 A;  3F6T A;  3REH D;  5CPK D;  3W99 B;  3A1I A;  2CV5 C;  4QLC A;  3REK B;  2CV5 D;  1P3O D;  3AZG A;  1N1J B;  4JJN A;  3REL C;  3O62 B;  3REL D;  4J8W B;  5B0Z C;  3MGS C;  5B0Z D;  3MGS D;  1P34 C;  1P34 D;  3C1B C;  5JA4 B;  3C1B D;  1KX4 B;  3AZL A;  2BYK A;  2LY8 A;  5B2J B;  5E5A A;  4J8U A;  3TU4 A;  5AV6 B;  5JRG A;  4H9N B;  3MNN A;  4J8V A;  4XUJ C;  1P3M A;  1P3I B;  4XUJ D;  4YS3 A;  5DNN C;  1ZLA A;  3WKJ B;  1KU5 A;  5DNN D;  2RVQ D;  2BYM B;  4NE3 A;  3REH A;  1R4V A;  5CPK A;  5BNV B;  5DNM D;  2CV5 A;  3EPJ A;  2F8N H;  3W98 B;  5CPI B;  5B1M C;  4J8X B;  3AV2 B;  2J8P A;  5B1M D;  3EPK A;  5G49 B;  5AV6 C;  3REL A;  1B67 A;  5B0Z A;  3MGS A;  3WKJ C;  1P34 A;  1P3P B;  3WKJ D;  3C1B A;  3KXB C;  3KXB D;  3EPH A;  3KWQ B;  4XUJ A;  5AVB C;  5BNX B;  5CP6 B;  2BG1 A;  5AVB D;  4R8P B;  5DNN A;  3B0C T;  3UT9 B;  3AN2 C;  3AN2 D;  2CWE A;  1P3A C;  1P3A D;  3W97 B;  4G92 C;  4J8X C;  3REI C;  4J8X D;  5DNM A;  3REI D;  1P3K B;  1KX5 C;  4H9Q B;  3LZ1 C;  1KX5 D;  2FJ7 C;  3LZ1 D;  3B0B A;  3UTA B;  2FJ7 D;  2IO5 B;  1KX3 C;  4CAY A;  3AZK C;  2HIO D;  2L5A A;  1KX3 D;  3AZK D;  5B31 C;  2Y2I A;  1BFM A;  5B31 D;  3REJ C;  1P3F B;  5B1M A;  5GT3 B;  3REJ D;  3VH5 A;  3WTP C;  5AV6 A;  3WTP D;  2Y2L A;  5B33 B;  3WKJ A;  1BH8 A;  2F8N B;  3AZJ B;  3LZ0 B;  3KXB A;  1P3L B;  4G91 B;  5AV9 C;  4AWL B;  3MGP C;  5AV9 D;  3MGP D;  4Z2M G;  2RIQ A;  5AVB A;  1P3K C;  3MVD B;  3AN2 A;  3EPL A;  4WV4 B;  1P3A A;  3AZG B;  4J8X A;  3REI A;  4HGA B;  1KX5 A;  4JJN B;  3LZ1 A;  4YM6 C;  2FJ7 A;  4YM6 D;  1KX3 A;  2DF4 C;  3VH6 W;  3AZK A;  2ARO B;  5B31 A;  5KDM A;  1Q9C A;  3REJ A;  3AZL B;  2BYK B;  4J8U B;  5CPJ B;  5E5A B;  3WTP A;  2W8S A;  2G5I C;  5JRG B;  3WTP E;  3MNN B;  4J8V B;  4AWL C;  4YS3 B;  1ZLA B;  3MVD C;  1EQZ B;  3MVD D;  1H3O B;  4KUD B;  1TAF A;  2Y2J A;  5AV9 A;  3AZG C;  3MGP A;  3REH B;  5CPK B;  1F66 C;  4JJN C;  1F66 D;  3AZM C;  3AZM D;  2CV5 B;  4ZUX B;  1P3O B;  2PYO C;  3B6F B;  3VH5 W;  2PYO D;  2ARO C;  3AFA B;  1HQ3 C;  1A7W A;  5CPJ C;  1HQ3 D;  3REL B;  4YM6 A;  3MGS B;  5BO0 A;  4H9P A;  5F99 B;  2FFF B;  4KUD C;  3C1B B;  4WU8 C;  4KUD D;  4EO5 C;  4WU8 D;  4XUJ B;  5B32 B;  3REH C;  5AV5 B;  3NQU A;  4WNN A;  5DNN B;  3MVD A;  3AZH B;  4ZUX C;  1P3O C;  5CHL B;  4ZUX D;  3B6F C;  3B6F D;  4Z5T B;  3AFA C;  3AFA D;  5DNM B;  1F66 A;  4KGC B;  5B40 C;  3AZM A;  5B40 D;  2PYO A;  4CAY B;  2Y2P A;  5F99 C;  2ARO A;  5AY8 C;  5F99 D;  5AY8 D;  1HQ3 A;  5B1M B;  5CPJ A;  4DRA A;  4LD9 B;  3B0D C;  5GT0 B;  5B32 C;  3AYW C;  5B32 D;  3AYW D;  4Z66 C;  5AV5 C;  4Z66 D;  4NE5 A;  5AV5 D;  3AZH C;  1BH8 B;  2RVQ C;  1H3O A;  3AZH D;  4KUD A;  4WU8 A;  3KXB B;  3KUY D;  2NZD B;  4Z5T C;  4Z5T D;  5AVB B;  5DNM C;  3W96 C;  2JSS A;  4KGC C;  3W96 D;  4KGC D;  1F1E A;  3AN2 B;  4CSR B;  4ZUX A;  1P3O A;  3B6F A;  1S32 C;  1S32 D;  1P3A B;  3AFA A;  4G92 B;  3REI B;  3AZE C;  3NQJ B;  1KX5 B;  3LZ1 B;  5B40 A;  3AZE D;  3AV1 C;  2Y2M A;  5GT0 C;  3AV1 D;  2FJ7 B;  4LD9 C;  5GT0 D;  4LD9 D;  3KFU G;  1KX3 B;  2HIO B;  3B0C W;  3AZK B;  5F99 A;  3AL0 C;  5AY8 A;  5B31 B;  5KDM B;  3REJ B;  2NZD C;  2NZD D;  3AZF C;  3WTP B;  3AZF D;  5B32 A;  3AYW A;  4Z66 A;  5AV5 A;  3AZH A;  1TAF B;  2HUE C;  4Z5T A;  3X1U C;  5AV9 B;  3X1U D;  3MGP B;  3W96 A;  4KGC A;  3WAA C;  3WAA D;  2HIO C;  1S32 A;  3AZE A;  3AV1 A;  4YM6 B;  1T3U A;  3A1K A;  4LD9 A;  5GT0 A;  5BO0 B;  4H9P B;  4KHA A;  4UUZ A;  2NZD A;  3AZF A;  1ID3 C;  1ID3 D;  3H0R C;  3C1C D;  5C3I C;  3NQU B;  4WNN B;  2ZY2 A;  4CSR A;  5B24 D;  5GSU B;  4XZQ C;  5BS7 C;  4XZQ D;  3X1U A;  3A6N C;  5FUG A;  3A6N D;  3NQJ A;  1JFI A;  4H9R A;  1F66 B;  3AZM B;  1WWS A;  3WAA A;  2PYO B;  3V9R A;  2HIO A;  3WA9 C;  1HQ3 B;  5B0Y C;  3WA9 D;  5B0Y D;  1ULY A;  1U35 C;  1U35 D;  4H9S C;  4WU8 B;  5GSU C;  4EO5 B;  5GSU D;  1AOI B;  1ID3 A;  3FDD A;  2XD5 A;  5B24 A;  4XZQ A;  5BT1 D;  5BS7 A;  2UWX A;  1BH9 A;  1P3B B;  5B2I B;  3A6N A;  2F8N K;  5B40 B;  3UTB C;  3B6G C;  3UTB D;  1M18 C;  3B6G D;  3MGR C;  1M18 D;  4H9O B;  3X1V C;  3MGR D;  5AY8 B;  3X1V D;  3WA9 A;  5B0Y A;  1AOI C;  1AOI D;  5AVC B;  2YFV A;  3B0D B;  4ZBJ C;  5GXQ C;  3AYW B;  2F8N G;  1U35 A;  5GXQ D;  4Z66 B;  2Y2Q A;  4H9S A;  4NE6 A;  3KUY B;  5GSU A;  4X23 B;  5B1L C;  1P3B C;  3LJA C;  5B1L D;  1P3B D;  5AV8 B;  5B2I C;  2G5H C;  3LJA D;  5B2I D;  2Y2N A;  3W96 B;  1S32 B;  3IP4 C;  1PZR A;  3AZE B;  2Y2K A;  1TZY C;  5AVC C;  3AZI C;  3AV1 B;  1TZY D;  5AVC D;  3UTB A;  3AZI D;  2F2A C;  3KSY A;  3B6G A;  1M18 A;  2NQB B;  3MGR A;  3X1V A;  2JE5 A;  3KUY C;  4KHA B;  4UUZ B;  4X23 C;  1AOI A;  3AZF B;  2Y2G A;  4X23 D;  5AV8 C;  5AV8 D;  5GXQ A;  1EQZ C;  1EQZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...