3V9RA

Crystal structure of saccharomyces cerevisiae mhf complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
NDDEDRAQLKARLWIRVEERLQQVLSSEDIKYTPRFINSLLELAYLQLGEMGSDLQAFARHAGRGVVNKSDLMLYLRKQPDLQERVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Uncharacterized protein YOL086W-A
publication title Saccharomyces Cerevisiae MHF Complex Structurally Resembles the Histones (H3-H4)(2) Heterotetramer and Functions as a Heterotetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 88
sequence length 88
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3v9rA00
4XZQD 4Z66B 5JRGC 3REHB 4ZUXC 5GT3D 3V9RA 4R8PB 5B32G 5E5AB 1P3MB 1P3LD 3AZMA 3AV2D 5AVBC 1P3AC 4ZUXD 4J8XB 2LY8A 4WNNA 3LZ0A 3RELC 4ZBJB 2CV5D 3UTAC 5AV6B 2PYOB 4Z2MH 5C3IC 4DRAA 5AVBD 3NQJA 3AZGB 2NZDD 5GXQA 5CPKB 5JA4A 3RELD 3B6GB 5CPIC 1WWSA 4Z2MG 5B31B 4KUDC 3LJAB 3O62D 3X1TC 2BYMA 3C1BC 4J8WD 5B0ZC 3MNNA 4J8UC 3B0DC 4KUDD 1TZYA 4KGCA 3AZIB 1P34A 1M18A 1AOIB 3X1TD 3X1VC 3AZKC 5DNMD 3C1BD 5GSUB 3MVDC 2AROA 5B0ZD 5B32B 3MGSC 4KGCD 3AZMC 5B33D 3WKJB 3AZEC 1S32B 3AN2C 4XZQB 4H9RB 1N1JB 3KWQC 2F8NH 3AZMD 3X1UA 3AN2D 5KDMA 3AYWA 3AV2B 1P3OC 2F8NG 1M1AB 1HTAA 3VH5A 1P3FC 1BFMA 3X1SA 2CV5B 1BH9A 3UT9A 5B2IC 5B0YC 5GXQD 1ZLAA 3A6NC 1P3FD 1P3KC 2NZDB 3RELB 5B2JC 1P3IA 2FJ7A 5B2ID 3AZFC 5B0YD 3WA9C 2F8NK 2PYOA 4DRBA 3O62B 5C3IB 5BNXB 4J8WB 2YFVA 1P34D 5F99B 4HGAC 3B6GA 4KUDB 5B40C 2IO5C 4AWLC 4YM6B 3X1TB 5DNMB 3C1BB 4QLCB 3C1CA 5B0ZB 4XUJA 4H9PB 1P3BC 1M19B 4KGCB 1BH8B 1ID3B 5B33B 5AV8A 5AVCC 5BS7A 3AZHC 3LZ1C 5B1MA 3X1SC 5GSUA 4X23C 3V9RB 5B32A 3AZMB 3REKA 1KX3A 3LZ1D 3W98A 3X1SD 4X23D 3VH5W 5CPJA 3UT9D 5AY8A 4G91C 3W97C 5GT3A 3NQJB 5GXQB 1P3LA 5JA4B 1P3ID 5JRGA 3W97D 2NQBC 4ZUXA 2BYMB 3B0BA 3MNNB 5AVBA 3LELC 1TZYB 3VH6W 1P34B 1P3AA 1M18B 3RELA 2AROB 3UTAA 3C1CD 4XUJD 3AFAC 2HUEC 5BO0A 3LELD 5AV8D 1KX3C 2RVQC 3WTPC 3B6FC 4JJNC 5CPIA 4KUDA 3C1BA 1KX3D 2RVQD 5B0ZA 4J8UA 4UUZA 3W99C 2F8NA 3AYWB 2BYKA 5CPJD 5AY8D 3X1VA 3AZKA 3X1SB 4YS3C 3MVDA 1BH9B 3UT9B 3MGSA 1ZLAB 4G92C 1KX5C 5JRGD 3AV1C 3AZEA 4YS3D 3AN2A 1P3IB 2FJ7B 3VH6T 3KWQA 5GT0C 3AV1D 1P3GC 2YFVB 1P3AD 4WU8C 3R45A 1P3OA 3KUYC 3UTAD 3MGPC 1P3FA 3AZJC 1P3GD 5B2IA 5B0YA 3C1CB 4EO5B 4XUJB 4WU8D 3A6NA 3KUYD 1Q9CA 4J8VC 3MGPD 3LELB 2JSSA 5CPID 5AV8B 1P3KA 3AZLC 5B1MB 5B2JA 4WU9C 3REJC 3AZFA 3WA9A 4J8UD 4J8VD 2F8ND 3NQUA 3REKB 1KX3B 3AZLD 3X1VD 3AZKD 3W98B 3MVDD 4NE5A 5B40A 5CPJB 5AY8B 3MGSD 1HQ3C 5CP6C 5G49B 5GT3B 5AV5C 4CAYA 1JFIA 3AZED 1P3BA 1P3LB 1B6WA 5AV9C 5AVCA 3KWQD 1HQ3D 5JRGB 3LZ1A 3AZHA 4ZUXB 4CSRA 4X23A 3REIC 1P3OD 1H3OA 5AVBB 1P3PC 1P3AB 1KU5A 3UTAB 3W97A 3A6ND 3WAAC 4NE3A 5BO0B 5DNNC 1P3KD 1P3PD 4WU8B 3W96C 5B2JD 3WTPE 5B24C 3AZFD 3WA9D 1A7WA 3MGPB 5CPIB 3WAAD 2NQBA 2L5AA 1ULYA 4H9OA 4J8UB 4H9NA 4UUZB 3W96D 3B0DB 5B24D 2F8NB 3LELA 2BYKB 5B40D 1F66C 3X1VB 3AZKB 4NE6A 3MVDB 3UTBC 3TU4C 3AFAA 1P3BD 3MGSB 4LD9C 1F66D 5B1LC 5AVCD 3WTPA 3AZHD 4JJNA 3AZEB 3B6FA 3AN2B 3TU4D 2HIOC 3KWQB 5G49A 1U35C 1WWIA 5B1LD 4E45A 3W99A 3R45B 1P3OB 2HIOD 3MGRC 3KXBC 4H9SC 1P3FB 4Z66C 1U35D 4YS3A 3REHC 5B2IB 5B0YB 1B67A 3A6NB 5E5AC 1P3MC 3KXBD 1P3LC 1KX5A 1EQZC 1P3KB 3AV1A 4Z66D 2NQBD 5B2JB 4J8XC 3AZFB 3WA9B 4ZBJC 5GT0A 5AV6C 1P3MD 5CHLB 1EQZD 3NQUB 1P3GA 3AZGC 4NFTA 4WU8A 3KUYA 4J8XD 5CPKC 4HGAB 3MGPA 5B40B 2IO5B 4AWLB 3AZJA 3AFAD 5B31C 3LJAC 3AZGD 3VH5T 4CAYB 3WTPD 1JFIB 4JJND 3B6FD 1P3BB 5CPKD 4J8VA 4WZSB 5AVCB 5B31D 3AZHB 3AZIC 3LZ1B 3MGQA 3AZLA 4WU9A 3REJA 1AOIC 4CSRB 4X23B 3W99D 1H3OB 3WKJC 2HIOB 1S32C 1HQ3A 4G91B 4XZQC 4KHAA 5B31G 5CP6A 3W97B 5AV5A 1KX5D 1KX4C 5AV9A 3AV2C 1M1AC 5GT0D 2NQBB 3REIA 4H9OB 1KX4D 2CV5C 4H9NB 1TAFA 5BNVA 1EQZB 1M1AD 3AZJD 1P3PA 2NZDC 3MGQC 5FUGA 4Z5TC 3WAAA 3AFAB 2HUEB 4M6BA 5DNNA 3O62C 3WTPB 4J8WC 4JJNB 3W96A 3MGQD 4WU9D 3REJD 5B24A 5F99C 3B6FB 4Z5TD 4YM6C 5DNMC 4QLCC 5F99D 3W99B 1M19C 4KGCC 1ID3C 1F66A 5BT1C 5B33C 5CP6D 4YM6D 4YS3B 2YFWA 5AV5D 3UTBA 3TU4A 4QLCD 4G92B 1M19D 4LD9A 1ID3D 1KX5B 5AV9D 5B1LA 5BT1D 3AV1B 2HIOA 3REID 3LZ0C 5GT0B 1U35A 1P3GB 1KX4B 5GXQC 3MGRA 3KUYB 3KXBA 4H9SA 3LZ0D 3AZNA 4E44A 3AZJB 4Z66A 4H9QB 3REHA 5DNND 4R8PA 5E5AA 1P3MA 4J8VB 3MNNC 1EQZA 3AZLB 1TZYC 3MGQB 4WU9B 3REJB 4J8XA 1P34C 1M18C 4Z5TB 2AROC 5AV6A 3MNND 1F1EA 3AZGA 1TZYD 3VH6A 1M18D 5CPKA 3UTBD 2AROD 5B31A 1HQ3B 5CP6B 4KHAB 4LD9D 3LJAA 5AV5B 3X1UC 5AV9B 3AYWC 3AZNC 3AZIA 3KSYA 1AOIA 3B0CW 3REIB 4R8PC 3UT9C 3X1UD 3MGRD 1ZLAC 1TAFB 5BNVB 3AZND 3AYWD 1P3PB 3WKJA 3REHD 5FUGB 1S32A 4WNNB 3LZ0B 1P3IC 2FJ7C 4R8PD 4XZQA 3WAAB 5E5AD 1ZLAD 4H9RA 1N1JA 5DNNB 2PYOC 1KX4A 3W96B 1ID3A 5B24B 3AV2A 2FJ7D 1M1AA 3B6GC 5AV6D 4H9QA 2PYOD 2CV5A 4WV4B 3C1CC 4EO5C 4XUJC 3B6GD 1R4VA 1F66B 5AV8C 2NZDA 3LJAD 5BS7C 2YFWB 3UTBB 5B1MC 3TU4B 4Z5TA 5GSUC 5B32C 4LD9B 3B0CT 3O62A 2CWEA 5BNXA 5B1LB 4J8WA 3AZID 3REKC 1AOID 5F99A 5B1MD 3W98C 5GSUD 5B32D 5CPJC 5AY8C 4YM6A 3X1TA 1U35B 5DNMA 4QLCA 5GT3C 3REKD 3WKJD 4H9PA 3X1UB 3MGRB 1S32D 3KXBB 1BH8A 5KDMB 1M19A 3AZNB 3W98D 5B33A
chains in the Genus database with same CATH superfamily
4XZQD 4Z66B 5JRGC 3REHB 4ZUXC 5GT3D 3V9RA 4R8PB 5B32G 5E5AB 1P3MB 1P3LD 3AZMA 3AV2D 5AVBC 2Y2QA 1P3AC 4ZUXD 4J8XB 2LY8A 4WNNA 3LZ0A 3RELC 4ZBJB 2CV5D 1T3UA 5AV6B 3UTAC 2PYOB 2Y2HA 4Z2MH 5C3IC 4DRAA 5AVBD 3NQJA 3AZGB 4WJ3C 2NZDD 5GXQA 5CPKB 5JA4A 3RELD 3B6GB 5CPIC 1WWSA 4Z2MG 5B31B 4KUDC 3LJAB 3O62D 3X1TC 2BYMA 3C1BC 4J8WD 5B0ZC 3MNNA 4J8UC 3B0DC 1W2EA 4KUDD 1TZYA 4KGCA 3AZIB 1P34A 1M18A 1AOIB 3X1TD 3X1VC 3AZKC 5DNMD 3C1BD 5GSUB 3MVDC 2AROA 5B0ZD 2DQNC 5B32B 3MGSC 4KGCD 3AZMC 5B33D 4DQYB 3WKJB 3AZEC 1S32B 3AN2C 4XZQB 2Y2JA 4H9RB 1N1JB 3KWQC 2F8NH 3AZMD 2ZY2A 3X1UA 3AN2D 5KDMA 3AYWA 3AV2B 1P3OC 2F8NG 1M1AB 1HTAA 3VH5A 1P3FC 1BFMA 3X1SA 2CV5B 1BH9A 3UT9A 5B2IC 5B0YC 5GXQD 1ZLAA 2F2AC 3A6NC 1P3FD 1P3KC 2NZDB 3RELB 5B2JC 1P3IA 2FJ7A 5B2ID 3AZFC 5B0YD 2Y2NA 3WA9C 2F8NK 2PYOA 4DRBA 3O62B 5C3IB 5BNXB 4J8WB 3KFUG 2YFVA 1P34D 5F99B 4HGAC 3B6GA 4KUDB 5B40C 2IO5C 4AWLC 4YM6B 3X1TB 5DNMB 3C1BB 4QLCB 3C1CA 5B0ZB 4XUJA 4H9PB 1P3BC 1M19B 4KGCB 1BH8B 1ID3B 5B33B 5AV8A 5AVCC 5BS7A 3AZHC 3H0LC 3LZ1C 5B1MA 3X1SC 5GSUA 4X23C 3V9RB 5B32A 3AZMB 3REKA 1KX3A 3LZ1D 3W98A 3X1SD 4X23D 3VH5W 5CPJA 3UT9D 2Y2GA 5AY8A 4G91C 3W97C 3EG5B 5GT3A 3NQJB 2RIQA 5GXQB 2XD5A 1P3LA 5JA4B 1P3ID 5JRGA 3W97D 2NQBC 4ZUXA 2BYMB 3B0BA 2Y2IA 3MNNB 2Y2MA 5AVBA 2J8PA 1TZYB 3VH6W 3LELC 1P34B 1P3AA 1M18B 3RELA 3AL0C 2AROB 3UTAA 2ZY3A 3C1CD 4XUJD 3H0RC 3AFAC 2HUEC 5BO0A 3LELD 5AV8D 2JCHA 1KX3C 2RVQC 3WTPC 3B6FC 4JJNC 5CPIA 4KUDA 3C1BA 1KX3D 2RVQD 5B0ZA 4J8UA 4UUZA 3W99C 2F8NA 3AYWB 2BYKA 5CPJD 5AY8D 3X1VA 3AZKA 3X1SB 4YS3C 3MVDA 1BH9B 3UT9B 3MGSA 1ZLAB 4G92C 1KX5C 5JRGD 3AV1C 3AZEA 4YS3D 3AN2A 1P3IB 2FJ7B 3VH6T 3KWQA 5GT0C 2ZY4A 3FDDA 3AV1D 1P3GC 2YFVB 1P3AD 4WU8C 2Y2LA 3R45A 1P3OA 3KUYC 3UTAD 3MGPC 1P3FA 3AZJC 1P3GD 5B2IA 5B0YA 3C1CB 4EO5B 4XUJB 4WU8D 3A6NA 3KUYD 1Q9CA 4J8VC 3MGPD 3LELB 2JSSA 5CPID 5AV8B 1P3KA 3AZLC 5B1MB 5B2JA 4WU9C 3REJC 3AZFA 3WA9A 4J8UD 4J8VD 2F8ND 3NQUA 3REKB 1KX3B 3AZLD 3X1VD 3AZKD 3W98B 3MVDD 4NE5A 5B40A 5CPJB 5AY8B 3MGSD 1HQ3C 5CP6C 5G49B 5GT3B 5AV5C 4CAYA 1JFIA 3AZED 1P3BA 1P3LB 1B6WA 3A1KA 5AV9C 5AVCA 2FFFB 1HQ3D 5JRGB 3LZ1A 3KWQD 3AZHA 4ZUXB 4CSRA 4X23A 3REIC 1P3OD 1H3OA 2Y2OA 5AVBB 1P3PC 1P3AB 2XD1A 1KU5A 3UTAB 3W97A 3A6ND 3WAAC 4NE3A 5BO0B 5DNNC 1P3KD 3EPJA 1P3PD 4WU8B 3W96C 5B2JD 3WTPE 5B24C 3AZFD 3WA9D 1A7WA 3MGPB 5CPIB 3WAAD 2NQBA 2L5AA 1ULYA 2G5HC 4H9OA 4J8UB 4H9NA 4UUZB 3W96D 3B0DB 2Y2KA 5B24D 2F8NB 3LELA 2BYKB 5B40D 1F66C 3X1VB 3AZKB 4NE6A 3MVDB 3UTBC 3TU4C 3AFAA 1P3BD 3MGSB 4LD9C 1F66D 5B1LC 5AVCD 3WTPA 3AZHD 4JJNA 3AZEB 3B6FA 3AN2B 3TU4D 2HIOC 3KWQB 5G49A 1U35C 1WWIA 5B1LD 4E45A 4UPKA 3W99A 3R45B 1P3OB 2HIOD 3MGRC 3KXBC 4H9SC 1P3FB 4Z66C 1U35D 4YS3A 3REHC 5B2IB 5B0YB 1B67A 3A6NB 5E5AC 1P3MC 3KXBD 1P3LC 1KX5A 1EQZC 1P3KB 3AV1A 4Z66D 2NQBD 5B2JB 4J8XC 3AZFB 3WA9B 4ZBJC 5GT0A 5AV6C 1P3MD 5CHLB 1EQZD 3NQUB 1P3GA 3AZGC 4NFTA 4WU8A 3KUYA 4J8XD 2ZM5A 4HGAB 5CPKC 3MGPA 5B40B 2IO5B 4AWLB 3AZJA 3AFAD 5B31C 3LJAC 3AZGD 3VH5T 4CAYB 3WTPD 1JFIB 2W8SA 4JJND 1P3BB 5CPKD 3B6FD 4J8VA 4WZSB 5AVCB 5B31D 3AZHB 3AZIC 3LZ1B 3MGQA 3AZLA 4WU9A 2ZY5A 3REJA 4CSRB 4X23B 1AOIC 3W99D 1H3OB 2BG1A 3WKJC 3EPHA 2HIOB 1S32C 1HQ3A 4G91B 4XZQC 4KHAA 5B31G 5CP6A 3W97B 2DF4C 5AV5A 1KX5D 1KX4C 5AV9A 3AV2C 1M1AC 5GT0D 2NQBB 1Z2CB 3A1IA 3REIA 4H9OB 1PZRA 1KX4D 2CV5C 4H9NB 1TAFA 5BNVA 1EQZB 1M1AD 3AZJD 1P3PA 2NZDC 3MGQC 5FUGA 4Z5TC 3WAAA 3AFAB 2HUEB 4M6BA 5DNNA 3O62C 3WTPB 4J8WC 4JJNB 3W96A 3MGQD 4WU9D 3REJD 5B24A 5F99C 3B6FB 4Z5TD 4YM6C 5DNMC 4QLCC 5F99D 3W99B 1M19C 4KGCC 1ID3C 1F66A 5BT1C 5B33C 5CP6D 4YM6D 4YS3B 2YFWA 5AV5D 3UTBA 3TU4A 3IP4C 4QLCD 3F6TA 4G92B 1M19D 4LD9A 1ID3D 1KX5B 5AV9D 5B1LA 5BT1D 3AV1B 2HIOA 2UWXA 3REID 3LZ0C 3EPKA 5GT0B 1U35A 1P3GB 1KX4B 5GXQC 3MGRA 3KUYB 3KXBA 4H9SA 3LZ0D 3AZNA 4E44A 3AZJB 4Z66A 4H9QB 3REHA 5DNND 4R8PA 5E5AA 1P3MA 4J8VB 3MNNC 1EQZA 3AZLB 1TZYC 3MGQB 4WU9B 3REJB 4J8XA 1P34C 1M18C 4Z5TB 2AROC 5AV6A 3H0MC 3MNND 1F1EA 3AZGA 1TZYD 3VH6A 1M18D 5CPKA 3UTBD 3EPLA 2AROD 5B31A 1HQ3B 5CP6B 4KHAB 4LD9D 3LJAA 5AV5B 3X1UC 5AV9B 3AYWC 3AZNC 3AZIA 3KSYA 1AOIA 3P5JB 3B0CW 3REIB 2G5IC 2JE5A 4R8PC 3UT9C 3X1UD 3MGRD 1ZLAC 1TAFB 5BNVB 3AZND 3AYWD 1P3PB 3WKJA 3REHD 5FUGB 1S32A 4WNNB 3LZ0B 1P3IC 2FJ7C 4R8PD 4XZQA 3WAAB 5E5AD 1ZLAD 4H9RA 1N1JA 5DNNB 2PYOC 1KX4A 3W96B 1ID3A 5B24B 3AV2A 2FJ7D 1M1AA 3B6GC 5AV6D 4H9QA 2PYOD 2CV5A 2Y2PA 4WV4B 3C1CC 4EO5C 4XUJC 3B6GD 1R4VA 1F66B 5AV8C 2NZDA 3LJAD 5BS7C 2YFWB 3UTBB 5B1MC 3TU4B 4Z5TA 5GSUC 5B32C 4LD9B 3B0CT 3O62A 2CWEA 5BNXA 5B1LB 4J8WA 3AZID 3REKC 1AOID 5F99A 5B1MD 3W98C 5GSUD 5B32D 5CPJC 5AY8C 4YM6A 3X1TA 1U35B 5DNMA 4QLCA 5GT3C 3REKD 3WKJD 4H9PA 3X1UB 3MGRB 1S32D 3KXBB 1BH8A 5KDMB 1M19A 3AZNB 3W98D 2VQRA 5B33A
chains in the Genus database with same CATH topology
4XZQD 4Z66B 5JRGC 3REHB 4ZUXC 5GT3D 3V9RA 4R8PB 5B32G 5E5AB 1P3MB 1P3LD 3AZMA 3AV2D 5AVBC 2Y2QA 1P3AC 4ZUXD 4J8XB 2LY8A 4WNNA 3LZ0A 3RELC 4ZBJB 2CV5D 1T3UA 5AV6B 3UTAC 2PYOB 2Y2HA 4Z2MH 5C3IC 4DRAA 5AVBD 3NQJA 3AZGB 4WJ3C 2NZDD 5GXQA 5CPKB 5JA4A 3RELD 3B6GB 5CPIC 1WWSA 4Z2MG 5B31B 4KUDC 3LJAB 3O62D 3X1TC 2BYMA 3C1BC 4J8WD 5B0ZC 3MNNA 4J8UC 3B0DC 1W2EA 4KUDD 1TZYA 4KGCA 3AZIB 1P34A 1M18A 1AOIB 3X1TD 3X1VC 3AZKC 5DNMD 3C1BD 5GSUB 3MVDC 2AROA 5B0ZD 2DQNC 5B32B 3MGSC 4KGCD 3AZMC 5B33D 4DQYB 3WKJB 3AZEC 1S32B 3AN2C 4XZQB 2Y2JA 4H9RB 1N1JB 3KWQC 2F8NH 3AZMD 2ZY2A 3X1UA 3AN2D 5KDMA 3AYWA 3AV2B 1P3OC 2F8NG 1M1AB 1HTAA 3VH5A 1P3FC 1BFMA 3X1SA 2CV5B 1BH9A 3UT9A 5B2IC 5B0YC 5GXQD 1ZLAA 2F2AC 3A6NC 1P3FD 1P3KC 2NZDB 3RELB 5B2JC 1P3IA 2FJ7A 5B2ID 3AZFC 5B0YD 2Y2NA 3WA9C 2F8NK 2PYOA 4DRBA 3O62B 5C3IB 5BNXB 4J8WB 3KFUG 2YFVA 1P34D 5F99B 4HGAC 3B6GA 4KUDB 5B40C 2IO5C 4AWLC 4YM6B 3X1TB 5DNMB 3C1BB 4QLCB 3C1CA 5B0ZB 4XUJA 4H9PB 1P3BC 1M19B 4KGCB 1BH8B 1ID3B 5B33B 5AV8A 5AVCC 5BS7A 3AZHC 3H0LC 3LZ1C 5B1MA 3X1SC 5GSUA 4X23C 3V9RB 5B32A 3AZMB 3REKA 1KX3A 3LZ1D 3W98A 3X1SD 4X23D 3VH5W 5CPJA 3UT9D 2Y2GA 5AY8A 4G91C 3W97C 3EG5B 5GT3A 3NQJB 2RIQA 5GXQB 2XD5A 1P3LA 5JA4B 1P3ID 5JRGA 3W97D 2NQBC 4ZUXA 2BYMB 3B0BA 2Y2IA 3MNNB 2Y2MA 5AVBA 2J8PA 1TZYB 3VH6W 3LELC 1P34B 1P3AA 1M18B 3RELA 3AL0C 2AROB 3UTAA 2ZY3A 3C1CD 4XUJD 3H0RC 3AFAC 2HUEC 5BO0A 3LELD 5AV8D 2JCHA 1KX3C 2RVQC 3WTPC 3B6FC 4JJNC 5CPIA 4KUDA 3C1BA 1KX3D 2RVQD 5B0ZA 4J8UA 4UUZA 3W99C 2F8NA 3AYWB 2BYKA 5CPJD 5AY8D 3X1VA 3AZKA 3X1SB 4YS3C 3MVDA 1BH9B 3UT9B 3MGSA 1ZLAB 4G92C 1KX5C 5JRGD 3AV1C 3AZEA 4YS3D 3AN2A 1P3IB 2FJ7B 3VH6T 3KWQA 5GT0C 2ZY4A 3FDDA 3AV1D 1P3GC 2YFVB 1P3AD 4WU8C 2Y2LA 3R45A 1P3OA 3KUYC 3UTAD 3MGPC 1P3FA 3AZJC 1P3GD 5B2IA 5B0YA 3C1CB 4EO5B 4XUJB 4WU8D 3A6NA 3KUYD 1Q9CA 4J8VC 3MGPD 3LELB 2JSSA 5CPID 5AV8B 1P3KA 3AZLC 5B1MB 5B2JA 4WU9C 3REJC 3AZFA 3WA9A 4J8UD 4J8VD 2F8ND 3NQUA 3REKB 1KX3B 3AZLD 3X1VD 3AZKD 3W98B 3MVDD 4NE5A 5B40A 5CPJB 5AY8B 3MGSD 1HQ3C 5CP6C 5G49B 5GT3B 5AV5C 4CAYA 1JFIA 3AZED 1P3BA 1P3LB 1B6WA 3A1KA 5AV9C 5AVCA 2FFFB 1HQ3D 5JRGB 3LZ1A 3KWQD 3AZHA 4ZUXB 4CSRA 4X23A 3REIC 1P3OD 1H3OA 2Y2OA 5AVBB 1P3PC 1P3AB 2XD1A 1KU5A 3UTAB 3W97A 3A6ND 3WAAC 4NE3A 5BO0B 5DNNC 1P3KD 3EPJA 1P3PD 4WU8B 3W96C 5B2JD 3WTPE 5B24C 3AZFD 3WA9D 1A7WA 3MGPB 5CPIB 3WAAD 2NQBA 2L5AA 1ULYA 2G5HC 4H9OA 4J8UB 4H9NA 4UUZB 3W96D 3B0DB 2Y2KA 5B24D 2F8NB 3LELA 2BYKB 5B40D 1F66C 3X1VB 3AZKB 4NE6A 3MVDB 3UTBC 3TU4C 3AFAA 1P3BD 3MGSB 4LD9C 1F66D 5B1LC 5AVCD 3WTPA 3AZHD 4JJNA 3AZEB 3B6FA 3AN2B 3TU4D 2HIOC 3KWQB 5G49A 1U35C 1WWIA 5B1LD 4E45A 4UPKA 3W99A 3R45B 1P3OB 2HIOD 3MGRC 3KXBC 4H9SC 1P3FB 4Z66C 1U35D 4YS3A 3REHC 5B2IB 5B0YB 1B67A 3A6NB 5E5AC 1P3MC 3KXBD 1P3LC 1KX5A 1EQZC 1P3KB 3AV1A 4Z66D 2NQBD 5B2JB 4J8XC 3AZFB 3WA9B 4ZBJC 5GT0A 5AV6C 1P3MD 5CHLB 1EQZD 3NQUB 1P3GA 3AZGC 4NFTA 4WU8A 3KUYA 4J8XD 2ZM5A 4HGAB 5CPKC 3MGPA 5B40B 2IO5B 4AWLB 3AZJA 3AFAD 5B31C 3LJAC 3AZGD 3VH5T 4CAYB 3WTPD 1JFIB 2W8SA 4JJND 1P3BB 5CPKD 3B6FD 4J8VA 4WZSB 5AVCB 5B31D 3AZHB 3AZIC 3LZ1B 3MGQA 3AZLA 4WU9A 2ZY5A 3REJA 4CSRB 4X23B 1AOIC 3W99D 1H3OB 2BG1A 3WKJC 3EPHA 2HIOB 1S32C 1HQ3A 4G91B 4XZQC 4KHAA 5B31G 5CP6A 3W97B 2DF4C 5AV5A 1KX5D 1KX4C 5AV9A 3AV2C 1M1AC 5GT0D 2NQBB 1Z2CB 3A1IA 3REIA 4H9OB 1PZRA 1KX4D 2CV5C 4H9NB 1TAFA 5BNVA 1EQZB 1M1AD 3AZJD 1P3PA 2NZDC 3MGQC 5FUGA 4Z5TC 3WAAA 3AFAB 2HUEB 4M6BA 5DNNA 3O62C 3WTPB 4J8WC 4JJNB 3W96A 3MGQD 4WU9D 3REJD 5B24A 5F99C 3B6FB 4Z5TD 4YM6C 5DNMC 4QLCC 5F99D 3W99B 1M19C 4KGCC 1ID3C 1F66A 5BT1C 5B33C 5CP6D 4YM6D 4YS3B 2YFWA 5AV5D 3UTBA 3TU4A 3IP4C 4QLCD 3F6TA 4G92B 1M19D 4LD9A 1ID3D 1KX5B 5AV9D 5B1LA 5BT1D 3AV1B 2HIOA 2UWXA 3REID 3LZ0C 3EPKA 5GT0B 1U35A 1P3GB 1KX4B 5GXQC 3MGRA 3KUYB 3KXBA 4H9SA 3LZ0D 3AZNA 4E44A 3AZJB 4Z66A 4H9QB 3REHA 5DNND 4R8PA 5E5AA 1P3MA 4J8VB 3MNNC 1EQZA 3AZLB 1TZYC 3MGQB 4WU9B 3REJB 4J8XA 1P34C 1M18C 4Z5TB 2AROC 5AV6A 3H0MC 3MNND 1F1EA 3AZGA 1TZYD 3VH6A 1M18D 5CPKA 3UTBD 3EPLA 2AROD 5B31A 1HQ3B 5CP6B 4KHAB 4LD9D 3LJAA 5AV5B 3X1UC 5AV9B 3AYWC 3AZNC 3AZIA 3KSYA 1AOIA 3P5JB 3B0CW 3REIB 2G5IC 2JE5A 4R8PC 3UT9C 3X1UD 3MGRD 1ZLAC 1TAFB 5BNVB 3AZND 3AYWD 1P3PB 3WKJA 3REHD 5FUGB 1S32A 4WNNB 3LZ0B 1P3IC 2FJ7C 4R8PD 4XZQA 3WAAB 5E5AD 1ZLAD 4H9RA 1N1JA 5DNNB 2PYOC 1KX4A 3W96B 1ID3A 5B24B 3AV2A 2FJ7D 1M1AA 3B6GC 5AV6D 4H9QA 2PYOD 2CV5A 2Y2PA 4WV4B 3C1CC 4EO5C 4XUJC 3B6GD 1R4VA 1F66B 5AV8C 2NZDA 3LJAD 5BS7C 2YFWB 3UTBB 5B1MC 3TU4B 4Z5TA 5GSUC 5B32C 4LD9B 3B0CT 3O62A 2CWEA 5BNXA 5B1LB 4J8WA 3AZID 3REKC 1AOID 5F99A 5B1MD 3W98C 5GSUD 5B32D 5CPJC 5AY8C 4YM6A 3X1TA 1U35B 5DNMA 4QLCA 5GT3C 3REKD 3WKJD 4H9PA 3X1UB 3MGRB 1S32D 3KXBB 1BH8A 5KDMB 1M19A 3AZNB 3W98D 2VQRA 5B33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  4Z66 B;  5JRG C;  3REH B;  4ZUX C;  5GT3 D;  3V9R A;  4R8P B;  5B32 G;  5E5A B;  1P3M B;  1P3L D;  3AZM A;  3AV2 D;  5AVB C;  1P3A C;  4ZUX D;  4J8X B;  2LY8 A;  4WNN A;  3LZ0 A;  3REL C;  4ZBJ B;  2CV5 D;  3UTA C;  5AV6 B;  2PYO B;  4Z2M H;  5C3I C;  4DRA A;  5AVB D;  3NQJ A;  3AZG B;  2NZD D;  5GXQ A;  5CPK B;  5JA4 A;  3REL D;  3B6G B;  5CPI C;  1WWS A;  4Z2M G;  5B31 B;  4KUD C;  3LJA B;  3O62 D;  3X1T C;  2BYM A;  3C1B C;  4J8W D;  5B0Z C;  3MNN A;  4J8U C;  3B0D C;  4KUD D;  1TZY A;  4KGC A;  3AZI B;  1P34 A;  1M18 A;  1AOI B;  3X1T D;  3X1V C;  3AZK C;  5DNM D;  3C1B D;  5GSU B;  3MVD C;  2ARO A;  5B0Z D;  5B32 B;  3MGS C;  4KGC D;  3AZM C;  5B33 D;  3WKJ B;  3AZE C;  1S32 B;  3AN2 C;  4XZQ B;  4H9R B;  1N1J B;  3KWQ C;  2F8N H;  3AZM D;  3X1U A;  3AN2 D;  5KDM A;  3AYW A;  3AV2 B;  1P3O C;  2F8N G;  1M1A B;  1HTA A;  3VH5 A;  1P3F C;  1BFM A;  3X1S A;  2CV5 B;  1BH9 A;  3UT9 A;  5B2I C;  5B0Y C;  5GXQ D;  1ZLA A;  3A6N C;  1P3F D;  1P3K C;  2NZD B;  3REL B;  5B2J C;  1P3I A;  2FJ7 A;  5B2I D;  3AZF C;  5B0Y D;  3WA9 C;  2F8N K;  2PYO A;  4DRB A;  3O62 B;  5C3I B;  5BNX B;  4J8W B;  2YFV A;  1P34 D;  5F99 B;  4HGA C;  3B6G A;  4KUD B;  5B40 C;  2IO5 C;  4AWL C;  4YM6 B;  3X1T B;  5DNM B;  3C1B B;  4QLC B;  3C1C A;  5B0Z B;  4XUJ A;  4H9P B;  1P3B C;  1M19 B;  4KGC B;  1BH8 B;  1ID3 B;  5B33 B;  5AV8 A;  5AVC C;  5BS7 A;  3AZH C;  3LZ1 C;  5B1M A;  3X1S C;  5GSU A;  4X23 C;  3V9R B;  5B32 A;  3AZM B;  3REK A;  1KX3 A;  3LZ1 D;  3W98 A;  3X1S D;  4X23 D;  3VH5 W;  5CPJ A;  3UT9 D;  5AY8 A;  4G91 C;  3W97 C;  5GT3 A;  3NQJ B;  5GXQ B;  1P3L A;  5JA4 B;  1P3I D;  5JRG A;  3W97 D;  2NQB C;  4ZUX A;  2BYM B;  3B0B A;  3MNN B;  5AVB A;  3LEL C;  1TZY B;  3VH6 W;  1P34 B;  1P3A A;  1M18 B;  3REL A;  2ARO B;  3UTA A;  3C1C D;  4XUJ D;  3AFA C;  2HUE C;  5BO0 A;  3LEL D;  5AV8 D;  1KX3 C;  2RVQ C;  3WTP C;  3B6F C;  4JJN C;  5CPI A;  4KUD A;  3C1B A;  1KX3 D;  2RVQ D;  5B0Z A;  4J8U A;  4UUZ A;  3W99 C;  2F8N A;  3AYW B;  2BYK A;  5CPJ D;  5AY8 D;  3X1V A;  3AZK A;  3X1S B;  4YS3 C;  3MVD A;  1BH9 B;  3UT9 B;  3MGS A;  1ZLA B;  4G92 C;  1KX5 C;  5JRG D;  3AV1 C;  3AZE A;  4YS3 D;  3AN2 A;  1P3I B;  2FJ7 B;  3VH6 T;  3KWQ A;  5GT0 C;  3AV1 D;  1P3G C;  2YFV B;  1P3A D;  4WU8 C;  3R45 A;  1P3O A;  3KUY C;  3UTA D;  3MGP C;  1P3F A;  3AZJ C;  1P3G D;  5B2I A;  5B0Y A;  3C1C B;  4EO5 B;  4XUJ B;  4WU8 D;  3A6N A;  3KUY D;  1Q9C A;  4J8V C;  3MGP D;  3LEL B;  2JSS A;  5CPI D;  5AV8 B;  1P3K A;  3AZL C;  5B1M B;  5B2J A;  4WU9 C;  3REJ C;  3AZF A;  3WA9 A;  4J8U D;  4J8V D;  2F8N D;  3NQU A;  3REK B;  1KX3 B;  3AZL D;  3X1V D;  3AZK D;  3W98 B;  3MVD D;  4NE5 A;  5B40 A;  5CPJ B;  5AY8 B;  3MGS D;  1HQ3 C;  5CP6 C;  5G49 B;  5GT3 B;  5AV5 C;  4CAY A;  1JFI A;  3AZE D;  1P3B A;  1P3L B;  1B6W A;  5AV9 C;  5AVC A;  3KWQ D;  1HQ3 D;  5JRG B;  3LZ1 A;  3AZH A;  4ZUX B;  4CSR A;  4X23 A;  3REI C;  1P3O D;  1H3O A;  5AVB B;  1P3P C;  1P3A B;  1KU5 A;  3UTA B;  3W97 A;  3A6N D;  3WAA C;  4NE3 A;  5BO0 B;  5DNN C;  1P3K D;  1P3P D;  4WU8 B;  3W96 C;  5B2J D;  3WTP E;  5B24 C;  3AZF D;  3WA9 D;  1A7W A;  3MGP B;  5CPI B;  3WAA D;  2NQB A;  2L5A A;  1ULY A;  4H9O A;  4J8U B;  4H9N A;  4UUZ B;  3W96 D;  3B0D B;  5B24 D;  2F8N B;  3LEL A;  2BYK B;  5B40 D;  1F66 C;  3X1V B;  3AZK B;  4NE6 A;  3MVD B;  3UTB C;  3TU4 C;  3AFA A;  1P3B D;  3MGS B;  4LD9 C;  1F66 D;  5B1L C;  5AVC D;  3WTP A;  3AZH D;  4JJN A;  3AZE B;  3B6F A;  3AN2 B;  3TU4 D;  2HIO C;  3KWQ B;  5G49 A;  1U35 C;  1WWI A;  5B1L D;  4E45 A;  3W99 A;  3R45 B;  1P3O B;  2HIO D;  3MGR C;  3KXB C;  4H9S C;  1P3F B;  4Z66 C;  1U35 D;  4YS3 A;  3REH C;  5B2I B;  5B0Y B;  1B67 A;  3A6N B;  5E5A C;  1P3M C;  3KXB D;  1P3L C;  1KX5 A;  1EQZ C;  1P3K B;  3AV1 A;  4Z66 D;  2NQB D;  5B2J B;  4J8X C;  3AZF B;  3WA9 B;  4ZBJ C;  5GT0 A;  5AV6 C;  1P3M D;  5CHL B;  1EQZ D;  3NQU B;  1P3G A;  3AZG C;  4NFT A;  4WU8 A;  3KUY A;  4J8X D;  5CPK C;  4HGA B;  3MGP A;  5B40 B;  2IO5 B;  4AWL B;  3AZJ A;  3AFA D;  5B31 C;  3LJA C;  3AZG D;  3VH5 T;  4CAY B;  3WTP D;  1JFI B;  4JJN D;  3B6F D;  1P3B B;  5CPK D;  4J8V A;  4WZS B;  5AVC B;  5B31 D;  3AZH B;  3AZI C;  3LZ1 B;  3MGQ A;  3AZL A;  4WU9 A;  3REJ A;  1AOI C;  4CSR B;  4X23 B;  3W99 D;  1H3O B;  3WKJ C;  2HIO B;  1S32 C;  1HQ3 A;  4G91 B;  4XZQ C;  4KHA A;  5B31 G;  5CP6 A;  3W97 B;  5AV5 A;  1KX5 D;  1KX4 C;  5AV9 A;  3AV2 C;  1M1A C;  5GT0 D;  2NQB B;  3REI A;  4H9O B;  1KX4 D;  2CV5 C;  4H9N B;  1TAF A;  5BNV A;  1EQZ B;  1M1A D;  3AZJ D;  1P3P A;  2NZD C;  3MGQ C;  5FUG A;  4Z5T C;  3WAA A;  3AFA B;  2HUE B;  4M6B A;  5DNN A;  3O62 C;  3WTP B;  4J8W C;  4JJN B;  3W96 A;  3MGQ D;  4WU9 D;  3REJ D;  5B24 A;  5F99 C;  3B6F B;  4Z5T D;  4YM6 C;  5DNM C;  4QLC C;  5F99 D;  3W99 B;  1M19 C;  4KGC C;  1ID3 C;  1F66 A;  5BT1 C;  5B33 C;  5CP6 D;  4YM6 D;  4YS3 B;  2YFW A;  5AV5 D;  3UTB A;  3TU4 A;  4QLC D;  4G92 B;  1M19 D;  4LD9 A;  1ID3 D;  1KX5 B;  5AV9 D;  5B1L A;  5BT1 D;  3AV1 B;  2HIO A;  3REI D;  3LZ0 C;  5GT0 B;  1U35 A;  1P3G B;  1KX4 B;  5GXQ C;  3MGR A;  3KUY B;  3KXB A;  4H9S A;  3LZ0 D;  3AZN A;  4E44 A;  3AZJ B;  4Z66 A;  4H9Q B;  3REH A;  5DNN D;  4R8P A;  5E5A A;  1P3M A;  4J8V B;  3MNN C;  1EQZ A;  3AZL B;  1TZY C;  3MGQ B;  4WU9 B;  3REJ B;  4J8X A;  1P34 C;  1M18 C;  4Z5T B;  2ARO C;  5AV6 A;  3MNN D;  1F1E A;  3AZG A;  1TZY D;  3VH6 A;  1M18 D;  5CPK A;  3UTB D;  2ARO D;  5B31 A;  1HQ3 B;  5CP6 B;  4KHA B;  4LD9 D;  3LJA A;  5AV5 B;  3X1U C;  5AV9 B;  3AYW C;  3AZN C;  3AZI A;  3KSY A;  1AOI A;  3B0C W;  3REI B;  4R8P C;  3UT9 C;  3X1U D;  3MGR D;  1ZLA C;  1TAF B;  5BNV B;  3AZN D;  3AYW D;  1P3P B;  3WKJ A;  3REH D;  5FUG B;  1S32 A;  4WNN B;  3LZ0 B;  1P3I C;  2FJ7 C;  4R8P D;  4XZQ A;  3WAA B;  5E5A D;  1ZLA D;  4H9R A;  1N1J A;  5DNN B;  2PYO C;  1KX4 A;  3W96 B;  1ID3 A;  5B24 B;  3AV2 A;  2FJ7 D;  1M1A A;  3B6G C;  5AV6 D;  4H9Q A;  2PYO D;  2CV5 A;  4WV4 B;  3C1C C;  4EO5 C;  4XUJ C;  3B6G D;  1R4V A;  1F66 B;  5AV8 C;  2NZD A;  3LJA D;  5BS7 C;  2YFW B;  3UTB B;  5B1M C;  3TU4 B;  4Z5T A;  5GSU C;  5B32 C;  4LD9 B;  3B0C T;  3O62 A;  2CWE A;  5BNX A;  5B1L B;  4J8W A;  3AZI D;  3REK C;  1AOI D;  5F99 A;  5B1M D;  3W98 C;  5GSU D;  5B32 D;  5CPJ C;  5AY8 C;  4YM6 A;  3X1T A;  1U35 B;  5DNM A;  4QLC A;  5GT3 C;  3REK D;  3WKJ D;  4H9P A;  3X1U B;  3MGR B;  1S32 D;  3KXB B;  1BH8 A;  5KDM B;  1M19 A;  3AZN B;  3W98 D;  5B33 A; 
#chains in the Genus database with same CATH topology
 4XZQ D;  4Z66 B;  5JRG C;  3REH B;  4ZUX C;  5GT3 D;  3V9R A;  4R8P B;  5B32 G;  5E5A B;  1P3M B;  1P3L D;  3AZM A;  3AV2 D;  5AVB C;  2Y2Q A;  1P3A C;  4ZUX D;  4J8X B;  2LY8 A;  4WNN A;  3LZ0 A;  3REL C;  4ZBJ B;  2CV5 D;  1T3U A;  5AV6 B;  3UTA C;  2PYO B;  2Y2H A;  4Z2M H;  5C3I C;  4DRA A;  5AVB D;  3NQJ A;  3AZG B;  4WJ3 C;  2NZD D;  5GXQ A;  5CPK B;  5JA4 A;  3REL D;  3B6G B;  5CPI C;  1WWS A;  4Z2M G;  5B31 B;  4KUD C;  3LJA B;  3O62 D;  3X1T C;  2BYM A;  3C1B C;  4J8W D;  5B0Z C;  3MNN A;  4J8U C;  3B0D C;  1W2E A;  4KUD D;  1TZY A;  4KGC A;  3AZI B;  1P34 A;  1M18 A;  1AOI B;  3X1T D;  3X1V C;  3AZK C;  5DNM D;  3C1B D;  5GSU B;  3MVD C;  2ARO A;  5B0Z D;  2DQN C;  5B32 B;  3MGS C;  4KGC D;  3AZM C;  5B33 D;  4DQY B;  3WKJ B;  3AZE C;  1S32 B;  3AN2 C;  4XZQ B;  2Y2J A;  4H9R B;  1N1J B;  3KWQ C;  2F8N H;  3AZM D;  2ZY2 A;  3X1U A;  3AN2 D;  5KDM A;  3AYW A;  3AV2 B;  1P3O C;  2F8N G;  1M1A B;  1HTA A;  3VH5 A;  1P3F C;  1BFM A;  3X1S A;  2CV5 B;  1BH9 A;  3UT9 A;  5B2I C;  5B0Y C;  5GXQ D;  1ZLA A;  2F2A C;  3A6N C;  1P3F D;  1P3K C;  2NZD B;  3REL B;  5B2J C;  1P3I A;  2FJ7 A;  5B2I D;  3AZF C;  5B0Y D;  2Y2N A;  3WA9 C;  2F8N K;  2PYO A;  4DRB A;  3O62 B;  5C3I B;  5BNX B;  4J8W B;  3KFU G;  2YFV A;  1P34 D;  5F99 B;  4HGA C;  3B6G A;  4KUD B;  5B40 C;  2IO5 C;  4AWL C;  4YM6 B;  3X1T B;  5DNM B;  3C1B B;  4QLC B;  3C1C A;  5B0Z B;  4XUJ A;  4H9P B;  1P3B C;  1M19 B;  4KGC B;  1BH8 B;  1ID3 B;  5B33 B;  5AV8 A;  5AVC C;  5BS7 A;  3AZH C;  3H0L C;  3LZ1 C;  5B1M A;  3X1S C;  5GSU A;  4X23 C;  3V9R B;  5B32 A;  3AZM B;  3REK A;  1KX3 A;  3LZ1 D;  3W98 A;  3X1S D;  4X23 D;  3VH5 W;  5CPJ A;  3UT9 D;  2Y2G A;  5AY8 A;  4G91 C;  3W97 C;  3EG5 B;  5GT3 A;  3NQJ B;  2RIQ A;  5GXQ B;  2XD5 A;  1P3L A;  5JA4 B;  1P3I D;  5JRG A;  3W97 D;  2NQB C;  4ZUX A;  2BYM B;  3B0B A;  2Y2I A;  3MNN B;  2Y2M A;  5AVB A;  2J8P A;  1TZY B;  3VH6 W;  3LEL C;  1P34 B;  1P3A A;  1M18 B;  3REL A;  3AL0 C;  2ARO B;  3UTA A;  2ZY3 A;  3C1C D;  4XUJ D;  3H0R C;  3AFA C;  2HUE C;  5BO0 A;  3LEL D;  5AV8 D;  2JCH A;  1KX3 C;  2RVQ C;  3WTP C;  3B6F C;  4JJN C;  5CPI A;  4KUD A;  3C1B A;  1KX3 D;  2RVQ D;  5B0Z A;  4J8U A;  4UUZ A;  3W99 C;  2F8N A;  3AYW B;  2BYK A;  5CPJ D;  5AY8 D;  3X1V A;  3AZK A;  3X1S B;  4YS3 C;  3MVD A;  1BH9 B;  3UT9 B;  3MGS A;  1ZLA B;  4G92 C;  1KX5 C;  5JRG D;  3AV1 C;  3AZE A;  4YS3 D;  3AN2 A;  1P3I B;  2FJ7 B;  3VH6 T;  3KWQ A;  5GT0 C;  2ZY4 A;  3FDD A;  3AV1 D;  1P3G C;  2YFV B;  1P3A D;  4WU8 C;  2Y2L A;  3R45 A;  1P3O A;  3KUY C;  3UTA D;  3MGP C;  1P3F A;  3AZJ C;  1P3G D;  5B2I A;  5B0Y A;  3C1C B;  4EO5 B;  4XUJ B;  4WU8 D;  3A6N A;  3KUY D;  1Q9C A;  4J8V C;  3MGP D;  3LEL B;  2JSS A;  5CPI D;  5AV8 B;  1P3K A;  3AZL C;  5B1M B;  5B2J A;  4WU9 C;  3REJ C;  3AZF A;  3WA9 A;  4J8U D;  4J8V D;  2F8N D;  3NQU A;  3REK B;  1KX3 B;  3AZL D;  3X1V D;  3AZK D;  3W98 B;  3MVD D;  4NE5 A;  5B40 A;  5CPJ B;  5AY8 B;  3MGS D;  1HQ3 C;  5CP6 C;  5G49 B;  5GT3 B;  5AV5 C;  4CAY A;  1JFI A;  3AZE D;  1P3B A;  1P3L B;  1B6W A;  3A1K A;  5AV9 C;  5AVC A;  2FFF B;  1HQ3 D;  5JRG B;  3LZ1 A;  3KWQ D;  3AZH A;  4ZUX B;  4CSR A;  4X23 A;  3REI C;  1P3O D;  1H3O A;  2Y2O A;  5AVB B;  1P3P C;  1P3A B;  2XD1 A;  1KU5 A;  3UTA B;  3W97 A;  3A6N D;  3WAA C;  4NE3 A;  5BO0 B;  5DNN C;  1P3K D;  3EPJ A;  1P3P D;  4WU8 B;  3W96 C;  5B2J D;  3WTP E;  5B24 C;  3AZF D;  3WA9 D;  1A7W A;  3MGP B;  5CPI B;  3WAA D;  2NQB A;  2L5A A;  1ULY A;  2G5H C;  4H9O A;  4J8U B;  4H9N A;  4UUZ B;  3W96 D;  3B0D B;  2Y2K A;  5B24 D;  2F8N B;  3LEL A;  2BYK B;  5B40 D;  1F66 C;  3X1V B;  3AZK B;  4NE6 A;  3MVD B;  3UTB C;  3TU4 C;  3AFA A;  1P3B D;  3MGS B;  4LD9 C;  1F66 D;  5B1L C;  5AVC D;  3WTP A;  3AZH D;  4JJN A;  3AZE B;  3B6F A;  3AN2 B;  3TU4 D;  2HIO C;  3KWQ B;  5G49 A;  1U35 C;  1WWI A;  5B1L D;  4E45 A;  4UPK A;  3W99 A;  3R45 B;  1P3O B;  2HIO D;  3MGR C;  3KXB C;  4H9S C;  1P3F B;  4Z66 C;  1U35 D;  4YS3 A;  3REH C;  5B2I B;  5B0Y B;  1B67 A;  3A6N B;  5E5A C;  1P3M C;  3KXB D;  1P3L C;  1KX5 A;  1EQZ C;  1P3K B;  3AV1 A;  4Z66 D;  2NQB D;  5B2J B;  4J8X C;  3AZF B;  3WA9 B;  4ZBJ C;  5GT0 A;  5AV6 C;  1P3M D;  5CHL B;  1EQZ D;  3NQU B;  1P3G A;  3AZG C;  4NFT A;  4WU8 A;  3KUY A;  4J8X D;  2ZM5 A;  4HGA B;  5CPK C;  3MGP A;  5B40 B;  2IO5 B;  4AWL B;  3AZJ A;  3AFA D;  5B31 C;  3LJA C;  3AZG D;  3VH5 T;  4CAY B;  3WTP D;  1JFI B;  2W8S A;  4JJN D;  1P3B B;  5CPK D;  3B6F D;  4J8V A;  4WZS B;  5AVC B;  5B31 D;  3AZH B;  3AZI C;  3LZ1 B;  3MGQ A;  3AZL A;  4WU9 A;  2ZY5 A;  3REJ A;  4CSR B;  4X23 B;  1AOI C;  3W99 D;  1H3O B;  2BG1 A;  3WKJ C;  3EPH A;  2HIO B;  1S32 C;  1HQ3 A;  4G91 B;  4XZQ C;  4KHA A;  5B31 G;  5CP6 A;  3W97 B;  2DF4 C;  5AV5 A;  1KX5 D;  1KX4 C;  5AV9 A;  3AV2 C;  1M1A C;  5GT0 D;  2NQB B;  1Z2C B;  3A1I A;  3REI A;  4H9O B;  1PZR A;  1KX4 D;  2CV5 C;  4H9N B;  1TAF A;  5BNV A;  1EQZ B;  1M1A D;  3AZJ D;  1P3P A;  2NZD C;  3MGQ C;  5FUG A;  4Z5T C;  3WAA A;  3AFA B;  2HUE B;  4M6B A;  5DNN A;  3O62 C;  3WTP B;  4J8W C;  4JJN B;  3W96 A;  3MGQ D;  4WU9 D;  3REJ D;  5B24 A;  5F99 C;  3B6F B;  4Z5T D;  4YM6 C;  5DNM C;  4QLC C;  5F99 D;  3W99 B;  1M19 C;  4KGC C;  1ID3 C;  1F66 A;  5BT1 C;  5B33 C;  5CP6 D;  4YM6 D;  4YS3 B;  2YFW A;  5AV5 D;  3UTB A;  3TU4 A;  3IP4 C;  4QLC D;  3F6T A;  4G92 B;  1M19 D;  4LD9 A;  1ID3 D;  1KX5 B;  5AV9 D;  5B1L A;  5BT1 D;  3AV1 B;  2HIO A;  2UWX A;  3REI D;  3LZ0 C;  3EPK A;  5GT0 B;  1U35 A;  1P3G B;  1KX4 B;  5GXQ C;  3MGR A;  3KUY B;  3KXB A;  4H9S A;  3LZ0 D;  3AZN A;  4E44 A;  3AZJ B;  4Z66 A;  4H9Q B;  3REH A;  5DNN D;  4R8P A;  5E5A A;  1P3M A;  4J8V B;  3MNN C;  1EQZ A;  3AZL B;  1TZY C;  3MGQ B;  4WU9 B;  3REJ B;  4J8X A;  1P34 C;  1M18 C;  4Z5T B;  2ARO C;  5AV6 A;  3H0M C;  3MNN D;  1F1E A;  3AZG A;  1TZY D;  3VH6 A;  1M18 D;  5CPK A;  3UTB D;  3EPL A;  2ARO D;  5B31 A;  1HQ3 B;  5CP6 B;  4KHA B;  4LD9 D;  3LJA A;  5AV5 B;  3X1U C;  5AV9 B;  3AYW C;  3AZN C;  3AZI A;  3KSY A;  1AOI A;  3P5J B;  3B0C W;  3REI B;  2G5I C;  2JE5 A;  4R8P C;  3UT9 C;  3X1U D;  3MGR D;  1ZLA C;  1TAF B;  5BNV B;  3AZN D;  3AYW D;  1P3P B;  3WKJ A;  3REH D;  5FUG B;  1S32 A;  4WNN B;  3LZ0 B;  1P3I C;  2FJ7 C;  4R8P D;  4XZQ A;  3WAA B;  5E5A D;  1ZLA D;  4H9R A;  1N1J A;  5DNN B;  2PYO C;  1KX4 A;  3W96 B;  1ID3 A;  5B24 B;  3AV2 A;  2FJ7 D;  1M1A A;  3B6G C;  5AV6 D;  4H9Q A;  2PYO D;  2CV5 A;  2Y2P A;  4WV4 B;  3C1C C;  4EO5 C;  4XUJ C;  3B6G D;  1R4V A;  1F66 B;  5AV8 C;  2NZD A;  3LJA D;  5BS7 C;  2YFW B;  3UTB B;  5B1M C;  3TU4 B;  4Z5T A;  5GSU C;  5B32 C;  4LD9 B;  3B0C T;  3O62 A;  2CWE A;  5BNX A;  5B1L B;  4J8W A;  3AZI D;  3REK C;  1AOI D;  5F99 A;  5B1M D;  3W98 C;  5GSU D;  5B32 D;  5CPJ C;  5AY8 C;  4YM6 A;  3X1T A;  1U35 B;  5DNM A;  4QLC A;  5GT3 C;  3REK D;  3WKJ D;  4H9P A;  3X1U B;  3MGR B;  1S32 D;  3KXB B;  1BH8 A;  5KDM B;  1M19 A;  3AZN B;  3W98 D;  2VQR A;  5B33 A; 
#chains in the Genus database with same CATH homology
 4XZQ D;  4Z66 B;  5JRG C;  3REH B;  4ZUX C;  5GT3 D;  3V9R A;  4R8P B;  5B32 G;  5E5A B;  1P3M B;  1P3L D;  3AZM A;  3AV2 D;  5AVB C;  2Y2Q A;  1P3A C;  4ZUX D;  4J8X B;  2LY8 A;  4WNN A;  3LZ0 A;  3REL C;  4ZBJ B;  2CV5 D;  1T3U A;  5AV6 B;  3UTA C;  2PYO B;  2Y2H A;  4Z2M H;  5C3I C;  4DRA A;  5AVB D;  3NQJ A;  3AZG B;  4WJ3 C;  2NZD D;  5GXQ A;  5CPK B;  5JA4 A;  3REL D;  3B6G B;  5CPI C;  1WWS A;  4Z2M G;  5B31 B;  4KUD C;  3LJA B;  3O62 D;  3X1T C;  2BYM A;  3C1B C;  4J8W D;  5B0Z C;  3MNN A;  4J8U C;  3B0D C;  1W2E A;  4KUD D;  1TZY A;  4KGC A;  3AZI B;  1P34 A;  1M18 A;  1AOI B;  3X1T D;  3X1V C;  3AZK C;  5DNM D;  3C1B D;  5GSU B;  3MVD C;  2ARO A;  5B0Z D;  2DQN C;  5B32 B;  3MGS C;  4KGC D;  3AZM C;  5B33 D;  4DQY B;  3WKJ B;  3AZE C;  1S32 B;  3AN2 C;  4XZQ B;  2Y2J A;  4H9R B;  1N1J B;  3KWQ C;  2F8N H;  3AZM D;  2ZY2 A;  3X1U A;  3AN2 D;  5KDM A;  3AYW A;  3AV2 B;  1P3O C;  2F8N G;  1M1A B;  1HTA A;  3VH5 A;  1P3F C;  1BFM A;  3X1S A;  2CV5 B;  1BH9 A;  3UT9 A;  5B2I C;  5B0Y C;  5GXQ D;  1ZLA A;  2F2A C;  3A6N C;  1P3F D;  1P3K C;  2NZD B;  3REL B;  5B2J C;  1P3I A;  2FJ7 A;  5B2I D;  3AZF C;  5B0Y D;  2Y2N A;  3WA9 C;  2F8N K;  2PYO A;  4DRB A;  3O62 B;  5C3I B;  5BNX B;  4J8W B;  3KFU G;  2YFV A;  1P34 D;  5F99 B;  4HGA C;  3B6G A;  4KUD B;  5B40 C;  2IO5 C;  4AWL C;  4YM6 B;  3X1T B;  5DNM B;  3C1B B;  4QLC B;  3C1C A;  5B0Z B;  4XUJ A;  4H9P B;  1P3B C;  1M19 B;  4KGC B;  1BH8 B;  1ID3 B;  5B33 B;  5AV8 A;  5AVC C;  5BS7 A;  3AZH C;  3H0L C;  3LZ1 C;  5B1M A;  3X1S C;  5GSU A;  4X23 C;  3V9R B;  5B32 A;  3AZM B;  3REK A;  1KX3 A;  3LZ1 D;  3W98 A;  3X1S D;  4X23 D;  3VH5 W;  5CPJ A;  3UT9 D;  2Y2G A;  5AY8 A;  4G91 C;  3W97 C;  3EG5 B;  5GT3 A;  3NQJ B;  2RIQ A;  5GXQ B;  2XD5 A;  1P3L A;  5JA4 B;  1P3I D;  5JRG A;  3W97 D;  2NQB C;  4ZUX A;  2BYM B;  3B0B A;  2Y2I A;  3MNN B;  2Y2M A;  5AVB A;  2J8P A;  1TZY B;  3VH6 W;  3LEL C;  1P34 B;  1P3A A;  1M18 B;  3REL A;  3AL0 C;  2ARO B;  3UTA A;  2ZY3 A;  3C1C D;  4XUJ D;  3H0R C;  3AFA C;  2HUE C;  5BO0 A;  3LEL D;  5AV8 D;  2JCH A;  1KX3 C;  2RVQ C;  3WTP C;  3B6F C;  4JJN C;  5CPI A;  4KUD A;  3C1B A;  1KX3 D;  2RVQ D;  5B0Z A;  4J8U A;  4UUZ A;  3W99 C;  2F8N A;  3AYW B;  2BYK A;  5CPJ D;  5AY8 D;  3X1V A;  3AZK A;  3X1S B;  4YS3 C;  3MVD A;  1BH9 B;  3UT9 B;  3MGS A;  1ZLA B;  4G92 C;  1KX5 C;  5JRG D;  3AV1 C;  3AZE A;  4YS3 D;  3AN2 A;  1P3I B;  2FJ7 B;  3VH6 T;  3KWQ A;  5GT0 C;  2ZY4 A;  3FDD A;  3AV1 D;  1P3G C;  2YFV B;  1P3A D;  4WU8 C;  2Y2L A;  3R45 A;  1P3O A;  3KUY C;  3UTA D;  3MGP C;  1P3F A;  3AZJ C;  1P3G D;  5B2I A;  5B0Y A;  3C1C B;  4EO5 B;  4XUJ B;  4WU8 D;  3A6N A;  3KUY D;  1Q9C A;  4J8V C;  3MGP D;  3LEL B;  2JSS A;  5CPI D;  5AV8 B;  1P3K A;  3AZL C;  5B1M B;  5B2J A;  4WU9 C;  3REJ C;  3AZF A;  3WA9 A;  4J8U D;  4J8V D;  2F8N D;  3NQU A;  3REK B;  1KX3 B;  3AZL D;  3X1V D;  3AZK D;  3W98 B;  3MVD D;  4NE5 A;  5B40 A;  5CPJ B;  5AY8 B;  3MGS D;  1HQ3 C;  5CP6 C;  5G49 B;  5GT3 B;  5AV5 C;  4CAY A;  1JFI A;  3AZE D;  1P3B A;  1P3L B;  1B6W A;  3A1K A;  5AV9 C;  5AVC A;  2FFF B;  1HQ3 D;  5JRG B;  3LZ1 A;  3KWQ D;  3AZH A;  4ZUX B;  4CSR A;  4X23 A;  3REI C;  1P3O D;  1H3O A;  2Y2O A;  5AVB B;  1P3P C;  1P3A B;  2XD1 A;  1KU5 A;  3UTA B;  3W97 A;  3A6N D;  3WAA C;  4NE3 A;  5BO0 B;  5DNN C;  1P3K D;  3EPJ A;  1P3P D;  4WU8 B;  3W96 C;  5B2J D;  3WTP E;  5B24 C;  3AZF D;  3WA9 D;  1A7W A;  3MGP B;  5CPI B;  3WAA D;  2NQB A;  2L5A A;  1ULY A;  2G5H C;  4H9O A;  4J8U B;  4H9N A;  4UUZ B;  3W96 D;  3B0D B;  2Y2K A;  5B24 D;  2F8N B;  3LEL A;  2BYK B;  5B40 D;  1F66 C;  3X1V B;  3AZK B;  4NE6 A;  3MVD B;  3UTB C;  3TU4 C;  3AFA A;  1P3B D;  3MGS B;  4LD9 C;  1F66 D;  5B1L C;  5AVC D;  3WTP A;  3AZH D;  4JJN A;  3AZE B;  3B6F A;  3AN2 B;  3TU4 D;  2HIO C;  3KWQ B;  5G49 A;  1U35 C;  1WWI A;  5B1L D;  4E45 A;  4UPK A;  3W99 A;  3R45 B;  1P3O B;  2HIO D;  3MGR C;  3KXB C;  4H9S C;  1P3F B;  4Z66 C;  1U35 D;  4YS3 A;  3REH C;  5B2I B;  5B0Y B;  1B67 A;  3A6N B;  5E5A C;  1P3M C;  3KXB D;  1P3L C;  1KX5 A;  1EQZ C;  1P3K B;  3AV1 A;  4Z66 D;  2NQB D;  5B2J B;  4J8X C;  3AZF B;  3WA9 B;  4ZBJ C;  5GT0 A;  5AV6 C;  1P3M D;  5CHL B;  1EQZ D;  3NQU B;  1P3G A;  3AZG C;  4NFT A;  4WU8 A;  3KUY A;  4J8X D;  2ZM5 A;  4HGA B;  5CPK C;  3MGP A;  5B40 B;  2IO5 B;  4AWL B;  3AZJ A;  3AFA D;  5B31 C;  3LJA C;  3AZG D;  3VH5 T;  4CAY B;  3WTP D;  1JFI B;  2W8S A;  4JJN D;  1P3B B;  5CPK D;  3B6F D;  4J8V A;  4WZS B;  5AVC B;  5B31 D;  3AZH B;  3AZI C;  3LZ1 B;  3MGQ A;  3AZL A;  4WU9 A;  2ZY5 A;  3REJ A;  4CSR B;  4X23 B;  1AOI C;  3W99 D;  1H3O B;  2BG1 A;  3WKJ C;  3EPH A;  2HIO B;  1S32 C;  1HQ3 A;  4G91 B;  4XZQ C;  4KHA A;  5B31 G;  5CP6 A;  3W97 B;  2DF4 C;  5AV5 A;  1KX5 D;  1KX4 C;  5AV9 A;  3AV2 C;  1M1A C;  5GT0 D;  2NQB B;  1Z2C B;  3A1I A;  3REI A;  4H9O B;  1PZR A;  1KX4 D;  2CV5 C;  4H9N B;  1TAF A;  5BNV A;  1EQZ B;  1M1A D;  3AZJ D;  1P3P A;  2NZD C;  3MGQ C;  5FUG A;  4Z5T C;  3WAA A;  3AFA B;  2HUE B;  4M6B A;  5DNN A;  3O62 C;  3WTP B;  4J8W C;  4JJN B;  3W96 A;  3MGQ D;  4WU9 D;  3REJ D;  5B24 A;  5F99 C;  3B6F B;  4Z5T D;  4YM6 C;  5DNM C;  4QLC C;  5F99 D;  3W99 B;  1M19 C;  4KGC C;  1ID3 C;  1F66 A;  5BT1 C;  5B33 C;  5CP6 D;  4YM6 D;  4YS3 B;  2YFW A;  5AV5 D;  3UTB A;  3TU4 A;  3IP4 C;  4QLC D;  3F6T A;  4G92 B;  1M19 D;  4LD9 A;  1ID3 D;  1KX5 B;  5AV9 D;  5B1L A;  5BT1 D;  3AV1 B;  2HIO A;  2UWX A;  3REI D;  3LZ0 C;  3EPK A;  5GT0 B;  1U35 A;  1P3G B;  1KX4 B;  5GXQ C;  3MGR A;  3KUY B;  3KXB A;  4H9S A;  3LZ0 D;  3AZN A;  4E44 A;  3AZJ B;  4Z66 A;  4H9Q B;  3REH A;  5DNN D;  4R8P A;  5E5A A;  1P3M A;  4J8V B;  3MNN C;  1EQZ A;  3AZL B;  1TZY C;  3MGQ B;  4WU9 B;  3REJ B;  4J8X A;  1P34 C;  1M18 C;  4Z5T B;  2ARO C;  5AV6 A;  3H0M C;  3MNN D;  1F1E A;  3AZG A;  1TZY D;  3VH6 A;  1M18 D;  5CPK A;  3UTB D;  3EPL A;  2ARO D;  5B31 A;  1HQ3 B;  5CP6 B;  4KHA B;  4LD9 D;  3LJA A;  5AV5 B;  3X1U C;  5AV9 B;  3AYW C;  3AZN C;  3AZI A;  3KSY A;  1AOI A;  3P5J B;  3B0C W;  3REI B;  2G5I C;  2JE5 A;  4R8P C;  3UT9 C;  3X1U D;  3MGR D;  1ZLA C;  1TAF B;  5BNV B;  3AZN D;  3AYW D;  1P3P B;  3WKJ A;  3REH D;  5FUG B;  1S32 A;  4WNN B;  3LZ0 B;  1P3I C;  2FJ7 C;  4R8P D;  4XZQ A;  3WAA B;  5E5A D;  1ZLA D;  4H9R A;  1N1J A;  5DNN B;  2PYO C;  1KX4 A;  3W96 B;  1ID3 A;  5B24 B;  3AV2 A;  2FJ7 D;  1M1A A;  3B6G C;  5AV6 D;  4H9Q A;  2PYO D;  2CV5 A;  2Y2P A;  4WV4 B;  3C1C C;  4EO5 C;  4XUJ C;  3B6G D;  1R4V A;  1F66 B;  5AV8 C;  2NZD A;  3LJA D;  5BS7 C;  2YFW B;  3UTB B;  5B1M C;  3TU4 B;  4Z5T A;  5GSU C;  5B32 C;  4LD9 B;  3B0C T;  3O62 A;  2CWE A;  5BNX A;  5B1L B;  4J8W A;  3AZI D;  3REK C;  1AOI D;  5F99 A;  5B1M D;  3W98 C;  5GSU D;  5B32 D;  5CPJ C;  5AY8 C;  4YM6 A;  3X1T A;  1U35 B;  5DNM A;  4QLC A;  5GT3 C;  3REK D;  3WKJ D;  4H9P A;  3X1U B;  3MGR B;  1S32 D;  3KXB B;  1BH8 A;  5KDM B;  1M19 A;  3AZN B;  3W98 D;  2VQR A;  5B33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...