3C1BB

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1bB00
5B40A 2AROD 3REHA 5DNMB 4KGCC 3AZMB 3MVDA 1P3AA 4DRAA 5DNMD 3AZMD 5GT3B 3MNNB 5AVCC 1A7WA 5B2IC 1AOIA 5JRGA 5GT3D 3MNND 3AZIA 5F99B 3KXBC 4Z5TC 3AV2A 3W96A 3REKB 5F99D 3W97C 2PYOC 3WA9A 3REKD 4CSRA 5B31C 5E5AB 5DNNC 2LY8A 4ZBJB 5CPJA 1ZLAA 1R4VA 3WTPB 1M19A 5E5AD 4HGAC 4E45A 4KHAA 3AZNC 4KGCA 5GXQC 3LZ0B 1H3OA 3WTPD 4H9OB 1WWIA 3LZ0D 5GT0B 2CWEA 5JA4B 5AVCA 5B2IA 2NQBC 5GT0D 1P3MB 1KX4C 4EO5B 1N1JA 1BH9B 4J8WB 5AV6C 1P3MD 3NQUB 5KDMA 3LELB 1P3KB 3KXBA 4Z5TA 4J8WD 3W97A 3LELD 3KUYB 1P3KD 2PYOA 4QLCC 2NZDB 3X1TC 5B31A 5B0YB 3KUYD 5DNNA 5FUGA 2NZDD 2IO5C 5CPKB 5B0YD 5CPIC 1WWSA 3REIB 3AZNA 1BFMA 5CPKD 5GXQA 1P3BC 1F66B 4JJNB 1HQ3C 3MGQC 4J8UB 3REID 3AZGB 1F66D 4JJND 5BT1C 4J8UD 3AZGD 5AV8C 3AZEB 5C3IB 4YM6B 2NQBA 1KX4A 3MGPC 5CP6C 4XUJC 5B1MB 4WZSB 3LZ1C 3LJAC 1KX3B 3AZED 1P3PB 4YM6D 5AV6A 3REJC 3WKJB 5B1MD 5G49A 1KX3D 1P3PD 2FJ7C 4H9NB 3UTBA 3WKJD 4QLCA 3X1TA 3VH5T 3C1CB 4YS3C 2YFVA 5CPIA 5B40B 3REHB 3C1CD 3MVDB 2HUEC 3C1BB 1P3BA 4X23C 1P3AB 1HQ3A 5B40D 3MGQA 3REHD 5B2JC 3MVDD 3C1BD 3WAAC 1P3AD 3AYWC 1AOIB 5JRGB 5AV8A 4ZUXC 3C1BC 3MGPA 4XUJA 5CP6A 1AOID 5JRGD 3LZ1A 3LJAA 3AZIB 3REJA 1P3IC 4J8VC 3B6FC 4UUZA 3AV2B 3W96B 1P34C 3AZID 2FJ7A 4NE3A 3WA9B 3VH5W 3AV2D 3W96D 1TZYC 4CSRB 4G91B 4G92B 3WA9D 5CPJB 5BS7C 4YS3A 1ZLAB 3VH5A 3AZJC 1M19B 5BO0A 4KHAB 5CPJD 4KGCB 3AZHC 1ZLAD 1M18C 1H3OB 4X23A 1M19D 5B2JA 4KGCD 5AV5C 3WAAA 4Z2MH 4H9PA 5AVCB 5B2IB 3AYWA 4ZUXA 2F8NH 3C1BA 5AVCD 1N1JB 5B2ID 5KDMB 1P3IA 4J8VA 3B6FA 3KXBB 4Z5TB 4WU8D 1P34A 1P3LC 3W97B 3KXBD 2PYOB 4Z5TD 4WU8C 1TZYA 3W97D 5B31B 2PYOD 3UTAC 5DNNB 5FUGB 1M1AC 5BS7A 5B31D 3AZJA 4HGAB 5DNND 3AZNB 2HIOC 3AZHA 5GXQB 1M18A 4Z66C 3AZND 1P3OC 1EQZC 5GXQD 5AV5A 3KWQC 3RELC 2NQBB 1KX4B 5B32C 1B67A 2NQBD 1KX4D 5AV6B 1S32C 3A6NC 5G49B 3UTBB 5AV6D 1P3LA 3AV1C 3AFAC 4QLCB 4WU8A 3UTBD 3X1TB 2YFWA 4CAYA 3X1UC 3UTAA 1BH8A 4QLCD 3AN2A 1M1AA 3X1TD 2IO5B 3UTBC 2YFVB 5BNVA 5CPIB 2F8NA 2HIOA 1P3BB 5CPID 1HQ3B 4H9QA 4Z66A 3MGQB 1P3OA 1EQZA 1P3BD 3KWQA 1HQ3D 3MGQD 5AV8B 3RELA 3O62C 3MGPB 4XUJB 5B32A 5CP6B 3MGRC 5BT1D 4AWLC 3X1SC 3LZ1B 5AV8D 3LJAB 3MGSC 3MGPD 3REJB 4XUJD 5CP6D 3A6NA 1S32A 4KUDC 4UUZB 3LZ1D 3LJAD 2FJ7B 1JFIA 3REJD 2CV5C 3AV1A 1Q9CA 5AY8C 3AFAA 3B6GC 2FJ7D 3X1UA 3AZLC 4YS3B 2F8NK 5BO0B 3B0DC 4YS3D 2HUEB 4X23B 3NQJA 5B2JB 3WAAB 4H9PB 4X23D 5B2JD 3AYWB 4ZUXB 2BYMA 3WAAD 3V9RA 3O62A 3MGRA 3X1SA 3AYWD 4ZUXD 3MGSA 1P3IB 4J8VB 3B6FB 4KUDA 5AV9C 1P3GC 1P34B 4Z2MG 2CV5A 1P3ID 5AY8A 4J8VD 3B6FD 4LD9C 1P34D 3B6GA 4WNNA 1TZYB 5B33C 4WU9C 1TZYD 5B31G 3AZLA 5B24C 3AZJB 5BNXA 3W98C 3AZHB 1M18B 3AZJD 3AZHD 5AV5B 1M18D 2L5AA 5GSUC 5AV5D 3X1VC 3VH6T 1KX5C 4DRBA 5B0ZC 5AV9A 1P3GA 4NE6A 1P3LB 1U35C 3UT9C 4LD9A 4NE5A 4WU8B 1P3LD 3W99C 2YFWB 4CAYB 5B33A 4WU9A 3UTAB 2RVQC 1BH8B 5AVBC 3AN2B 1P3FC 1M1AB 4H9RA 5B24A 2F8NB 5BNVB 3UTAD 3AN2D 1M1AD 3W98A 2HIOB 4J8XC 2F8ND 3TU4C 4R8PC 4H9QB 4Z66B 3AN2C 2HIOD 1P3OB 1EQZB 3KWQB 4Z66D 3VH6W 3AZKC 1P3OD 1EQZD 5GSUA 3RELB 3KWQD 4H9SC 4XZQC 5B32B 3X1VA 3R45A 1KX5A 3RELD 2AROC 1S32B 3VH6A 2BYKA 5B32D 5B0ZA 3A6NB 4E44A 1JFIB 5DNMC 1S32D 3AZMC 3AV1B 3A6ND 3UT9A 1TAFA 1U35A 3AFAB 3W99A 3AV1D 4NFTA 3X1UB 3AFAD 5GT3C 3AZFA 1P3FA 5AVBA 3MNNC 3X1UD 2JSSA 1ID3A 4J8XA 5F99C 5B1LA 3TU4A 3NQJB 4R8PA 3REKC 3AZKA 2BYMB 3V9RB 3O62B 3MGRB 4H9SA 4XZQA 3X1SB 4AWLB 5E5AC 3MGSB 2AROA 3O62D 4ZBJC 3MGRD 3X1SD 4KUDB 3WTPC 3MGSD 1B6WA 5DNMA 3AZMA 2CV5B 5AY8B 4KUDD 3LZ0C 3B6GB 4WNNB 2CV5D 5AY8D 5GT3A 5GT0C 3MNNA 3B6GD 3AZLB 1P3MC 5BNXB 4EO5C 3B0DB 3AZLD 5F99A 4J8WC 3LELC 3C1CA 1P3KC 3REKA 3KUYC 2NZDC 5CHLB 5B0YC 5E5AA 5CPKC 5AV9B 3WTPA 1P3GB 3REIC 1F66C 3LZ0A 4LD9B 5AV9D 1P3GD 4H9OA 4JJNC 4J8UC 1KU5A 3AZGC 5B33B 4WU9B 4LD9D 4WV4B 5JA4A 5GT0A 3B0CT 5B33D 4H9RB 5B24B 4WU9D 5C3IC 4YM6C 3AZEC 1P3MA 1ULYA 3W98B 5B1MC 1KX3C 5B24D 2F8NG 1BH9A 1P3PC 4J8WA 3NQUA 4M6BA 3W98D 3WKJC 3LELA 1P3KA 3KUYA 3WTPE 5GSUB 2NZDA 3X1VB 5B0YA 3R45B 5GSUD 1KX5B 5B32G 3C1CC 2BYKB 5B0ZB 3X1VD 5CPKA 1KX5D 5B40C 3REHC 3REIA 1U35B 5B0ZD 3MVDC 1TAFB 3UT9B 1F66A 1P3AC 3B0CW 4JJNA 4J8UA 3W99B 1U35D 3AZGA 3UT9D 3AZFB 1P3FB 5AVBB 3W99D 1AOIC 5JRGC 3AZFD 3AZEA 4YM6A 2RVQD 5AVBD 1P3FD 1ID3B 5B1MA 4J8XB 1KX3A 3AZIC 1P3PA 5B1LB 3TU4B 4R8PB 3AZFC 1HTAA 1ID3D 3WKJA 4J8XD 3AV2C 3W96C 3B0BA 4H9NA 5B1LD 4R8PD 3TU4D 3AZKB 1ID3C 3WA9C 1F1EA 4G91C 4XZQB 5B1LC 4G92C 3AZKD 3KSYA 2AROB 5CPJC 4XZQD 1ZLAC 1M19C
chains in the Genus database with same CATH superfamily
5B40A 2AROD 2G5IC 5DNMB 3REHA 3AZMB 4KGCC 3MVDA 1P3AA 4DRAA 5DNMD 3AZMD 5GT3B 3MNNB 5AVCC 1A7WA 5B2IC 1AOIA 5JRGA 5GT3D 3MNND 3AZIA 5F99B 3KXBC 4Z5TC 3AV2A 3W96A 2W8SA 3REKB 5F99D 3W97C 2RIQA 2PYOC 3WA9A 3REKD 4CSRA 5B31C 5E5AB 5DNNC 2LY8A 4ZBJB 5CPJA 1ZLAA 1R4VA 3WTPB 3H0MC 5E5AD 4HGAC 4E45A 1M19A 4KHAA 3AZNC 4KGCA 5GXQC 3LZ0B 1H3OA 3WTPD 4H9OB 1WWIA 3LZ0D 5GT0B 2CWEA 5JA4B 5AVCA 5B2IA 2NQBC 5GT0D 1P3MB 1KX4C 4EO5B 1N1JA 1BH9B 3P5JB 4J8WB 5AV6C 1P3MD 3NQUB 5KDMA 3LELB 1P3KB 3KXBA 4Z5TA 4J8WD 3W97A 3LELD 3KUYB 1P3KD 2PYOA 4QLCC 2NZDB 3X1TC 5B31A 2Y2GA 5B0YB 3KUYD 5DNNA 5FUGA 2XD5A 2NZDD 2IO5C 5CPKB 5B0YD 5CPIC 2DF4C 1WWSA 3REIB 3AZNA 1BFMA 5CPKD 5GXQA 1P3BC 1F66B 4JJNB 1HQ3C 3MGQC 4J8UB 3REID 3AZGB 1F66D 4JJND 5BT1C 4J8UD 3AZGD 5AV8C 3AZEB 5C3IB 4YM6B 2NQBA 1KX4A 3MGPC 5CP6C 4XUJC 5B1MB 4WZSB 3LZ1C 3LJAC 1KX3B 3AZED 1P3PB 4YM6D 5AV6A 3REJC 3WKJB 5B1MD 5G49A 1KX3D 1P3PD 2FJ7C 4H9NB 3UTBA 3WKJD 2G5HC 4QLCA 3X1TA 3VH5T 3EPKA 3C1CB 4YS3C 3EPHA 2YFVA 5CPIA 2Y2QA 5B40B 3REHB 3C1CD 2ZY3A 3MVDB 2HUEC 3C1BB 1P3BA 4X23C 1P3AB 1HQ3A 5B40D 3MGQA 2Y2PA 5B2JC 3REHD 3MVDD 3C1BD 3WAAC 1P3AD 3AYWC 1AOIB 5JRGB 5AV8A 4ZUXC 3C1BC 3MGPA 4XUJA 5CP6A 1AOID 5JRGD 3LZ1A 3LJAA 3AZIB 2UWXA 3REJA 1P3IC 4J8VC 3B6FC 4UUZA 3AV2B 3W96B 1P34C 3AZID 1Z2CB 4NE3A 2FJ7A 2F2AC 3WA9B 3VH5W 3AV2D 3W96D 1TZYC 4CSRB 4G91B 4G92B 3WA9D 5CPJB 5BS7C 4YS3A 1ZLAB 3VH5A 3AZJC 1M19B 5BO0A 4KHAB 5CPJD 4KGCB 3AZHC 1ZLAD 1M18C 1H3OB 4X23A 1M19D 4UPKA 2DQNC 5B2JA 4KGCD 5AV5C 3WAAA 4Z2MH 4H9PA 5AVCB 5B2IB 3AYWA 4ZUXA 2F8NH 3AL0C 3C1BA 5AVCD 1N1JB 5B2ID 3KFUG 5KDMB 1P3IA 4J8VA 3B6FA 3KXBB 4Z5TB 4WU8D 1P34A 1P3LC 3W97B 3KXBD 2PYOB 4Z5TD 4WU8C 1TZYA 3W97D 5B31B 2Y2MA 3EPLA 3UTAC 2PYOD 5DNNB 5FUGB 1M1AC 5BS7A 5B31D 3AZJA 4HGAB 5DNND 3AZNB 2HIOC 3AZHA 5GXQB 1M18A 4Z66C 3AZND 1P3OC 1EQZC 3A1KA 5GXQD 5AV5A 3KWQC 3RELC 2NQBB 1KX4B 5B32C 1B67A 2NQBD 1KX4D 2JE5A 5AV6B 1S32C 3A6NC 5G49B 3UTBB 5AV6D 1P3LA 3AV1C 3FDDA 3AFAC 4QLCB 4WU8A 3UTBD 3X1TB 2YFWA 2Y2HA 4CAYA 3X1UC 3UTAA 1BH8A 4QLCD 3AN2A 1M1AA 3X1TD 3F6TA 2IO5B 3UTBC 2YFVB 5BNVA 5CPIB 2F8NA 2HIOA 1P3BB 5CPID 1HQ3B 4H9QA 4Z66A 3MGQB 1P3OA 1EQZA 1P3BD 3KWQA 1HQ3D 3MGQD 1PZRA 5AV8B 3RELA 3O62C 3MGPB 4XUJB 5B32A 5CP6B 3MGRC 5BT1D 4AWLC 3X1SC 3LZ1B 5AV8D 3LJAB 3MGSC 3MGPD 3REJB 4XUJD 5CP6D 3A6NA 1S32A 4KUDC 4UUZB 3LZ1D 3LJAD 2FJ7B 1JFIA 3REJD 2CV5C 3AV1A 1Q9CA 5AY8C 3AFAA 3B6GC 2ZM5A 2FJ7D 3X1UA 4WJ3C 3AZLC 4YS3B 2F8NK 5BO0B 3B0DC 4YS3D 2HUEB 4X23B 3NQJA 5B2JB 3WAAB 4H9PB 4X23D 2Y2NA 5B2JD 3AYWB 4ZUXB 2BYMA 3WAAD 3V9RA 3O62A 3MGRA 3X1SA 3AYWD 4ZUXD 3MGSA 1P3IB 4J8VB 3B6FB 4KUDA 5AV9C 1P3GC 1P34B 4Z2MG 2CV5A 1P3ID 5AY8A 4J8VD 3B6FD 4LD9C 1P34D 3B6GA 4WNNA 1TZYB 2Y2JA 5B33C 4WU9C 1TZYD 5B31G 3AZLA 5B24C 3AZJB 2VQRA 2Y2IA 5BNXA 3W98C 3AZHB 1M18B 3AZJD 1W2EA 3EPJA 2ZY4A 3AZHD 5AV5B 1M18D 2L5AA 3A1IA 5GSUC 5AV5D 3X1VC 3VH6T 1KX5C 4DRBA 5B0ZC 5AV9A 1P3GA 4NE6A 1P3LB 1U35C 3UT9C 4LD9A 4NE5A 4WU8B 1P3LD 3W99C 2YFWB 4CAYB 5B33A 4WU9A 2JCHA 3UTAB 2RVQC 1BH8B 5AVBC 3AN2B 1P3FC 1M1AB 4H9RA 5B24A 2F8NB 5BNVB 3UTAD 3AN2D 1M1AD 3W98A 2HIOB 4J8XC 2F8ND 3TU4C 4R8PC 4H9QB 4Z66B 3AN2C 2HIOD 1P3OB 1EQZB 4DQYB 3KWQB 4Z66D 3VH6W 3AZKC 1P3OD 1EQZD 5GSUA 3RELB 2FFFB 3KWQD 4H9SC 4XZQC 5B32B 3X1VA 3R45A 1KX5A 3RELD 2AROC 1S32B 3VH6A 2BYKA 5B32D 5B0ZA 3A6NB 2BG1A 3H0LC 4E44A 1JFIB 5DNMC 1S32D 3AZMC 3AV1B 3A6ND 3UT9A 1TAFA 1U35A 3AFAB 2ZY5A 3W99A 3AV1D 4NFTA 3X1UB 3AFAD 5GT3C 3AZFA 1P3FA 5AVBA 3MNNC 3X1UD 2JSSA 1ID3A 4J8XA 5F99C 5B1LA 3TU4A 3NQJB 4R8PA 3REKC 3AZKA 2BYMB 3V9RB 3O62B 3MGRB 4H9SA 4XZQA 3X1SB 4AWLB 5E5AC 3MGSB 2AROA 3O62D 4ZBJC 3MGRD 3X1SD 4KUDB 3WTPC 3MGSD 1B6WA 5DNMA 3AZMA 2CV5B 5AY8B 4KUDD 3LZ0C 3B6GB 4WNNB 2CV5D 5AY8D 5GT3A 5GT0C 3MNNA 3B6GD 3AZLB 1P3MC 5BNXB 4EO5C 3B0DB 3AZLD 3EG5B 5F99A 4J8WC 3LELC 3C1CA 1P3KC 3REKA 3KUYC 2NZDC 5CHLB 5B0YC 5E5AA 5CPKC 5AV9B 3WTPA 1P3GB 3REIC 1F66C 3LZ0A 4LD9B 5AV9D 1P3GD 4H9OA 4JJNC 4J8UC 1KU5A 3AZGC 5B33B 4WU9B 4LD9D 4WV4B 5JA4A 5GT0A 3B0CT 5B33D 4H9RB 5B24B 4WU9D 5C3IC 4YM6C 3AZEC 1P3MA 1ULYA 3W98B 5B1MC 2XD1A 1KX3C 5B24D 2F8NG 1BH9A 1P3PC 4J8WA 3NQUA 4M6BA 3W98D 3WKJC 3LELA 1P3KA 3KUYA 3WTPE 5GSUB 3IP4C 2NZDA 3X1VB 5B0YA 3R45B 5GSUD 1KX5B 5B32G 3C1CC 2BYKB 5B0ZB 3X1VD 5CPKA 1KX5D 5B40C 3REHC 3REIA 1U35B 5B0ZD 3MVDC 1TAFB 3UT9B 1F66A 1P3AC 3B0CW 4JJNA 4J8UA 3W99B 1U35D 3AZGA 3UT9D 3AZFB 1P3FB 5AVBB 3W99D 2Y2KA 1AOIC 5JRGC 3AZFD 3AZEA 4YM6A 2RVQD 5AVBD 1P3FD 1ID3B 5B1MA 4J8XB 1KX3A 3AZIC 1P3PA 2ZY2A 5B1LB 3TU4B 4R8PB 3AZFC 1HTAA 1ID3D 3WKJA 4J8XD 3AV2C 3W96C 3B0BA 4H9NA 5B1LD 4R8PD 3TU4D 2J8PA 3AZKB 1T3UA 1ID3C 3WA9C 3H0RC 1F1EA 4G91C 4XZQB 5B1LC 2Y2OA 4G92C 3AZKD 3KSYA 2AROB 5CPJC 4XZQD 1ZLAC 2Y2LA 1M19C
chains in the Genus database with same CATH topology
5B40A 2AROD 2G5IC 5DNMB 3REHA 3AZMB 4KGCC 3MVDA 1P3AA 4DRAA 5DNMD 3AZMD 5GT3B 3MNNB 5AVCC 1A7WA 5B2IC 1AOIA 5JRGA 5GT3D 3MNND 3AZIA 5F99B 3KXBC 4Z5TC 3AV2A 3W96A 2W8SA 3REKB 5F99D 3W97C 2RIQA 2PYOC 3WA9A 3REKD 4CSRA 5B31C 5E5AB 5DNNC 2LY8A 4ZBJB 5CPJA 1ZLAA 1R4VA 3WTPB 3H0MC 5E5AD 4HGAC 4E45A 1M19A 4KHAA 3AZNC 4KGCA 5GXQC 3LZ0B 1H3OA 3WTPD 4H9OB 1WWIA 3LZ0D 5GT0B 2CWEA 5JA4B 5AVCA 5B2IA 2NQBC 5GT0D 1P3MB 1KX4C 4EO5B 1N1JA 1BH9B 3P5JB 4J8WB 5AV6C 1P3MD 3NQUB 5KDMA 3LELB 1P3KB 3KXBA 4Z5TA 4J8WD 3W97A 3LELD 3KUYB 1P3KD 2PYOA 4QLCC 2NZDB 3X1TC 5B31A 2Y2GA 5B0YB 3KUYD 5DNNA 5FUGA 2XD5A 2NZDD 2IO5C 5CPKB 5B0YD 5CPIC 2DF4C 1WWSA 3REIB 3AZNA 1BFMA 5CPKD 5GXQA 1P3BC 1F66B 4JJNB 1HQ3C 3MGQC 4J8UB 3REID 3AZGB 1F66D 4JJND 5BT1C 4J8UD 3AZGD 5AV8C 3AZEB 5C3IB 4YM6B 2NQBA 1KX4A 3MGPC 5CP6C 4XUJC 5B1MB 4WZSB 3LZ1C 3LJAC 1KX3B 3AZED 1P3PB 4YM6D 5AV6A 3REJC 3WKJB 5B1MD 5G49A 1KX3D 1P3PD 2FJ7C 4H9NB 3UTBA 3WKJD 2G5HC 4QLCA 3X1TA 3VH5T 3EPKA 3C1CB 4YS3C 3EPHA 2YFVA 5CPIA 2Y2QA 5B40B 3REHB 3C1CD 2ZY3A 3MVDB 2HUEC 3C1BB 1P3BA 4X23C 1P3AB 1HQ3A 5B40D 3MGQA 2Y2PA 5B2JC 3REHD 3MVDD 3C1BD 3WAAC 1P3AD 3AYWC 1AOIB 5JRGB 5AV8A 4ZUXC 3C1BC 3MGPA 4XUJA 5CP6A 1AOID 5JRGD 3LZ1A 3LJAA 3AZIB 2UWXA 3REJA 1P3IC 4J8VC 3B6FC 4UUZA 3AV2B 3W96B 1P34C 3AZID 1Z2CB 4NE3A 2FJ7A 2F2AC 3WA9B 3VH5W 3AV2D 3W96D 1TZYC 4CSRB 4G91B 4G92B 3WA9D 5CPJB 5BS7C 4YS3A 1ZLAB 3VH5A 3AZJC 1M19B 5BO0A 4KHAB 5CPJD 4KGCB 3AZHC 1ZLAD 1M18C 1H3OB 4X23A 1M19D 4UPKA 2DQNC 5B2JA 4KGCD 5AV5C 3WAAA 4Z2MH 4H9PA 5AVCB 5B2IB 3AYWA 4ZUXA 2F8NH 3AL0C 3C1BA 5AVCD 1N1JB 5B2ID 3KFUG 5KDMB 1P3IA 4J8VA 3B6FA 3KXBB 4Z5TB 4WU8D 1P34A 1P3LC 3W97B 3KXBD 2PYOB 4Z5TD 4WU8C 1TZYA 3W97D 5B31B 2Y2MA 3EPLA 3UTAC 2PYOD 5DNNB 5FUGB 1M1AC 5BS7A 5B31D 3AZJA 4HGAB 5DNND 3AZNB 2HIOC 3AZHA 5GXQB 1M18A 4Z66C 3AZND 1P3OC 1EQZC 3A1KA 5GXQD 5AV5A 3KWQC 3RELC 2NQBB 1KX4B 5B32C 1B67A 2NQBD 1KX4D 2JE5A 5AV6B 1S32C 3A6NC 5G49B 3UTBB 5AV6D 1P3LA 3AV1C 3FDDA 3AFAC 4QLCB 4WU8A 3UTBD 3X1TB 2YFWA 2Y2HA 4CAYA 3X1UC 3UTAA 1BH8A 4QLCD 3AN2A 1M1AA 3X1TD 3F6TA 2IO5B 3UTBC 2YFVB 5BNVA 5CPIB 2F8NA 2HIOA 1P3BB 5CPID 1HQ3B 4H9QA 4Z66A 3MGQB 1P3OA 1EQZA 1P3BD 3KWQA 1HQ3D 3MGQD 1PZRA 5AV8B 3RELA 3O62C 3MGPB 4XUJB 5B32A 5CP6B 3MGRC 5BT1D 4AWLC 3X1SC 3LZ1B 5AV8D 3LJAB 3MGSC 3MGPD 3REJB 4XUJD 5CP6D 3A6NA 1S32A 4KUDC 4UUZB 3LZ1D 3LJAD 2FJ7B 1JFIA 3REJD 2CV5C 3AV1A 1Q9CA 5AY8C 3AFAA 3B6GC 2ZM5A 2FJ7D 3X1UA 4WJ3C 3AZLC 4YS3B 2F8NK 5BO0B 3B0DC 4YS3D 2HUEB 4X23B 3NQJA 5B2JB 3WAAB 4H9PB 4X23D 2Y2NA 5B2JD 3AYWB 4ZUXB 2BYMA 3WAAD 3V9RA 3O62A 3MGRA 3X1SA 3AYWD 4ZUXD 3MGSA 1P3IB 4J8VB 3B6FB 4KUDA 5AV9C 1P3GC 1P34B 4Z2MG 2CV5A 1P3ID 5AY8A 4J8VD 3B6FD 4LD9C 1P34D 3B6GA 4WNNA 1TZYB 2Y2JA 5B33C 4WU9C 1TZYD 5B31G 3AZLA 5B24C 3AZJB 2VQRA 2Y2IA 5BNXA 3W98C 3AZHB 1M18B 3AZJD 1W2EA 3EPJA 2ZY4A 3AZHD 5AV5B 1M18D 2L5AA 3A1IA 5GSUC 5AV5D 3X1VC 3VH6T 1KX5C 4DRBA 5B0ZC 5AV9A 1P3GA 4NE6A 1P3LB 1U35C 3UT9C 4LD9A 4NE5A 4WU8B 1P3LD 3W99C 2YFWB 4CAYB 5B33A 4WU9A 2JCHA 3UTAB 2RVQC 1BH8B 5AVBC 3AN2B 1P3FC 1M1AB 4H9RA 5B24A 2F8NB 5BNVB 3UTAD 3AN2D 1M1AD 3W98A 2HIOB 4J8XC 2F8ND 3TU4C 4R8PC 4H9QB 4Z66B 3AN2C 2HIOD 1P3OB 1EQZB 4DQYB 3KWQB 4Z66D 3VH6W 3AZKC 1P3OD 1EQZD 5GSUA 3RELB 2FFFB 3KWQD 4H9SC 4XZQC 5B32B 3X1VA 3R45A 1KX5A 3RELD 2AROC 1S32B 3VH6A 2BYKA 5B32D 5B0ZA 3A6NB 2BG1A 3H0LC 4E44A 1JFIB 5DNMC 1S32D 3AZMC 3AV1B 3A6ND 3UT9A 1TAFA 1U35A 3AFAB 2ZY5A 3W99A 3AV1D 4NFTA 3X1UB 3AFAD 5GT3C 3AZFA 1P3FA 5AVBA 3MNNC 3X1UD 2JSSA 1ID3A 4J8XA 5F99C 5B1LA 3TU4A 3NQJB 4R8PA 3REKC 3AZKA 2BYMB 3V9RB 3O62B 3MGRB 4H9SA 4XZQA 3X1SB 4AWLB 5E5AC 3MGSB 2AROA 3O62D 4ZBJC 3MGRD 3X1SD 4KUDB 3WTPC 3MGSD 1B6WA 5DNMA 3AZMA 2CV5B 5AY8B 4KUDD 3LZ0C 3B6GB 4WNNB 2CV5D 5AY8D 5GT3A 5GT0C 3MNNA 3B6GD 3AZLB 1P3MC 5BNXB 4EO5C 3B0DB 3AZLD 3EG5B 5F99A 4J8WC 3LELC 3C1CA 1P3KC 3REKA 3KUYC 2NZDC 5CHLB 5B0YC 5E5AA 5CPKC 5AV9B 3WTPA 1P3GB 3REIC 1F66C 3LZ0A 4LD9B 5AV9D 1P3GD 4H9OA 4JJNC 4J8UC 1KU5A 3AZGC 5B33B 4WU9B 4LD9D 4WV4B 5JA4A 5GT0A 3B0CT 5B33D 4H9RB 5B24B 4WU9D 5C3IC 4YM6C 3AZEC 1P3MA 1ULYA 3W98B 5B1MC 2XD1A 1KX3C 5B24D 2F8NG 1BH9A 1P3PC 4J8WA 3NQUA 4M6BA 3W98D 3WKJC 3LELA 1P3KA 3KUYA 3WTPE 5GSUB 3IP4C 2NZDA 3X1VB 5B0YA 3R45B 5GSUD 1KX5B 5B32G 3C1CC 2BYKB 5B0ZB 3X1VD 5CPKA 1KX5D 5B40C 3REHC 3REIA 1U35B 5B0ZD 3MVDC 1TAFB 3UT9B 1F66A 1P3AC 3B0CW 4JJNA 4J8UA 3W99B 1U35D 3AZGA 3UT9D 3AZFB 1P3FB 5AVBB 3W99D 2Y2KA 1AOIC 5JRGC 3AZFD 3AZEA 4YM6A 2RVQD 5AVBD 1P3FD 1ID3B 5B1MA 4J8XB 1KX3A 3AZIC 1P3PA 2ZY2A 5B1LB 3TU4B 4R8PB 3AZFC 1HTAA 1ID3D 3WKJA 4J8XD 3AV2C 3W96C 3B0BA 4H9NA 5B1LD 4R8PD 3TU4D 2J8PA 3AZKB 1T3UA 1ID3C 3WA9C 3H0RC 1F1EA 4G91C 4XZQB 5B1LC 2Y2OA 4G92C 3AZKD 3KSYA 2AROB 5CPJC 4XZQD 1ZLAC 2Y2LA 1M19C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 A;  2ARO D;  3REH A;  5DNM B;  4KGC C;  3AZM B;  3MVD A;  1P3A A;  4DRA A;  5DNM D;  3AZM D;  5GT3 B;  3MNN B;  5AVC C;  1A7W A;  5B2I C;  1AOI A;  5JRG A;  5GT3 D;  3MNN D;  3AZI A;  5F99 B;  3KXB C;  4Z5T C;  3AV2 A;  3W96 A;  3REK B;  5F99 D;  3W97 C;  2PYO C;  3WA9 A;  3REK D;  4CSR A;  5B31 C;  5E5A B;  5DNN C;  2LY8 A;  4ZBJ B;  5CPJ A;  1ZLA A;  1R4V A;  3WTP B;  1M19 A;  5E5A D;  4HGA C;  4E45 A;  4KHA A;  3AZN C;  4KGC A;  5GXQ C;  3LZ0 B;  1H3O A;  3WTP D;  4H9O B;  1WWI A;  3LZ0 D;  5GT0 B;  2CWE A;  5JA4 B;  5AVC A;  5B2I A;  2NQB C;  5GT0 D;  1P3M B;  1KX4 C;  4EO5 B;  1N1J A;  1BH9 B;  4J8W B;  5AV6 C;  1P3M D;  3NQU B;  5KDM A;  3LEL B;  1P3K B;  3KXB A;  4Z5T A;  4J8W D;  3W97 A;  3LEL D;  3KUY B;  1P3K D;  2PYO A;  4QLC C;  2NZD B;  3X1T C;  5B31 A;  5B0Y B;  3KUY D;  5DNN A;  5FUG A;  2NZD D;  2IO5 C;  5CPK B;  5B0Y D;  5CPI C;  1WWS A;  3REI B;  3AZN A;  1BFM A;  5CPK D;  5GXQ A;  1P3B C;  1F66 B;  4JJN B;  1HQ3 C;  3MGQ C;  4J8U B;  3REI D;  3AZG B;  1F66 D;  4JJN D;  5BT1 C;  4J8U D;  3AZG D;  5AV8 C;  3AZE B;  5C3I B;  4YM6 B;  2NQB A;  1KX4 A;  3MGP C;  5CP6 C;  4XUJ C;  5B1M B;  4WZS B;  3LZ1 C;  3LJA C;  1KX3 B;  3AZE D;  1P3P B;  4YM6 D;  5AV6 A;  3REJ C;  3WKJ B;  5B1M D;  5G49 A;  1KX3 D;  1P3P D;  2FJ7 C;  4H9N B;  3UTB A;  3WKJ D;  4QLC A;  3X1T A;  3VH5 T;  3C1C B;  4YS3 C;  2YFV A;  5CPI A;  5B40 B;  3REH B;  3C1C D;  3MVD B;  2HUE C;  3C1B B;  1P3B A;  4X23 C;  1P3A B;  1HQ3 A;  5B40 D;  3MGQ A;  3REH D;  5B2J C;  3MVD D;  3C1B D;  3WAA C;  1P3A D;  3AYW C;  1AOI B;  5JRG B;  5AV8 A;  4ZUX C;  3C1B C;  3MGP A;  4XUJ A;  5CP6 A;  1AOI D;  5JRG D;  3LZ1 A;  3LJA A;  3AZI B;  3REJ A;  1P3I C;  4J8V C;  3B6F C;  4UUZ A;  3AV2 B;  3W96 B;  1P34 C;  3AZI D;  2FJ7 A;  4NE3 A;  3WA9 B;  3VH5 W;  3AV2 D;  3W96 D;  1TZY C;  4CSR B;  4G91 B;  4G92 B;  3WA9 D;  5CPJ B;  5BS7 C;  4YS3 A;  1ZLA B;  3VH5 A;  3AZJ C;  1M19 B;  5BO0 A;  4KHA B;  5CPJ D;  4KGC B;  3AZH C;  1ZLA D;  1M18 C;  1H3O B;  4X23 A;  1M19 D;  5B2J A;  4KGC D;  5AV5 C;  3WAA A;  4Z2M H;  4H9P A;  5AVC B;  5B2I B;  3AYW A;  4ZUX A;  2F8N H;  3C1B A;  5AVC D;  1N1J B;  5B2I D;  5KDM B;  1P3I A;  4J8V A;  3B6F A;  3KXB B;  4Z5T B;  4WU8 D;  1P34 A;  1P3L C;  3W97 B;  3KXB D;  2PYO B;  4Z5T D;  4WU8 C;  1TZY A;  3W97 D;  5B31 B;  2PYO D;  3UTA C;  5DNN B;  5FUG B;  1M1A C;  5BS7 A;  5B31 D;  3AZJ A;  4HGA B;  5DNN D;  3AZN B;  2HIO C;  3AZH A;  5GXQ B;  1M18 A;  4Z66 C;  3AZN D;  1P3O C;  1EQZ C;  5GXQ D;  5AV5 A;  3KWQ C;  3REL C;  2NQB B;  1KX4 B;  5B32 C;  1B67 A;  2NQB D;  1KX4 D;  5AV6 B;  1S32 C;  3A6N C;  5G49 B;  3UTB B;  5AV6 D;  1P3L A;  3AV1 C;  3AFA C;  4QLC B;  4WU8 A;  3UTB D;  3X1T B;  2YFW A;  4CAY A;  3X1U C;  3UTA A;  1BH8 A;  4QLC D;  3AN2 A;  1M1A A;  3X1T D;  2IO5 B;  3UTB C;  2YFV B;  5BNV A;  5CPI B;  2F8N A;  2HIO A;  1P3B B;  5CPI D;  1HQ3 B;  4H9Q A;  4Z66 A;  3MGQ B;  1P3O A;  1EQZ A;  1P3B D;  3KWQ A;  1HQ3 D;  3MGQ D;  5AV8 B;  3REL A;  3O62 C;  3MGP B;  4XUJ B;  5B32 A;  5CP6 B;  3MGR C;  5BT1 D;  4AWL C;  3X1S C;  3LZ1 B;  5AV8 D;  3LJA B;  3MGS C;  3MGP D;  3REJ B;  4XUJ D;  5CP6 D;  3A6N A;  1S32 A;  4KUD C;  4UUZ B;  3LZ1 D;  3LJA D;  2FJ7 B;  1JFI A;  3REJ D;  2CV5 C;  3AV1 A;  1Q9C A;  5AY8 C;  3AFA A;  3B6G C;  2FJ7 D;  3X1U A;  3AZL C;  4YS3 B;  2F8N K;  5BO0 B;  3B0D C;  4YS3 D;  2HUE B;  4X23 B;  3NQJ A;  5B2J B;  3WAA B;  4H9P B;  4X23 D;  5B2J D;  3AYW B;  4ZUX B;  2BYM A;  3WAA D;  3V9R A;  3O62 A;  3MGR A;  3X1S A;  3AYW D;  4ZUX D;  3MGS A;  1P3I B;  4J8V B;  3B6F B;  4KUD A;  5AV9 C;  1P3G C;  1P34 B;  4Z2M G;  2CV5 A;  1P3I D;  5AY8 A;  4J8V D;  3B6F D;  4LD9 C;  1P34 D;  3B6G A;  4WNN A;  1TZY B;  5B33 C;  4WU9 C;  1TZY D;  5B31 G;  3AZL A;  5B24 C;  3AZJ B;  5BNX A;  3W98 C;  3AZH B;  1M18 B;  3AZJ D;  3AZH D;  5AV5 B;  1M18 D;  2L5A A;  5GSU C;  5AV5 D;  3X1V C;  3VH6 T;  1KX5 C;  4DRB A;  5B0Z C;  5AV9 A;  1P3G A;  4NE6 A;  1P3L B;  1U35 C;  3UT9 C;  4LD9 A;  4NE5 A;  4WU8 B;  1P3L D;  3W99 C;  2YFW B;  4CAY B;  5B33 A;  4WU9 A;  3UTA B;  2RVQ C;  1BH8 B;  5AVB C;  3AN2 B;  1P3F C;  1M1A B;  4H9R A;  5B24 A;  2F8N B;  5BNV B;  3UTA D;  3AN2 D;  1M1A D;  3W98 A;  2HIO B;  4J8X C;  2F8N D;  3TU4 C;  4R8P C;  4H9Q B;  4Z66 B;  3AN2 C;  2HIO D;  1P3O B;  1EQZ B;  3KWQ B;  4Z66 D;  3VH6 W;  3AZK C;  1P3O D;  1EQZ D;  5GSU A;  3REL B;  3KWQ D;  4H9S C;  4XZQ C;  5B32 B;  3X1V A;  3R45 A;  1KX5 A;  3REL D;  2ARO C;  1S32 B;  3VH6 A;  2BYK A;  5B32 D;  5B0Z A;  3A6N B;  4E44 A;  1JFI B;  5DNM C;  1S32 D;  3AZM C;  3AV1 B;  3A6N D;  3UT9 A;  1TAF A;  1U35 A;  3AFA B;  3W99 A;  3AV1 D;  4NFT A;  3X1U B;  3AFA D;  5GT3 C;  3AZF A;  1P3F A;  5AVB A;  3MNN C;  3X1U D;  2JSS A;  1ID3 A;  4J8X A;  5F99 C;  5B1L A;  3TU4 A;  3NQJ B;  4R8P A;  3REK C;  3AZK A;  2BYM B;  3V9R B;  3O62 B;  3MGR B;  4H9S A;  4XZQ A;  3X1S B;  4AWL B;  5E5A C;  3MGS B;  2ARO A;  3O62 D;  4ZBJ C;  3MGR D;  3X1S D;  4KUD B;  3WTP C;  3MGS D;  1B6W A;  5DNM A;  3AZM A;  2CV5 B;  5AY8 B;  4KUD D;  3LZ0 C;  3B6G B;  4WNN B;  2CV5 D;  5AY8 D;  5GT3 A;  5GT0 C;  3MNN A;  3B6G D;  3AZL B;  1P3M C;  5BNX B;  4EO5 C;  3B0D B;  3AZL D;  5F99 A;  4J8W C;  3LEL C;  3C1C A;  1P3K C;  3REK A;  3KUY C;  2NZD C;  5CHL B;  5B0Y C;  5E5A A;  5CPK C;  5AV9 B;  3WTP A;  1P3G B;  3REI C;  1F66 C;  3LZ0 A;  4LD9 B;  5AV9 D;  1P3G D;  4H9O A;  4JJN C;  4J8U C;  1KU5 A;  3AZG C;  5B33 B;  4WU9 B;  4LD9 D;  4WV4 B;  5JA4 A;  5GT0 A;  3B0C T;  5B33 D;  4H9R B;  5B24 B;  4WU9 D;  5C3I C;  4YM6 C;  3AZE C;  1P3M A;  1ULY A;  3W98 B;  5B1M C;  1KX3 C;  5B24 D;  2F8N G;  1BH9 A;  1P3P C;  4J8W A;  3NQU A;  4M6B A;  3W98 D;  3WKJ C;  3LEL A;  1P3K A;  3KUY A;  3WTP E;  5GSU B;  2NZD A;  3X1V B;  5B0Y A;  3R45 B;  5GSU D;  1KX5 B;  5B32 G;  3C1C C;  2BYK B;  5B0Z B;  3X1V D;  5CPK A;  1KX5 D;  5B40 C;  3REH C;  3REI A;  1U35 B;  5B0Z D;  3MVD C;  1TAF B;  3UT9 B;  1F66 A;  1P3A C;  3B0C W;  4JJN A;  4J8U A;  3W99 B;  1U35 D;  3AZG A;  3UT9 D;  3AZF B;  1P3F B;  5AVB B;  3W99 D;  1AOI C;  5JRG C;  3AZF D;  3AZE A;  4YM6 A;  2RVQ D;  5AVB D;  1P3F D;  1ID3 B;  5B1M A;  4J8X B;  1KX3 A;  3AZI C;  1P3P A;  5B1L B;  3TU4 B;  4R8P B;  3AZF C;  1HTA A;  1ID3 D;  3WKJ A;  4J8X D;  3AV2 C;  3W96 C;  3B0B A;  4H9N A;  5B1L D;  4R8P D;  3TU4 D;  3AZK B;  1ID3 C;  3WA9 C;  1F1E A;  4G91 C;  4XZQ B;  5B1L C;  4G92 C;  3AZK D;  3KSY A;  2ARO B;  5CPJ C;  4XZQ D;  1ZLA C;  1M19 C; 
#chains in the Genus database with same CATH topology
 5B40 A;  2ARO D;  2G5I C;  5DNM B;  3REH A;  3AZM B;  4KGC C;  3MVD A;  1P3A A;  4DRA A;  5DNM D;  3AZM D;  5GT3 B;  3MNN B;  5AVC C;  1A7W A;  5B2I C;  1AOI A;  5JRG A;  5GT3 D;  3MNN D;  3AZI A;  5F99 B;  3KXB C;  4Z5T C;  3AV2 A;  3W96 A;  2W8S A;  3REK B;  5F99 D;  3W97 C;  2RIQ A;  2PYO C;  3WA9 A;  3REK D;  4CSR A;  5B31 C;  5E5A B;  5DNN C;  2LY8 A;  4ZBJ B;  5CPJ A;  1ZLA A;  1R4V A;  3WTP B;  3H0M C;  5E5A D;  4HGA C;  4E45 A;  1M19 A;  4KHA A;  3AZN C;  4KGC A;  5GXQ C;  3LZ0 B;  1H3O A;  3WTP D;  4H9O B;  1WWI A;  3LZ0 D;  5GT0 B;  2CWE A;  5JA4 B;  5AVC A;  5B2I A;  2NQB C;  5GT0 D;  1P3M B;  1KX4 C;  4EO5 B;  1N1J A;  1BH9 B;  3P5J B;  4J8W B;  5AV6 C;  1P3M D;  3NQU B;  5KDM A;  3LEL B;  1P3K B;  3KXB A;  4Z5T A;  4J8W D;  3W97 A;  3LEL D;  3KUY B;  1P3K D;  2PYO A;  4QLC C;  2NZD B;  3X1T C;  5B31 A;  2Y2G A;  5B0Y B;  3KUY D;  5DNN A;  5FUG A;  2XD5 A;  2NZD D;  2IO5 C;  5CPK B;  5B0Y D;  5CPI C;  2DF4 C;  1WWS A;  3REI B;  3AZN A;  1BFM A;  5CPK D;  5GXQ A;  1P3B C;  1F66 B;  4JJN B;  1HQ3 C;  3MGQ C;  4J8U B;  3REI D;  3AZG B;  1F66 D;  4JJN D;  5BT1 C;  4J8U D;  3AZG D;  5AV8 C;  3AZE B;  5C3I B;  4YM6 B;  2NQB A;  1KX4 A;  3MGP C;  5CP6 C;  4XUJ C;  5B1M B;  4WZS B;  3LZ1 C;  3LJA C;  1KX3 B;  3AZE D;  1P3P B;  4YM6 D;  5AV6 A;  3REJ C;  3WKJ B;  5B1M D;  5G49 A;  1KX3 D;  1P3P D;  2FJ7 C;  4H9N B;  3UTB A;  3WKJ D;  2G5H C;  4QLC A;  3X1T A;  3VH5 T;  3EPK A;  3C1C B;  4YS3 C;  3EPH A;  2YFV A;  5CPI A;  2Y2Q A;  5B40 B;  3REH B;  3C1C D;  2ZY3 A;  3MVD B;  2HUE C;  3C1B B;  1P3B A;  4X23 C;  1P3A B;  1HQ3 A;  5B40 D;  3MGQ A;  2Y2P A;  5B2J C;  3REH D;  3MVD D;  3C1B D;  3WAA C;  1P3A D;  3AYW C;  1AOI B;  5JRG B;  5AV8 A;  4ZUX C;  3C1B C;  3MGP A;  4XUJ A;  5CP6 A;  1AOI D;  5JRG D;  3LZ1 A;  3LJA A;  3AZI B;  2UWX A;  3REJ A;  1P3I C;  4J8V C;  3B6F C;  4UUZ A;  3AV2 B;  3W96 B;  1P34 C;  3AZI D;  1Z2C B;  4NE3 A;  2FJ7 A;  2F2A C;  3WA9 B;  3VH5 W;  3AV2 D;  3W96 D;  1TZY C;  4CSR B;  4G91 B;  4G92 B;  3WA9 D;  5CPJ B;  5BS7 C;  4YS3 A;  1ZLA B;  3VH5 A;  3AZJ C;  1M19 B;  5BO0 A;  4KHA B;  5CPJ D;  4KGC B;  3AZH C;  1ZLA D;  1M18 C;  1H3O B;  4X23 A;  1M19 D;  4UPK A;  2DQN C;  5B2J A;  4KGC D;  5AV5 C;  3WAA A;  4Z2M H;  4H9P A;  5AVC B;  5B2I B;  3AYW A;  4ZUX A;  2F8N H;  3AL0 C;  3C1B A;  5AVC D;  1N1J B;  5B2I D;  3KFU G;  5KDM B;  1P3I A;  4J8V A;  3B6F A;  3KXB B;  4Z5T B;  4WU8 D;  1P34 A;  1P3L C;  3W97 B;  3KXB D;  2PYO B;  4Z5T D;  4WU8 C;  1TZY A;  3W97 D;  5B31 B;  2Y2M A;  3EPL A;  3UTA C;  2PYO D;  5DNN B;  5FUG B;  1M1A C;  5BS7 A;  5B31 D;  3AZJ A;  4HGA B;  5DNN D;  3AZN B;  2HIO C;  3AZH A;  5GXQ B;  1M18 A;  4Z66 C;  3AZN D;  1P3O C;  1EQZ C;  3A1K A;  5GXQ D;  5AV5 A;  3KWQ C;  3REL C;  2NQB B;  1KX4 B;  5B32 C;  1B67 A;  2NQB D;  1KX4 D;  2JE5 A;  5AV6 B;  1S32 C;  3A6N C;  5G49 B;  3UTB B;  5AV6 D;  1P3L A;  3AV1 C;  3FDD A;  3AFA C;  4QLC B;  4WU8 A;  3UTB D;  3X1T B;  2YFW A;  2Y2H A;  4CAY A;  3X1U C;  3UTA A;  1BH8 A;  4QLC D;  3AN2 A;  1M1A A;  3X1T D;  3F6T A;  2IO5 B;  3UTB C;  2YFV B;  5BNV A;  5CPI B;  2F8N A;  2HIO A;  1P3B B;  5CPI D;  1HQ3 B;  4H9Q A;  4Z66 A;  3MGQ B;  1P3O A;  1EQZ A;  1P3B D;  3KWQ A;  1HQ3 D;  3MGQ D;  1PZR A;  5AV8 B;  3REL A;  3O62 C;  3MGP B;  4XUJ B;  5B32 A;  5CP6 B;  3MGR C;  5BT1 D;  4AWL C;  3X1S C;  3LZ1 B;  5AV8 D;  3LJA B;  3MGS C;  3MGP D;  3REJ B;  4XUJ D;  5CP6 D;  3A6N A;  1S32 A;  4KUD C;  4UUZ B;  3LZ1 D;  3LJA D;  2FJ7 B;  1JFI A;  3REJ D;  2CV5 C;  3AV1 A;  1Q9C A;  5AY8 C;  3AFA A;  3B6G C;  2ZM5 A;  2FJ7 D;  3X1U A;  4WJ3 C;  3AZL C;  4YS3 B;  2F8N K;  5BO0 B;  3B0D C;  4YS3 D;  2HUE B;  4X23 B;  3NQJ A;  5B2J B;  3WAA B;  4H9P B;  4X23 D;  2Y2N A;  5B2J D;  3AYW B;  4ZUX B;  2BYM A;  3WAA D;  3V9R A;  3O62 A;  3MGR A;  3X1S A;  3AYW D;  4ZUX D;  3MGS A;  1P3I B;  4J8V B;  3B6F B;  4KUD A;  5AV9 C;  1P3G C;  1P34 B;  4Z2M G;  2CV5 A;  1P3I D;  5AY8 A;  4J8V D;  3B6F D;  4LD9 C;  1P34 D;  3B6G A;  4WNN A;  1TZY B;  2Y2J A;  5B33 C;  4WU9 C;  1TZY D;  5B31 G;  3AZL A;  5B24 C;  3AZJ B;  2VQR A;  2Y2I A;  5BNX A;  3W98 C;  3AZH B;  1M18 B;  3AZJ D;  1W2E A;  3EPJ A;  2ZY4 A;  3AZH D;  5AV5 B;  1M18 D;  2L5A A;  3A1I A;  5GSU C;  5AV5 D;  3X1V C;  3VH6 T;  1KX5 C;  4DRB A;  5B0Z C;  5AV9 A;  1P3G A;  4NE6 A;  1P3L B;  1U35 C;  3UT9 C;  4LD9 A;  4NE5 A;  4WU8 B;  1P3L D;  3W99 C;  2YFW B;  4CAY B;  5B33 A;  4WU9 A;  2JCH A;  3UTA B;  2RVQ C;  1BH8 B;  5AVB C;  3AN2 B;  1P3F C;  1M1A B;  4H9R A;  5B24 A;  2F8N B;  5BNV B;  3UTA D;  3AN2 D;  1M1A D;  3W98 A;  2HIO B;  4J8X C;  2F8N D;  3TU4 C;  4R8P C;  4H9Q B;  4Z66 B;  3AN2 C;  2HIO D;  1P3O B;  1EQZ B;  4DQY B;  3KWQ B;  4Z66 D;  3VH6 W;  3AZK C;  1P3O D;  1EQZ D;  5GSU A;  3REL B;  2FFF B;  3KWQ D;  4H9S C;  4XZQ C;  5B32 B;  3X1V A;  3R45 A;  1KX5 A;  3REL D;  2ARO C;  1S32 B;  3VH6 A;  2BYK A;  5B32 D;  5B0Z A;  3A6N B;  2BG1 A;  3H0L C;  4E44 A;  1JFI B;  5DNM C;  1S32 D;  3AZM C;  3AV1 B;  3A6N D;  3UT9 A;  1TAF A;  1U35 A;  3AFA B;  2ZY5 A;  3W99 A;  3AV1 D;  4NFT A;  3X1U B;  3AFA D;  5GT3 C;  3AZF A;  1P3F A;  5AVB A;  3MNN C;  3X1U D;  2JSS A;  1ID3 A;  4J8X A;  5F99 C;  5B1L A;  3TU4 A;  3NQJ B;  4R8P A;  3REK C;  3AZK A;  2BYM B;  3V9R B;  3O62 B;  3MGR B;  4H9S A;  4XZQ A;  3X1S B;  4AWL B;  5E5A C;  3MGS B;  2ARO A;  3O62 D;  4ZBJ C;  3MGR D;  3X1S D;  4KUD B;  3WTP C;  3MGS D;  1B6W A;  5DNM A;  3AZM A;  2CV5 B;  5AY8 B;  4KUD D;  3LZ0 C;  3B6G B;  4WNN B;  2CV5 D;  5AY8 D;  5GT3 A;  5GT0 C;  3MNN A;  3B6G D;  3AZL B;  1P3M C;  5BNX B;  4EO5 C;  3B0D B;  3AZL D;  3EG5 B;  5F99 A;  4J8W C;  3LEL C;  3C1C A;  1P3K C;  3REK A;  3KUY C;  2NZD C;  5CHL B;  5B0Y C;  5E5A A;  5CPK C;  5AV9 B;  3WTP A;  1P3G B;  3REI C;  1F66 C;  3LZ0 A;  4LD9 B;  5AV9 D;  1P3G D;  4H9O A;  4JJN C;  4J8U C;  1KU5 A;  3AZG C;  5B33 B;  4WU9 B;  4LD9 D;  4WV4 B;  5JA4 A;  5GT0 A;  3B0C T;  5B33 D;  4H9R B;  5B24 B;  4WU9 D;  5C3I C;  4YM6 C;  3AZE C;  1P3M A;  1ULY A;  3W98 B;  5B1M C;  2XD1 A;  1KX3 C;  5B24 D;  2F8N G;  1BH9 A;  1P3P C;  4J8W A;  3NQU A;  4M6B A;  3W98 D;  3WKJ C;  3LEL A;  1P3K A;  3KUY A;  3WTP E;  5GSU B;  3IP4 C;  2NZD A;  3X1V B;  5B0Y A;  3R45 B;  5GSU D;  1KX5 B;  5B32 G;  3C1C C;  2BYK B;  5B0Z B;  3X1V D;  5CPK A;  1KX5 D;  5B40 C;  3REH C;  3REI A;  1U35 B;  5B0Z D;  3MVD C;  1TAF B;  3UT9 B;  1F66 A;  1P3A C;  3B0C W;  4JJN A;  4J8U A;  3W99 B;  1U35 D;  3AZG A;  3UT9 D;  3AZF B;  1P3F B;  5AVB B;  3W99 D;  2Y2K A;  1AOI C;  5JRG C;  3AZF D;  3AZE A;  4YM6 A;  2RVQ D;  5AVB D;  1P3F D;  1ID3 B;  5B1M A;  4J8X B;  1KX3 A;  3AZI C;  1P3P A;  2ZY2 A;  5B1L B;  3TU4 B;  4R8P B;  3AZF C;  1HTA A;  1ID3 D;  3WKJ A;  4J8X D;  3AV2 C;  3W96 C;  3B0B A;  4H9N A;  5B1L D;  4R8P D;  3TU4 D;  2J8P A;  3AZK B;  1T3U A;  1ID3 C;  3WA9 C;  3H0R C;  1F1E A;  4G91 C;  4XZQ B;  5B1L C;  2Y2O A;  4G92 C;  3AZK D;  3KSY A;  2ARO B;  5CPJ C;  4XZQ D;  1ZLA C;  2Y2L A;  1M19 C; 
#chains in the Genus database with same CATH homology
 5B40 A;  2ARO D;  2G5I C;  5DNM B;  3REH A;  3AZM B;  4KGC C;  3MVD A;  1P3A A;  4DRA A;  5DNM D;  3AZM D;  5GT3 B;  3MNN B;  5AVC C;  1A7W A;  5B2I C;  1AOI A;  5JRG A;  5GT3 D;  3MNN D;  3AZI A;  5F99 B;  3KXB C;  4Z5T C;  3AV2 A;  3W96 A;  2W8S A;  3REK B;  5F99 D;  3W97 C;  2RIQ A;  2PYO C;  3WA9 A;  3REK D;  4CSR A;  5B31 C;  5E5A B;  5DNN C;  2LY8 A;  4ZBJ B;  5CPJ A;  1ZLA A;  1R4V A;  3WTP B;  3H0M C;  5E5A D;  4HGA C;  4E45 A;  1M19 A;  4KHA A;  3AZN C;  4KGC A;  5GXQ C;  3LZ0 B;  1H3O A;  3WTP D;  4H9O B;  1WWI A;  3LZ0 D;  5GT0 B;  2CWE A;  5JA4 B;  5AVC A;  5B2I A;  2NQB C;  5GT0 D;  1P3M B;  1KX4 C;  4EO5 B;  1N1J A;  1BH9 B;  3P5J B;  4J8W B;  5AV6 C;  1P3M D;  3NQU B;  5KDM A;  3LEL B;  1P3K B;  3KXB A;  4Z5T A;  4J8W D;  3W97 A;  3LEL D;  3KUY B;  1P3K D;  2PYO A;  4QLC C;  2NZD B;  3X1T C;  5B31 A;  2Y2G A;  5B0Y B;  3KUY D;  5DNN A;  5FUG A;  2XD5 A;  2NZD D;  2IO5 C;  5CPK B;  5B0Y D;  5CPI C;  2DF4 C;  1WWS A;  3REI B;  3AZN A;  1BFM A;  5CPK D;  5GXQ A;  1P3B C;  1F66 B;  4JJN B;  1HQ3 C;  3MGQ C;  4J8U B;  3REI D;  3AZG B;  1F66 D;  4JJN D;  5BT1 C;  4J8U D;  3AZG D;  5AV8 C;  3AZE B;  5C3I B;  4YM6 B;  2NQB A;  1KX4 A;  3MGP C;  5CP6 C;  4XUJ C;  5B1M B;  4WZS B;  3LZ1 C;  3LJA C;  1KX3 B;  3AZE D;  1P3P B;  4YM6 D;  5AV6 A;  3REJ C;  3WKJ B;  5B1M D;  5G49 A;  1KX3 D;  1P3P D;  2FJ7 C;  4H9N B;  3UTB A;  3WKJ D;  2G5H C;  4QLC A;  3X1T A;  3VH5 T;  3EPK A;  3C1C B;  4YS3 C;  3EPH A;  2YFV A;  5CPI A;  2Y2Q A;  5B40 B;  3REH B;  3C1C D;  2ZY3 A;  3MVD B;  2HUE C;  3C1B B;  1P3B A;  4X23 C;  1P3A B;  1HQ3 A;  5B40 D;  3MGQ A;  2Y2P A;  5B2J C;  3REH D;  3MVD D;  3C1B D;  3WAA C;  1P3A D;  3AYW C;  1AOI B;  5JRG B;  5AV8 A;  4ZUX C;  3C1B C;  3MGP A;  4XUJ A;  5CP6 A;  1AOI D;  5JRG D;  3LZ1 A;  3LJA A;  3AZI B;  2UWX A;  3REJ A;  1P3I C;  4J8V C;  3B6F C;  4UUZ A;  3AV2 B;  3W96 B;  1P34 C;  3AZI D;  1Z2C B;  4NE3 A;  2FJ7 A;  2F2A C;  3WA9 B;  3VH5 W;  3AV2 D;  3W96 D;  1TZY C;  4CSR B;  4G91 B;  4G92 B;  3WA9 D;  5CPJ B;  5BS7 C;  4YS3 A;  1ZLA B;  3VH5 A;  3AZJ C;  1M19 B;  5BO0 A;  4KHA B;  5CPJ D;  4KGC B;  3AZH C;  1ZLA D;  1M18 C;  1H3O B;  4X23 A;  1M19 D;  4UPK A;  2DQN C;  5B2J A;  4KGC D;  5AV5 C;  3WAA A;  4Z2M H;  4H9P A;  5AVC B;  5B2I B;  3AYW A;  4ZUX A;  2F8N H;  3AL0 C;  3C1B A;  5AVC D;  1N1J B;  5B2I D;  3KFU G;  5KDM B;  1P3I A;  4J8V A;  3B6F A;  3KXB B;  4Z5T B;  4WU8 D;  1P34 A;  1P3L C;  3W97 B;  3KXB D;  2PYO B;  4Z5T D;  4WU8 C;  1TZY A;  3W97 D;  5B31 B;  2Y2M A;  3EPL A;  3UTA C;  2PYO D;  5DNN B;  5FUG B;  1M1A C;  5BS7 A;  5B31 D;  3AZJ A;  4HGA B;  5DNN D;  3AZN B;  2HIO C;  3AZH A;  5GXQ B;  1M18 A;  4Z66 C;  3AZN D;  1P3O C;  1EQZ C;  3A1K A;  5GXQ D;  5AV5 A;  3KWQ C;  3REL C;  2NQB B;  1KX4 B;  5B32 C;  1B67 A;  2NQB D;  1KX4 D;  2JE5 A;  5AV6 B;  1S32 C;  3A6N C;  5G49 B;  3UTB B;  5AV6 D;  1P3L A;  3AV1 C;  3FDD A;  3AFA C;  4QLC B;  4WU8 A;  3UTB D;  3X1T B;  2YFW A;  2Y2H A;  4CAY A;  3X1U C;  3UTA A;  1BH8 A;  4QLC D;  3AN2 A;  1M1A A;  3X1T D;  3F6T A;  2IO5 B;  3UTB C;  2YFV B;  5BNV A;  5CPI B;  2F8N A;  2HIO A;  1P3B B;  5CPI D;  1HQ3 B;  4H9Q A;  4Z66 A;  3MGQ B;  1P3O A;  1EQZ A;  1P3B D;  3KWQ A;  1HQ3 D;  3MGQ D;  1PZR A;  5AV8 B;  3REL A;  3O62 C;  3MGP B;  4XUJ B;  5B32 A;  5CP6 B;  3MGR C;  5BT1 D;  4AWL C;  3X1S C;  3LZ1 B;  5AV8 D;  3LJA B;  3MGS C;  3MGP D;  3REJ B;  4XUJ D;  5CP6 D;  3A6N A;  1S32 A;  4KUD C;  4UUZ B;  3LZ1 D;  3LJA D;  2FJ7 B;  1JFI A;  3REJ D;  2CV5 C;  3AV1 A;  1Q9C A;  5AY8 C;  3AFA A;  3B6G C;  2ZM5 A;  2FJ7 D;  3X1U A;  4WJ3 C;  3AZL C;  4YS3 B;  2F8N K;  5BO0 B;  3B0D C;  4YS3 D;  2HUE B;  4X23 B;  3NQJ A;  5B2J B;  3WAA B;  4H9P B;  4X23 D;  2Y2N A;  5B2J D;  3AYW B;  4ZUX B;  2BYM A;  3WAA D;  3V9R A;  3O62 A;  3MGR A;  3X1S A;  3AYW D;  4ZUX D;  3MGS A;  1P3I B;  4J8V B;  3B6F B;  4KUD A;  5AV9 C;  1P3G C;  1P34 B;  4Z2M G;  2CV5 A;  1P3I D;  5AY8 A;  4J8V D;  3B6F D;  4LD9 C;  1P34 D;  3B6G A;  4WNN A;  1TZY B;  2Y2J A;  5B33 C;  4WU9 C;  1TZY D;  5B31 G;  3AZL A;  5B24 C;  3AZJ B;  2VQR A;  2Y2I A;  5BNX A;  3W98 C;  3AZH B;  1M18 B;  3AZJ D;  1W2E A;  3EPJ A;  2ZY4 A;  3AZH D;  5AV5 B;  1M18 D;  2L5A A;  3A1I A;  5GSU C;  5AV5 D;  3X1V C;  3VH6 T;  1KX5 C;  4DRB A;  5B0Z C;  5AV9 A;  1P3G A;  4NE6 A;  1P3L B;  1U35 C;  3UT9 C;  4LD9 A;  4NE5 A;  4WU8 B;  1P3L D;  3W99 C;  2YFW B;  4CAY B;  5B33 A;  4WU9 A;  2JCH A;  3UTA B;  2RVQ C;  1BH8 B;  5AVB C;  3AN2 B;  1P3F C;  1M1A B;  4H9R A;  5B24 A;  2F8N B;  5BNV B;  3UTA D;  3AN2 D;  1M1A D;  3W98 A;  2HIO B;  4J8X C;  2F8N D;  3TU4 C;  4R8P C;  4H9Q B;  4Z66 B;  3AN2 C;  2HIO D;  1P3O B;  1EQZ B;  4DQY B;  3KWQ B;  4Z66 D;  3VH6 W;  3AZK C;  1P3O D;  1EQZ D;  5GSU A;  3REL B;  2FFF B;  3KWQ D;  4H9S C;  4XZQ C;  5B32 B;  3X1V A;  3R45 A;  1KX5 A;  3REL D;  2ARO C;  1S32 B;  3VH6 A;  2BYK A;  5B32 D;  5B0Z A;  3A6N B;  2BG1 A;  3H0L C;  4E44 A;  1JFI B;  5DNM C;  1S32 D;  3AZM C;  3AV1 B;  3A6N D;  3UT9 A;  1TAF A;  1U35 A;  3AFA B;  2ZY5 A;  3W99 A;  3AV1 D;  4NFT A;  3X1U B;  3AFA D;  5GT3 C;  3AZF A;  1P3F A;  5AVB A;  3MNN C;  3X1U D;  2JSS A;  1ID3 A;  4J8X A;  5F99 C;  5B1L A;  3TU4 A;  3NQJ B;  4R8P A;  3REK C;  3AZK A;  2BYM B;  3V9R B;  3O62 B;  3MGR B;  4H9S A;  4XZQ A;  3X1S B;  4AWL B;  5E5A C;  3MGS B;  2ARO A;  3O62 D;  4ZBJ C;  3MGR D;  3X1S D;  4KUD B;  3WTP C;  3MGS D;  1B6W A;  5DNM A;  3AZM A;  2CV5 B;  5AY8 B;  4KUD D;  3LZ0 C;  3B6G B;  4WNN B;  2CV5 D;  5AY8 D;  5GT3 A;  5GT0 C;  3MNN A;  3B6G D;  3AZL B;  1P3M C;  5BNX B;  4EO5 C;  3B0D B;  3AZL D;  3EG5 B;  5F99 A;  4J8W C;  3LEL C;  3C1C A;  1P3K C;  3REK A;  3KUY C;  2NZD C;  5CHL B;  5B0Y C;  5E5A A;  5CPK C;  5AV9 B;  3WTP A;  1P3G B;  3REI C;  1F66 C;  3LZ0 A;  4LD9 B;  5AV9 D;  1P3G D;  4H9O A;  4JJN C;  4J8U C;  1KU5 A;  3AZG C;  5B33 B;  4WU9 B;  4LD9 D;  4WV4 B;  5JA4 A;  5GT0 A;  3B0C T;  5B33 D;  4H9R B;  5B24 B;  4WU9 D;  5C3I C;  4YM6 C;  3AZE C;  1P3M A;  1ULY A;  3W98 B;  5B1M C;  2XD1 A;  1KX3 C;  5B24 D;  2F8N G;  1BH9 A;  1P3P C;  4J8W A;  3NQU A;  4M6B A;  3W98 D;  3WKJ C;  3LEL A;  1P3K A;  3KUY A;  3WTP E;  5GSU B;  3IP4 C;  2NZD A;  3X1V B;  5B0Y A;  3R45 B;  5GSU D;  1KX5 B;  5B32 G;  3C1C C;  2BYK B;  5B0Z B;  3X1V D;  5CPK A;  1KX5 D;  5B40 C;  3REH C;  3REI A;  1U35 B;  5B0Z D;  3MVD C;  1TAF B;  3UT9 B;  1F66 A;  1P3A C;  3B0C W;  4JJN A;  4J8U A;  3W99 B;  1U35 D;  3AZG A;  3UT9 D;  3AZF B;  1P3F B;  5AVB B;  3W99 D;  2Y2K A;  1AOI C;  5JRG C;  3AZF D;  3AZE A;  4YM6 A;  2RVQ D;  5AVB D;  1P3F D;  1ID3 B;  5B1M A;  4J8X B;  1KX3 A;  3AZI C;  1P3P A;  2ZY2 A;  5B1L B;  3TU4 B;  4R8P B;  3AZF C;  1HTA A;  1ID3 D;  3WKJ A;  4J8X D;  3AV2 C;  3W96 C;  3B0B A;  4H9N A;  5B1L D;  4R8P D;  3TU4 D;  2J8P A;  3AZK B;  1T3U A;  1ID3 C;  3WA9 C;  3H0R C;  1F1E A;  4G91 C;  4XZQ B;  5B1L C;  2Y2O A;  4G92 C;  3AZK D;  3KSY A;  2ARO B;  5CPJ C;  4XZQ D;  1ZLA C;  2Y2L A;  1M19 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...