3C1BB

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
80
structure length
80
Chain Sequence
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 28
structure length 80
sequence length 80
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1bB00
5DNNB 3AZFB 5DNND 4WU8A 3AZFD 5GSUC 5AY8A 1M18A 1ZLAC 3REKC 1P3MB 1P3MD 5B1LB 4X23C 5B1LD 4KUDA 5JRGA 1F66B 5AVBC 1F66D 1BFMA 1EQZB 1TZYB 4H9PB 1TZYD 1EQZD 3MGRB 3NQUB 3AZGC 2NZDC 5E5AA 3X1TD 1BH9A 3VH6A 2FJ7C 4E45A 5B2IA 4J8VC 5B32D 3B6FC 2CV5A 4YS3C 5CP6B 4WU9B 5CP6D 4WU9D 3W97A 1R4VA 4H9OB 5BT1D 1H3OA 5JA4A 4G91C 2L5AA 1P3AA 3O62B 1M1AC 3O62D 4WU8C 3UT9B 3UT9D 1TAFA 1M18C 3AN2A 3AV2B 3AV2D 4J8UB 3LZ0C 4J8UD 4KUDC 5B31C 1P3IA 5CPJC 3C1BB 3C1BD 1U35C 3WTPA 5E5AC 1KX5A 4ZUXB 4ZUXD 5DNMA 5CPIB 5CPID 3W98B 5B2IC 5AV6C 2HIOA 5B2JB 3KUYB 5B2JD 3KUYD 3UTAA 3LJAA 3VH5T 2PYOC 4Z2MH 5B0ZC 5GT3C 1P34C 3KXBA 1P3FD 3AYWA 1P3PB 1P3PD 3LELA 3LZ1B 3LZ1D 5BNXB 3REHA 3AN2C 2IO5C 3RELA 3MNNA 3B6GA 4LD9A 3REIA 5GSUB 1P3IC 5GSUD 1A7WA 1ZLAB 3MGPA 1ZLAD 1P3KA 3REKB 3WTPC 4X23B 4X23D 3MGSA 1KX5C 4DRBA 5DNMC 5AVBB 5AVBD 3R45A 3AZGB 3X1SC 2NZDB 2NZDD 3REJA 1P3GC 2FJ7B 2FJ7D 4JJNC 4H9NA 4J8VB 4J8VD 3B6FB 3B6FD 4YS3B 5GXQA 5KDMB 3AZIA 4WNNB 1HQ3C 4G91B 3REHC 3TU4C 3RELC 3UTBA 3B6GC 1P3OC 1M1AB 1M1AD 4WU8B 4LD9C 4WU8D 4J8XC 1M18B 4YM6C 1M18D 2RVQD 1P3KC 1AOIA 2CWEA 3LZ0B 3LZ0D 4XZQA 4Z66A 4KUDB 5B31B 4KUDD 5BS7C 5B31D 5AVCA 4R8PD 5CPJB 5CPJD 4Z5TA 1U35B 1U35D 5AV5A 5E5AB 5E5AD 1P3LA 5CPKD 1BH9B 3WTPE 3REJC 5B2IB 5B2ID 5FUGA 5AV6B 5AV6D 1S32A 5GXQC 3AZIC 4ZBJC 2PYOB 2PYOD 1KX4C 5JA4B 5B0ZB 5B0ZD 5GT3B 1P34B 5GT3D 1P34D 5B24A 5AV9C 3C1CA 3V9RB 3AN2B 3AN2D 2IO5B 4KGCC 1AOIC 5F99A 4XZQC 1B67A 1P3IB 1P3ID 3WTPB 3WTPD 1P3LC 2YFVA 4KHAA 1KX5B 4CAYA 5DNMB 1KX5D 5DNMD 4E44A 1HTAA 3X1SB 3X1SD 1S32C 3WAAA 1P3GB 1P3GD 4JJNB 4JJND 2AROC 3WA9A 1KX3A 3MGRD 3B0CT 1HQ3B 1HQ3D 3VH5W 3REHB 3REHD 3TU4B 3TU4D 3RELB 3RELD 5F99C 3B6GB 3AFAA 1P3OB 1P3OD 3B6GD 4LD9B 4J8XB 2NQBA 4J8XD 4YM6B 4XUJA 4YM6D 1P3KB 1P3KD 5B40C 1N1JA 5BNVA 1B6WA 3AZHA 4H9QA 4H9RA 3R45B 4NE5A 3W99A 1M19A 5AY8C 4QLCA 3REJB 4H9NB 5GT0A 3VH5A 5JRGC 5GXQB 5GXQD 3AZIB 4ZBJB 1KX4B 1KX3C 1KX4D 4AWLB 5C3IC 3AFAC 3MGQA 3W98D 5AV9B 5AV9D 2NQBC 2CV5C 4XUJC 3AZEA 1AOIB 4KGCB 1AOID 3W97C 4KGCD 4XZQB 4XZQD 3AZLA 3AZHC 1P3AC 2BYMB 1P3LB 1JFIB 4UUZA 3AZMA 1P3LD 1M19C 4QLCC 5GT0C 5FUGB 1S32B 1F1EA 1S32D 3AZNA 3REKD 3W96A 3AZFA 2AROB 3MGQC 2AROD 5AV8A 3AZGD 2HIOC 5B1LA 3X1VA 3AZEC 5F99B 3UTAC 1F66A 3LJAC 3AZLC 1EQZA 4H9PA 1TZYA 3KXBC 3AYWC 4YS3D 3X1TA 5B40B 5B40D 3NQJA 2YFVB 4CAYB 3LELC 5B32A 4WU9A 3MNNC 3REIC 5AY8B 5AY8D 3MGPC 2HUEC 3W96C 3MGSC 5JRGB 5JRGD 4WZSB 3MVDA 2BYKA 1KX3B 5AV8C 4J8UA 5C3IB 3X1VC 3AFAB 3AFAD 3C1BA 2NQBB 2CV5B 4XUJB 2CV5D 3X1TC 4ZUXA 3W97B 5BNVB 3AZKA 3W97D 3AZHB 3AZHD 1H3OB 5B32C 4H9QB 3UTBC 1P3AB 1P3AD 4M6BA 1M19B 1M19D 4QLCB 1TAFB 4QLCD 1P3FA 5GT0B 4Z66C 5AVCC 3MVDC 5BNXA 2YFWA 4Z5TC 5AV5C 5GSUA 3MGQB 3MGQD 4CSRA 1ZLAA 2F8NA 2HIOB 2HIOD 4X23A 3AZEB 3AZED 3UTAB 3UTAD 3AZKC 3LJAB 3LJAD 3AZLB 3AV1A 4NE6A 5G49A 3KXBB 3KXBD 5B24C 3AYWB 3AYWD 3WKJA 4UUZB 3C1CC 3LELB 3LELD 2FJ7A 1P3FC 1BH8A 3MNNB 3MNND 4EO5C 5KDMA 3REIB 5B33A 3REID 4LD9D 3MGPB 1ID3A 2HUEB 3MGPD 3MGSB 3W96B 3MGSD 4Z2MG 5AV8B 5AV8D 4H9SA 3LZ0A 4G92C 3X1VB 3X1UA 3X1VD 5B31A 4R8PA 3AV1C 3WAAC 3REJD 5CPJA 5B32G 1U35A 3X1TB 5CPKA 3NQJB 3WA9C 3WKJC 3AZID 3AZJA 5B32B 5AV6A 3UTBB 3UTBD 1P3BA 5B1MA 4J8WA 5B33C 2PYOA 5B0ZA 5GT3A 1P34A 4HGAC 1ID3C 4Z66B 4Z66D 5AVCB 5AVCD 3MVDB 5BO0A 3MVDD 2BYKB 3V9RA 2RVQC 3VH6T 4Z5TB 4Z5TD 4H9SC 3W99C 5AV5B 5AV5D 3X1UC 4R8PC 3KWQA 1ULYA 3A6NA 5CPKC 3AZKB 3AZKD 1Q9CA 3AZJC 5B0YA 3X1SA 5B24B 5B24D 5DNNA 4WV4B 1P3BC 5B1MC 4J8WC 3C1CB 3C1CD 1P3GA 4JJNA 1P3FB 1P3MA 5F99D 4EO5B 3MGRA 3NQUA 1HQ3A 2F8NG 3TU4A 2YFWB 3AZMC 1P3OA 4KHAB 3KWQC 4J8XA 4CSRB 4YM6A 2LY8A 1WWSA 5CP6A 2F8NB 4NE3A 2F8ND 3KSYA 4G92B 3A6NC 4H9OA 5BS7A 3AZNC 3AV1B 3WAAB 3AV1D 3WAAD 5B0YC 5G49B 3O62A 2JSSA 3B0DC 5DNNC 3AZFC 3UT9A 3WA9B 3WKJB 3WA9D 3WKJD 1WWIA 3AV2A 1KX3D 1P3MC 1BH8B 5B1LC 1F66C 5B33B 1TZYC 5B33D 1EQZC 1KX4A 3MGRC 2NQBD 4HGAB 1ID3B 1ID3D 4XUJD 3B0CW 1N1JB 5CPIA 5B31G 3W98A 5AV9A 4H9RB 5B2JA 3KUYA 5CP6C 4WU9C 4KGCA 3W99B 3W99D 3X1UB 2F8NK 3X1UD 5BT1C 4R8PB 1P3PA 5GT0D 5CHLB 3O62C 2BYMA 1JFIA 5CPKB 3UT9C 3LZ1A 3AZJB 2F8NH 3AZJD 3AV2C 4J8UC 1P3BB 1P3BD 5B1MB 4J8WB 5B1MD 4J8WD 3C1BC 3REKA 4AWLC 4ZUXC 4NFTA 5CPIC 5AVBA 3W98C 2AROA 3AZLD 5BO0B 3AZGA 2NZDA 5B2JC 3KUYC 3AZMB 3AZMD 3KWQB 3B0BA 3KWQD 4J8VA 3B6FA 1KU5A 4YS3A 1P3PC 5B40A 3A6NB 3A6ND 3VH6W 4DRAA 4WNNA 3AZNB 3LZ1C 3AZND 5B0YB 5B0YD 3W96D 1M1AA 3B0DB
chains in the Genus database with same CATH superfamily
5DNNB 3AZFB 5DNND 4WU8A 3AZFD 5GSUC 5AY8A 1M18A 1ZLAC 3REKC 1P3MB 1P3MD 5B1LB 4X23C 5B1LD 4KUDA 5JRGA 1F66B 5AVBC 1F66D 1BFMA 1EQZB 1TZYB 4H9PB 1TZYD 1EQZD 3MGRB 2Y2IA 3NQUB 3AZGC 2NZDC 5E5AA 3X1TD 1BH9A 3VH6A 2FJ7C 4E45A 5B2IA 4J8VC 5B32D 3B6FC 2CV5A 4YS3C 5CP6B 4WU9B 5CP6D 4WU9D 3W97A 1R4VA 4H9OB 5BT1D 1H3OA 5JA4A 4G91C 2L5AA 1P3AA 3O62B 1M1AC 2ZY3A 3O62D 4WU8C 3UT9B 3UT9D 1TAFA 1M18C 3AN2A 3AV2B 3AV2D 4J8UB 3LZ0C 4J8UD 4KUDC 5B31C 1P3IA 2Y2MA 5CPJC 3C1BB 3C1BD 1U35C 3WTPA 5E5AC 1KX5A 4ZUXB 4ZUXD 5DNMA 5CPIB 5CPID 3W98B 5B2IC 2G5HC 5AV6C 2HIOA 5B2JB 3KUYB 5B2JD 3KUYD 3UTAA 2VQRA 3LJAA 3VH5T 2PYOC 4Z2MH 2Y2GA 2Y2NA 5B0ZC 5GT3C 1P34C 3KXBA 1P3FD 4DQYB 3AYWA 2Y2JA 1P3PB 1P3PD 3LELA 3LZ1B 3LZ1D 5BNXB 3REHA 3AN2C 2IO5C 2Y2HA 3RELA 3A1IA 3MNNA 3B6GA 4LD9A 3REIA 5GSUB 1P3IC 5GSUD 1A7WA 1ZLAB 3MGPA 1ZLAD 1P3KA 3REKB 3WTPC 4X23B 4X23D 3MGSA 1KX5C 4DRBA 5DNMC 5AVBB 5AVBD 3R45A 3AZGB 3X1SC 2NZDB 2NZDD 3REJA 1P3GC 2FJ7B 2FJ7D 4JJNC 4H9NA 4J8VB 4J8VD 3B6FB 3B6FD 4YS3B 5GXQA 5KDMB 3AZIA 4WNNB 1HQ3C 4G91B 3REHC 3TU4C 1T3UA 3RELC 3UTBA 3B6GC 1P3OC 1M1AB 1M1AD 4WU8B 4LD9C 4WU8D 2Y2QA 4J8XC 1M18B 4YM6C 1M18D 2RVQD 2XD5A 1P3KC 1AOIA 2CWEA 3LZ0B 3LZ0D 4XZQA 3H0LC 4Z66A 4KUDB 5B31B 4KUDD 5BS7C 5B31D 5AVCA 4R8PD 5CPJB 5CPJD 4Z5TA 1U35B 1U35D 5AV5A 5E5AB 5E5AD 1P3LA 5CPKD 1BH9B 3WTPE 3REJC 5B2IB 5B2ID 2ZY5A 5FUGA 5AV6B 5AV6D 1S32A 5GXQC 4UPKA 3AZIC 4ZBJC 2PYOB 2PYOD 1KX4C 5JA4B 5B0ZB 5B0ZD 5GT3B 1P34B 5GT3D 1P34D 5B24A 5AV9C 3H0RC 2ZY4A 3C1CA 3V9RB 3AN2B 3AN2D 2IO5B 4KGCC 1AOIC 5F99A 4XZQC 1B67A 1P3IB 1P3ID 2ZM5A 3KFUG 3WTPB 3WTPD 1P3LC 2YFVA 4KHAA 1KX5B 4CAYA 5DNMB 1KX5D 5DNMD 4E44A 2F2AC 1HTAA 3X1SB 3X1SD 1S32C 3WAAA 1P3GB 2Y2KA 1P3GD 4JJNB 4JJND 2AROC 3WA9A 1KX3A 3MGRD 3B0CT 1HQ3B 1HQ3D 3VH5W 3REHB 3REHD 3TU4B 3A1KA 3RELB 3TU4D 3RELD 5F99C 3B6GB 3AFAA 1P3OB 1P3OD 3B6GD 4LD9B 4J8XB 2NQBA 4J8XD 4YM6B 4XUJA 4YM6D 1P3KB 1P3KD 5B40C 1N1JA 5BNVA 1B6WA 3AZHA 3F6TA 4H9QA 4H9RA 3R45B 3H0MC 4NE5A 3W99A 1M19A 5AY8C 4QLCA 3REJB 3IP4C 4H9NB 5GT0A 3VH5A 5JRGC 5GXQB 5GXQD 3AZIB 4ZBJB 1KX4B 1KX3C 1KX4D 4AWLB 5C3IC 3AFAC 3MGQA 3W98D 5AV9B 5AV9D 2NQBC 2CV5C 4XUJC 3AZEA 1AOIB 4KGCB 1AOID 3W97C 4KGCD 4XZQB 4XZQD 3AZLA 3AZHC 1P3AC 2BYMB 1P3LB 1JFIB 4UUZA 3AZMA 1P3LD 1M19C 2G5IC 4QLCC 2Y2PA 3EG5B 3AL0C 5GT0C 5FUGB 1S32B 1F1EA 1S32D 4WJ3C 3AZNA 3REKD 2UWXA 3W96A 3AZFA 2BG1A 2AROB 3MGQC 2AROD 5AV8A 3AZGD 2HIOC 5B1LA 3X1VA 2W8SA 3AZEC 5F99B 3UTAC 1F66A 3LJAC 3AZLC 1EQZA 4H9PA 1TZYA 3KXBC 3AYWC 2J8PA 4YS3D 3X1TA 5B40B 5B40D 3NQJA 2YFVB 4CAYB 3LELC 5B32A 2ZY2A 4WU9A 3MNNC 3REIC 5AY8B 5AY8D 3MGPC 2HUEC 3EPKA 3W96C 3MGSC 5JRGB 5JRGD 4WZSB 3MVDA 2BYKA 1KX3B 5AV8C 4J8UA 5C3IB 3X1VC 3AFAB 3AFAD 1PZRA 3C1BA 2NQBB 2CV5B 4XUJB 2DF4C 2CV5D 3X1TC 4ZUXA 3W97B 5BNVB 3AZKA 3W97D 3AZHB 3AZHD 1H3OB 5B32C 4H9QB 3UTBC 1P3AB 1P3AD 4M6BA 1M19B 1M19D 1TAFB 4QLCB 4QLCD 1P3FA 5GT0B 2RIQA 4Z66C 5AVCC 3MVDC 5BNXA 2YFWA 4Z5TC 5AV5C 5GSUA 3MGQB 3MGQD 4CSRA 1ZLAA 3EPLA 2F8NA 2HIOB 2HIOD 4X23A 3AZEB 3AZED 3UTAB 3UTAD 3AZKC 3LJAB 3LJAD 3AZLB 3AV1A 4NE6A 5G49A 3KXBB 3KXBD 5B24C 3AYWB 3AYWD 3WKJA 4UUZB 3C1CC 3LELB 3LELD 2FJ7A 1P3FC 1BH8A 3MNNB 3MNND 4EO5C 5KDMA 3REIB 5B33A 3REID 4LD9D 3MGPB 1ID3A 2HUEB 3MGPD 3MGSB 3W96B 3MGSD 4Z2MG 5AV8B 5AV8D 2Y2LA 4H9SA 3LZ0A 4G92C 3X1VB 3X1UA 3X1VD 5B31A 4R8PA 3AV1C 3WAAC 3REJD 5CPJA 5B32G 1U35A 3X1TB 5CPKA 3NQJB 3WA9C 3WKJC 3AZID 3AZJA 5B32B 5AV6A 3UTBB 3UTBD 1P3BA 5B1MA 4J8WA 5B33C 2PYOA 5B0ZA 5GT3A 1P34A 4HGAC 1ID3C 4Z66B 4Z66D 5AVCB 5AVCD 3MVDB 5BO0A 3MVDD 2BYKB 3V9RA 2RVQC 3VH6T 4Z5TB 3P5JB 4H9SC 4Z5TD 3W99C 5AV5B 5AV5D 3X1UC 4R8PC 3KWQA 1ULYA 3A6NA 5CPKC 3AZKB 3AZKD 1Q9CA 3AZJC 5B0YA 3X1SA 5B24B 5B24D 2DQNC 5DNNA 4WV4B 3EPJA 1P3BC 5B1MC 4J8WC 3C1CB 3C1CD 1P3GA 4JJNA 1P3FB 1P3MA 5F99D 4EO5B 3MGRA 3NQUA 1HQ3A 2F8NG 3TU4A 2YFWB 3AZMC 1P3OA 4KHAB 3EPHA 3KWQC 4J8XA 4CSRB 4YM6A 2LY8A 1WWSA 5CP6A 2F8NB 4NE3A 2F8ND 3KSYA 4G92B 3A6NC 4H9OA 5BS7A 3AZNC 3AV1B 3WAAB 3AV1D 3WAAD 5B0YC 5G49B 3O62A 2JSSA 3B0DC 5DNNC 3AZFC 2JE5A 2Y2OA 3UT9A 3WA9B 3WKJB 3WA9D 3WKJD 1WWIA 3AV2A 1KX3D 1P3MC 1BH8B 5B1LC 1F66C 5B33B 1TZYC 5B33D 1EQZC 1KX4A 3MGRC 2NQBD 4HGAB 1ID3B 1ID3D 4XUJD 3B0CW 1N1JB 5CPIA 5B31G 3W98A 1Z2CB 5AV9A 4H9RB 3FDDA 5B2JA 3KUYA 5CP6C 4WU9C 1W2EA 4KGCA 3W99B 3W99D 3X1UB 2F8NK 3X1UD 5BT1C 4R8PB 1P3PA 5GT0D 5CHLB 3O62C 2BYMA 1JFIA 5CPKB 3UT9C 3LZ1A 3AZJB 2F8NH 3AZJD 3AV2C 4J8UC 2XD1A 1P3BB 1P3BD 5B1MB 4J8WB 5B1MD 4J8WD 3C1BC 3REKA 4AWLC 4ZUXC 4NFTA 5CPIC 5AVBA 3W98C 2AROA 3AZLD 5BO0B 3AZGA 2NZDA 5B2JC 3KUYC 3AZMB 3AZMD 2JCHA 3KWQB 3B0BA 3KWQD 4J8VA 3B6FA 2FFFB 1KU5A 4YS3A 1P3PC 5B40A 3A6NB 3A6ND 3VH6W 4DRAA 4WNNA 3AZNB 3LZ1C 3AZND 5B0YB 5B0YD 3W96D 1M1AA 3B0DB
chains in the Genus database with same CATH topology
5DNNB 3AZFB 5DNND 4WU8A 3AZFD 5GSUC 5AY8A 1M18A 1ZLAC 3REKC 1P3MB 1P3MD 5B1LB 4X23C 5B1LD 4KUDA 5JRGA 1F66B 5AVBC 1F66D 1BFMA 1EQZB 1TZYB 4H9PB 1TZYD 1EQZD 3MGRB 2Y2IA 3NQUB 3AZGC 2NZDC 5E5AA 3X1TD 1BH9A 3VH6A 2FJ7C 4E45A 5B2IA 4J8VC 5B32D 3B6FC 2CV5A 4YS3C 5CP6B 4WU9B 5CP6D 4WU9D 3W97A 1R4VA 4H9OB 5BT1D 1H3OA 5JA4A 4G91C 2L5AA 1P3AA 3O62B 1M1AC 2ZY3A 3O62D 4WU8C 3UT9B 3UT9D 1TAFA 1M18C 3AN2A 3AV2B 3AV2D 4J8UB 3LZ0C 4J8UD 4KUDC 5B31C 1P3IA 2Y2MA 5CPJC 3C1BB 3C1BD 1U35C 3WTPA 5E5AC 1KX5A 4ZUXB 4ZUXD 5DNMA 5CPIB 5CPID 3W98B 5B2IC 2G5HC 5AV6C 2HIOA 5B2JB 3KUYB 5B2JD 3KUYD 3UTAA 2VQRA 3LJAA 3VH5T 2PYOC 4Z2MH 2Y2GA 2Y2NA 5B0ZC 5GT3C 1P34C 3KXBA 1P3FD 4DQYB 3AYWA 2Y2JA 1P3PB 1P3PD 3LELA 3LZ1B 3LZ1D 5BNXB 3REHA 3AN2C 2IO5C 2Y2HA 3RELA 3A1IA 3MNNA 3B6GA 4LD9A 3REIA 5GSUB 1P3IC 5GSUD 1A7WA 1ZLAB 3MGPA 1ZLAD 1P3KA 3REKB 3WTPC 4X23B 4X23D 3MGSA 1KX5C 4DRBA 5DNMC 5AVBB 5AVBD 3R45A 3AZGB 3X1SC 2NZDB 2NZDD 3REJA 1P3GC 2FJ7B 2FJ7D 4JJNC 4H9NA 4J8VB 4J8VD 3B6FB 3B6FD 4YS3B 5GXQA 5KDMB 3AZIA 4WNNB 1HQ3C 4G91B 3REHC 3TU4C 1T3UA 3RELC 3UTBA 3B6GC 1P3OC 1M1AB 1M1AD 4WU8B 4LD9C 4WU8D 2Y2QA 4J8XC 1M18B 4YM6C 1M18D 2RVQD 2XD5A 1P3KC 1AOIA 2CWEA 3LZ0B 3LZ0D 4XZQA 3H0LC 4Z66A 4KUDB 5B31B 4KUDD 5BS7C 5B31D 5AVCA 4R8PD 5CPJB 5CPJD 4Z5TA 1U35B 1U35D 5AV5A 5E5AB 5E5AD 1P3LA 5CPKD 1BH9B 3WTPE 3REJC 5B2IB 5B2ID 2ZY5A 5FUGA 5AV6B 5AV6D 1S32A 5GXQC 4UPKA 3AZIC 4ZBJC 2PYOB 2PYOD 1KX4C 5JA4B 5B0ZB 5B0ZD 5GT3B 1P34B 5GT3D 1P34D 5B24A 5AV9C 3H0RC 2ZY4A 3C1CA 3V9RB 3AN2B 3AN2D 2IO5B 4KGCC 1AOIC 5F99A 4XZQC 1B67A 1P3IB 1P3ID 2ZM5A 3KFUG 3WTPB 3WTPD 1P3LC 2YFVA 4KHAA 1KX5B 4CAYA 5DNMB 1KX5D 5DNMD 4E44A 2F2AC 1HTAA 3X1SB 3X1SD 1S32C 3WAAA 1P3GB 2Y2KA 1P3GD 4JJNB 4JJND 2AROC 3WA9A 1KX3A 3MGRD 3B0CT 1HQ3B 1HQ3D 3VH5W 3REHB 3REHD 3TU4B 3A1KA 3RELB 3TU4D 3RELD 5F99C 3B6GB 3AFAA 1P3OB 1P3OD 3B6GD 4LD9B 4J8XB 2NQBA 4J8XD 4YM6B 4XUJA 4YM6D 1P3KB 1P3KD 5B40C 1N1JA 5BNVA 1B6WA 3AZHA 3F6TA 4H9QA 4H9RA 3R45B 3H0MC 4NE5A 3W99A 1M19A 5AY8C 4QLCA 3REJB 3IP4C 4H9NB 5GT0A 3VH5A 5JRGC 5GXQB 5GXQD 3AZIB 4ZBJB 1KX4B 1KX3C 1KX4D 4AWLB 5C3IC 3AFAC 3MGQA 3W98D 5AV9B 5AV9D 2NQBC 2CV5C 4XUJC 3AZEA 1AOIB 4KGCB 1AOID 3W97C 4KGCD 4XZQB 4XZQD 3AZLA 3AZHC 1P3AC 2BYMB 1P3LB 1JFIB 4UUZA 3AZMA 1P3LD 1M19C 2G5IC 4QLCC 2Y2PA 3EG5B 3AL0C 5GT0C 5FUGB 1S32B 1F1EA 1S32D 4WJ3C 3AZNA 3REKD 2UWXA 3W96A 3AZFA 2BG1A 2AROB 3MGQC 2AROD 5AV8A 3AZGD 2HIOC 5B1LA 3X1VA 2W8SA 3AZEC 5F99B 3UTAC 1F66A 3LJAC 3AZLC 1EQZA 4H9PA 1TZYA 3KXBC 3AYWC 2J8PA 4YS3D 3X1TA 5B40B 5B40D 3NQJA 2YFVB 4CAYB 3LELC 5B32A 2ZY2A 4WU9A 3MNNC 3REIC 5AY8B 5AY8D 3MGPC 2HUEC 3EPKA 3W96C 3MGSC 5JRGB 5JRGD 4WZSB 3MVDA 2BYKA 1KX3B 5AV8C 4J8UA 5C3IB 3X1VC 3AFAB 3AFAD 1PZRA 3C1BA 2NQBB 2CV5B 4XUJB 2DF4C 2CV5D 3X1TC 4ZUXA 3W97B 5BNVB 3AZKA 3W97D 3AZHB 3AZHD 1H3OB 5B32C 4H9QB 3UTBC 1P3AB 1P3AD 4M6BA 1M19B 1M19D 1TAFB 4QLCB 4QLCD 1P3FA 5GT0B 2RIQA 4Z66C 5AVCC 3MVDC 5BNXA 2YFWA 4Z5TC 5AV5C 5GSUA 3MGQB 3MGQD 4CSRA 1ZLAA 3EPLA 2F8NA 2HIOB 2HIOD 4X23A 3AZEB 3AZED 3UTAB 3UTAD 3AZKC 3LJAB 3LJAD 3AZLB 3AV1A 4NE6A 5G49A 3KXBB 3KXBD 5B24C 3AYWB 3AYWD 3WKJA 4UUZB 3C1CC 3LELB 3LELD 2FJ7A 1P3FC 1BH8A 3MNNB 3MNND 4EO5C 5KDMA 3REIB 5B33A 3REID 4LD9D 3MGPB 1ID3A 2HUEB 3MGPD 3MGSB 3W96B 3MGSD 4Z2MG 5AV8B 5AV8D 2Y2LA 4H9SA 3LZ0A 4G92C 3X1VB 3X1UA 3X1VD 5B31A 4R8PA 3AV1C 3WAAC 3REJD 5CPJA 5B32G 1U35A 3X1TB 5CPKA 3NQJB 3WA9C 3WKJC 3AZID 3AZJA 5B32B 5AV6A 3UTBB 3UTBD 1P3BA 5B1MA 4J8WA 5B33C 2PYOA 5B0ZA 5GT3A 1P34A 4HGAC 1ID3C 4Z66B 4Z66D 5AVCB 5AVCD 3MVDB 5BO0A 3MVDD 2BYKB 3V9RA 2RVQC 3VH6T 4Z5TB 3P5JB 4H9SC 4Z5TD 3W99C 5AV5B 5AV5D 3X1UC 4R8PC 3KWQA 1ULYA 3A6NA 5CPKC 3AZKB 3AZKD 1Q9CA 3AZJC 5B0YA 3X1SA 5B24B 5B24D 2DQNC 5DNNA 4WV4B 3EPJA 1P3BC 5B1MC 4J8WC 3C1CB 3C1CD 1P3GA 4JJNA 1P3FB 1P3MA 5F99D 4EO5B 3MGRA 3NQUA 1HQ3A 2F8NG 3TU4A 2YFWB 3AZMC 1P3OA 4KHAB 3EPHA 3KWQC 4J8XA 4CSRB 4YM6A 2LY8A 1WWSA 5CP6A 2F8NB 4NE3A 2F8ND 3KSYA 4G92B 3A6NC 4H9OA 5BS7A 3AZNC 3AV1B 3WAAB 3AV1D 3WAAD 5B0YC 5G49B 3O62A 2JSSA 3B0DC 5DNNC 3AZFC 2JE5A 2Y2OA 3UT9A 3WA9B 3WKJB 3WA9D 3WKJD 1WWIA 3AV2A 1KX3D 1P3MC 1BH8B 5B1LC 1F66C 5B33B 1TZYC 5B33D 1EQZC 1KX4A 3MGRC 2NQBD 4HGAB 1ID3B 1ID3D 4XUJD 3B0CW 1N1JB 5CPIA 5B31G 3W98A 1Z2CB 5AV9A 4H9RB 3FDDA 5B2JA 3KUYA 5CP6C 4WU9C 1W2EA 4KGCA 3W99B 3W99D 3X1UB 2F8NK 3X1UD 5BT1C 4R8PB 1P3PA 5GT0D 5CHLB 3O62C 2BYMA 1JFIA 5CPKB 3UT9C 3LZ1A 3AZJB 2F8NH 3AZJD 3AV2C 4J8UC 2XD1A 1P3BB 1P3BD 5B1MB 4J8WB 5B1MD 4J8WD 3C1BC 3REKA 4AWLC 4ZUXC 4NFTA 5CPIC 5AVBA 3W98C 2AROA 3AZLD 5BO0B 3AZGA 2NZDA 5B2JC 3KUYC 3AZMB 3AZMD 2JCHA 3KWQB 3B0BA 3KWQD 4J8VA 3B6FA 2FFFB 1KU5A 4YS3A 1P3PC 5B40A 3A6NB 3A6ND 3VH6W 4DRAA 4WNNA 3AZNB 3LZ1C 3AZND 5B0YB 5B0YD 3W96D 1M1AA 3B0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNN B;  3AZF B;  5DNN D;  4WU8 A;  3AZF D;  5GSU C;  5AY8 A;  1M18 A;  1ZLA C;  3REK C;  1P3M B;  1P3M D;  5B1L B;  4X23 C;  5B1L D;  4KUD A;  5JRG A;  1F66 B;  5AVB C;  1F66 D;  1BFM A;  1EQZ B;  1TZY B;  4H9P B;  1TZY D;  1EQZ D;  3MGR B;  3NQU B;  3AZG C;  2NZD C;  5E5A A;  3X1T D;  1BH9 A;  3VH6 A;  2FJ7 C;  4E45 A;  5B2I A;  4J8V C;  5B32 D;  3B6F C;  2CV5 A;  4YS3 C;  5CP6 B;  4WU9 B;  5CP6 D;  4WU9 D;  3W97 A;  1R4V A;  4H9O B;  5BT1 D;  1H3O A;  5JA4 A;  4G91 C;  2L5A A;  1P3A A;  3O62 B;  1M1A C;  3O62 D;  4WU8 C;  3UT9 B;  3UT9 D;  1TAF A;  1M18 C;  3AN2 A;  3AV2 B;  3AV2 D;  4J8U B;  3LZ0 C;  4J8U D;  4KUD C;  5B31 C;  1P3I A;  5CPJ C;  3C1B B;  3C1B D;  1U35 C;  3WTP A;  5E5A C;  1KX5 A;  4ZUX B;  4ZUX D;  5DNM A;  5CPI B;  5CPI D;  3W98 B;  5B2I C;  5AV6 C;  2HIO A;  5B2J B;  3KUY B;  5B2J D;  3KUY D;  3UTA A;  3LJA A;  3VH5 T;  2PYO C;  4Z2M H;  5B0Z C;  5GT3 C;  1P34 C;  3KXB A;  1P3F D;  3AYW A;  1P3P B;  1P3P D;  3LEL A;  3LZ1 B;  3LZ1 D;  5BNX B;  3REH A;  3AN2 C;  2IO5 C;  3REL A;  3MNN A;  3B6G A;  4LD9 A;  3REI A;  5GSU B;  1P3I C;  5GSU D;  1A7W A;  1ZLA B;  3MGP A;  1ZLA D;  1P3K A;  3REK B;  3WTP C;  4X23 B;  4X23 D;  3MGS A;  1KX5 C;  4DRB A;  5DNM C;  5AVB B;  5AVB D;  3R45 A;  3AZG B;  3X1S C;  2NZD B;  2NZD D;  3REJ A;  1P3G C;  2FJ7 B;  2FJ7 D;  4JJN C;  4H9N A;  4J8V B;  4J8V D;  3B6F B;  3B6F D;  4YS3 B;  5GXQ A;  5KDM B;  3AZI A;  4WNN B;  1HQ3 C;  4G91 B;  3REH C;  3TU4 C;  3REL C;  3UTB A;  3B6G C;  1P3O C;  1M1A B;  1M1A D;  4WU8 B;  4LD9 C;  4WU8 D;  4J8X C;  1M18 B;  4YM6 C;  1M18 D;  2RVQ D;  1P3K C;  1AOI A;  2CWE A;  3LZ0 B;  3LZ0 D;  4XZQ A;  4Z66 A;  4KUD B;  5B31 B;  4KUD D;  5BS7 C;  5B31 D;  5AVC A;  4R8P D;  5CPJ B;  5CPJ D;  4Z5T A;  1U35 B;  1U35 D;  5AV5 A;  5E5A B;  5E5A D;  1P3L A;  5CPK D;  1BH9 B;  3WTP E;  3REJ C;  5B2I B;  5B2I D;  5FUG A;  5AV6 B;  5AV6 D;  1S32 A;  5GXQ C;  3AZI C;  4ZBJ C;  2PYO B;  2PYO D;  1KX4 C;  5JA4 B;  5B0Z B;  5B0Z D;  5GT3 B;  1P34 B;  5GT3 D;  1P34 D;  5B24 A;  5AV9 C;  3C1C A;  3V9R B;  3AN2 B;  3AN2 D;  2IO5 B;  4KGC C;  1AOI C;  5F99 A;  4XZQ C;  1B67 A;  1P3I B;  1P3I D;  3WTP B;  3WTP D;  1P3L C;  2YFV A;  4KHA A;  1KX5 B;  4CAY A;  5DNM B;  1KX5 D;  5DNM D;  4E44 A;  1HTA A;  3X1S B;  3X1S D;  1S32 C;  3WAA A;  1P3G B;  1P3G D;  4JJN B;  4JJN D;  2ARO C;  3WA9 A;  1KX3 A;  3MGR D;  3B0C T;  1HQ3 B;  1HQ3 D;  3VH5 W;  3REH B;  3REH D;  3TU4 B;  3TU4 D;  3REL B;  3REL D;  5F99 C;  3B6G B;  3AFA A;  1P3O B;  1P3O D;  3B6G D;  4LD9 B;  4J8X B;  2NQB A;  4J8X D;  4YM6 B;  4XUJ A;  4YM6 D;  1P3K B;  1P3K D;  5B40 C;  1N1J A;  5BNV A;  1B6W A;  3AZH A;  4H9Q A;  4H9R A;  3R45 B;  4NE5 A;  3W99 A;  1M19 A;  5AY8 C;  4QLC A;  3REJ B;  4H9N B;  5GT0 A;  3VH5 A;  5JRG C;  5GXQ B;  5GXQ D;  3AZI B;  4ZBJ B;  1KX4 B;  1KX3 C;  1KX4 D;  4AWL B;  5C3I C;  3AFA C;  3MGQ A;  3W98 D;  5AV9 B;  5AV9 D;  2NQB C;  2CV5 C;  4XUJ C;  3AZE A;  1AOI B;  4KGC B;  1AOI D;  3W97 C;  4KGC D;  4XZQ B;  4XZQ D;  3AZL A;  3AZH C;  1P3A C;  2BYM B;  1P3L B;  1JFI B;  4UUZ A;  3AZM A;  1P3L D;  1M19 C;  4QLC C;  5GT0 C;  5FUG B;  1S32 B;  1F1E A;  1S32 D;  3AZN A;  3REK D;  3W96 A;  3AZF A;  2ARO B;  3MGQ C;  2ARO D;  5AV8 A;  3AZG D;  2HIO C;  5B1L A;  3X1V A;  3AZE C;  5F99 B;  3UTA C;  1F66 A;  3LJA C;  3AZL C;  1EQZ A;  4H9P A;  1TZY A;  3KXB C;  3AYW C;  4YS3 D;  3X1T A;  5B40 B;  5B40 D;  3NQJ A;  2YFV B;  4CAY B;  3LEL C;  5B32 A;  4WU9 A;  3MNN C;  3REI C;  5AY8 B;  5AY8 D;  3MGP C;  2HUE C;  3W96 C;  3MGS C;  5JRG B;  5JRG D;  4WZS B;  3MVD A;  2BYK A;  1KX3 B;  5AV8 C;  4J8U A;  5C3I B;  3X1V C;  3AFA B;  3AFA D;  3C1B A;  2NQB B;  2CV5 B;  4XUJ B;  2CV5 D;  3X1T C;  4ZUX A;  3W97 B;  5BNV B;  3AZK A;  3W97 D;  3AZH B;  3AZH D;  1H3O B;  5B32 C;  4H9Q B;  3UTB C;  1P3A B;  1P3A D;  4M6B A;  1M19 B;  1M19 D;  4QLC B;  1TAF B;  4QLC D;  1P3F A;  5GT0 B;  4Z66 C;  5AVC C;  3MVD C;  5BNX A;  2YFW A;  4Z5T C;  5AV5 C;  5GSU A;  3MGQ B;  3MGQ D;  4CSR A;  1ZLA A;  2F8N A;  2HIO B;  2HIO D;  4X23 A;  3AZE B;  3AZE D;  3UTA B;  3UTA D;  3AZK C;  3LJA B;  3LJA D;  3AZL B;  3AV1 A;  4NE6 A;  5G49 A;  3KXB B;  3KXB D;  5B24 C;  3AYW B;  3AYW D;  3WKJ A;  4UUZ B;  3C1C C;  3LEL B;  3LEL D;  2FJ7 A;  1P3F C;  1BH8 A;  3MNN B;  3MNN D;  4EO5 C;  5KDM A;  3REI B;  5B33 A;  3REI D;  4LD9 D;  3MGP B;  1ID3 A;  2HUE B;  3MGP D;  3MGS B;  3W96 B;  3MGS D;  4Z2M G;  5AV8 B;  5AV8 D;  4H9S A;  3LZ0 A;  4G92 C;  3X1V B;  3X1U A;  3X1V D;  5B31 A;  4R8P A;  3AV1 C;  3WAA C;  3REJ D;  5CPJ A;  5B32 G;  1U35 A;  3X1T B;  5CPK A;  3NQJ B;  3WA9 C;  3WKJ C;  3AZI D;  3AZJ A;  5B32 B;  5AV6 A;  3UTB B;  3UTB D;  1P3B A;  5B1M A;  4J8W A;  5B33 C;  2PYO A;  5B0Z A;  5GT3 A;  1P34 A;  4HGA C;  1ID3 C;  4Z66 B;  4Z66 D;  5AVC B;  5AVC D;  3MVD B;  5BO0 A;  3MVD D;  2BYK B;  3V9R A;  2RVQ C;  3VH6 T;  4Z5T B;  4Z5T D;  4H9S C;  3W99 C;  5AV5 B;  5AV5 D;  3X1U C;  4R8P C;  3KWQ A;  1ULY A;  3A6N A;  5CPK C;  3AZK B;  3AZK D;  1Q9C A;  3AZJ C;  5B0Y A;  3X1S A;  5B24 B;  5B24 D;  5DNN A;  4WV4 B;  1P3B C;  5B1M C;  4J8W C;  3C1C B;  3C1C D;  1P3G A;  4JJN A;  1P3F B;  1P3M A;  5F99 D;  4EO5 B;  3MGR A;  3NQU A;  1HQ3 A;  2F8N G;  3TU4 A;  2YFW B;  3AZM C;  1P3O A;  4KHA B;  3KWQ C;  4J8X A;  4CSR B;  4YM6 A;  2LY8 A;  1WWS A;  5CP6 A;  2F8N B;  4NE3 A;  2F8N D;  3KSY A;  4G92 B;  3A6N C;  4H9O A;  5BS7 A;  3AZN C;  3AV1 B;  3WAA B;  3AV1 D;  3WAA D;  5B0Y C;  5G49 B;  3O62 A;  2JSS A;  3B0D C;  5DNN C;  3AZF C;  3UT9 A;  3WA9 B;  3WKJ B;  3WA9 D;  3WKJ D;  1WWI A;  3AV2 A;  1KX3 D;  1P3M C;  1BH8 B;  5B1L C;  1F66 C;  5B33 B;  1TZY C;  5B33 D;  1EQZ C;  1KX4 A;  3MGR C;  2NQB D;  4HGA B;  1ID3 B;  1ID3 D;  4XUJ D;  3B0C W;  1N1J B;  5CPI A;  5B31 G;  3W98 A;  5AV9 A;  4H9R B;  5B2J A;  3KUY A;  5CP6 C;  4WU9 C;  4KGC A;  3W99 B;  3W99 D;  3X1U B;  2F8N K;  3X1U D;  5BT1 C;  4R8P B;  1P3P A;  5GT0 D;  5CHL B;  3O62 C;  2BYM A;  1JFI A;  5CPK B;  3UT9 C;  3LZ1 A;  3AZJ B;  2F8N H;  3AZJ D;  3AV2 C;  4J8U C;  1P3B B;  1P3B D;  5B1M B;  4J8W B;  5B1M D;  4J8W D;  3C1B C;  3REK A;  4AWL C;  4ZUX C;  4NFT A;  5CPI C;  5AVB A;  3W98 C;  2ARO A;  3AZL D;  5BO0 B;  3AZG A;  2NZD A;  5B2J C;  3KUY C;  3AZM B;  3AZM D;  3KWQ B;  3B0B A;  3KWQ D;  4J8V A;  3B6F A;  1KU5 A;  4YS3 A;  1P3P C;  5B40 A;  3A6N B;  3A6N D;  3VH6 W;  4DRA A;  4WNN A;  3AZN B;  3LZ1 C;  3AZN D;  5B0Y B;  5B0Y D;  3W96 D;  1M1A A;  3B0D B; 
#chains in the Genus database with same CATH topology
 5DNN B;  3AZF B;  5DNN D;  4WU8 A;  3AZF D;  5GSU C;  5AY8 A;  1M18 A;  1ZLA C;  3REK C;  1P3M B;  1P3M D;  5B1L B;  4X23 C;  5B1L D;  4KUD A;  5JRG A;  1F66 B;  5AVB C;  1F66 D;  1BFM A;  1EQZ B;  1TZY B;  4H9P B;  1TZY D;  1EQZ D;  3MGR B;  2Y2I A;  3NQU B;  3AZG C;  2NZD C;  5E5A A;  3X1T D;  1BH9 A;  3VH6 A;  2FJ7 C;  4E45 A;  5B2I A;  4J8V C;  5B32 D;  3B6F C;  2CV5 A;  4YS3 C;  5CP6 B;  4WU9 B;  5CP6 D;  4WU9 D;  3W97 A;  1R4V A;  4H9O B;  5BT1 D;  1H3O A;  5JA4 A;  4G91 C;  2L5A A;  1P3A A;  3O62 B;  1M1A C;  2ZY3 A;  3O62 D;  4WU8 C;  3UT9 B;  3UT9 D;  1TAF A;  1M18 C;  3AN2 A;  3AV2 B;  3AV2 D;  4J8U B;  3LZ0 C;  4J8U D;  4KUD C;  5B31 C;  1P3I A;  2Y2M A;  5CPJ C;  3C1B B;  3C1B D;  1U35 C;  3WTP A;  5E5A C;  1KX5 A;  4ZUX B;  4ZUX D;  5DNM A;  5CPI B;  5CPI D;  3W98 B;  5B2I C;  2G5H C;  5AV6 C;  2HIO A;  5B2J B;  3KUY B;  5B2J D;  3KUY D;  3UTA A;  2VQR A;  3LJA A;  3VH5 T;  2PYO C;  4Z2M H;  2Y2G A;  2Y2N A;  5B0Z C;  5GT3 C;  1P34 C;  3KXB A;  1P3F D;  4DQY B;  3AYW A;  2Y2J A;  1P3P B;  1P3P D;  3LEL A;  3LZ1 B;  3LZ1 D;  5BNX B;  3REH A;  3AN2 C;  2IO5 C;  2Y2H A;  3REL A;  3A1I A;  3MNN A;  3B6G A;  4LD9 A;  3REI A;  5GSU B;  1P3I C;  5GSU D;  1A7W A;  1ZLA B;  3MGP A;  1ZLA D;  1P3K A;  3REK B;  3WTP C;  4X23 B;  4X23 D;  3MGS A;  1KX5 C;  4DRB A;  5DNM C;  5AVB B;  5AVB D;  3R45 A;  3AZG B;  3X1S C;  2NZD B;  2NZD D;  3REJ A;  1P3G C;  2FJ7 B;  2FJ7 D;  4JJN C;  4H9N A;  4J8V B;  4J8V D;  3B6F B;  3B6F D;  4YS3 B;  5GXQ A;  5KDM B;  3AZI A;  4WNN B;  1HQ3 C;  4G91 B;  3REH C;  3TU4 C;  1T3U A;  3REL C;  3UTB A;  3B6G C;  1P3O C;  1M1A B;  1M1A D;  4WU8 B;  4LD9 C;  4WU8 D;  2Y2Q A;  4J8X C;  1M18 B;  4YM6 C;  1M18 D;  2RVQ D;  2XD5 A;  1P3K C;  1AOI A;  2CWE A;  3LZ0 B;  3LZ0 D;  4XZQ A;  3H0L C;  4Z66 A;  4KUD B;  5B31 B;  4KUD D;  5BS7 C;  5B31 D;  5AVC A;  4R8P D;  5CPJ B;  5CPJ D;  4Z5T A;  1U35 B;  1U35 D;  5AV5 A;  5E5A B;  5E5A D;  1P3L A;  5CPK D;  1BH9 B;  3WTP E;  3REJ C;  5B2I B;  5B2I D;  2ZY5 A;  5FUG A;  5AV6 B;  5AV6 D;  1S32 A;  5GXQ C;  4UPK A;  3AZI C;  4ZBJ C;  2PYO B;  2PYO D;  1KX4 C;  5JA4 B;  5B0Z B;  5B0Z D;  5GT3 B;  1P34 B;  5GT3 D;  1P34 D;  5B24 A;  5AV9 C;  3H0R C;  2ZY4 A;  3C1C A;  3V9R B;  3AN2 B;  3AN2 D;  2IO5 B;  4KGC C;  1AOI C;  5F99 A;  4XZQ C;  1B67 A;  1P3I B;  1P3I D;  2ZM5 A;  3KFU G;  3WTP B;  3WTP D;  1P3L C;  2YFV A;  4KHA A;  1KX5 B;  4CAY A;  5DNM B;  1KX5 D;  5DNM D;  4E44 A;  2F2A C;  1HTA A;  3X1S B;  3X1S D;  1S32 C;  3WAA A;  1P3G B;  2Y2K A;  1P3G D;  4JJN B;  4JJN D;  2ARO C;  3WA9 A;  1KX3 A;  3MGR D;  3B0C T;  1HQ3 B;  1HQ3 D;  3VH5 W;  3REH B;  3REH D;  3TU4 B;  3A1K A;  3REL B;  3TU4 D;  3REL D;  5F99 C;  3B6G B;  3AFA A;  1P3O B;  1P3O D;  3B6G D;  4LD9 B;  4J8X B;  2NQB A;  4J8X D;  4YM6 B;  4XUJ A;  4YM6 D;  1P3K B;  1P3K D;  5B40 C;  1N1J A;  5BNV A;  1B6W A;  3AZH A;  3F6T A;  4H9Q A;  4H9R A;  3R45 B;  3H0M C;  4NE5 A;  3W99 A;  1M19 A;  5AY8 C;  4QLC A;  3REJ B;  3IP4 C;  4H9N B;  5GT0 A;  3VH5 A;  5JRG C;  5GXQ B;  5GXQ D;  3AZI B;  4ZBJ B;  1KX4 B;  1KX3 C;  1KX4 D;  4AWL B;  5C3I C;  3AFA C;  3MGQ A;  3W98 D;  5AV9 B;  5AV9 D;  2NQB C;  2CV5 C;  4XUJ C;  3AZE A;  1AOI B;  4KGC B;  1AOI D;  3W97 C;  4KGC D;  4XZQ B;  4XZQ D;  3AZL A;  3AZH C;  1P3A C;  2BYM B;  1P3L B;  1JFI B;  4UUZ A;  3AZM A;  1P3L D;  1M19 C;  2G5I C;  4QLC C;  2Y2P A;  3EG5 B;  3AL0 C;  5GT0 C;  5FUG B;  1S32 B;  1F1E A;  1S32 D;  4WJ3 C;  3AZN A;  3REK D;  2UWX A;  3W96 A;  3AZF A;  2BG1 A;  2ARO B;  3MGQ C;  2ARO D;  5AV8 A;  3AZG D;  2HIO C;  5B1L A;  3X1V A;  2W8S A;  3AZE C;  5F99 B;  3UTA C;  1F66 A;  3LJA C;  3AZL C;  1EQZ A;  4H9P A;  1TZY A;  3KXB C;  3AYW C;  2J8P A;  4YS3 D;  3X1T A;  5B40 B;  5B40 D;  3NQJ A;  2YFV B;  4CAY B;  3LEL C;  5B32 A;  2ZY2 A;  4WU9 A;  3MNN C;  3REI C;  5AY8 B;  5AY8 D;  3MGP C;  2HUE C;  3EPK A;  3W96 C;  3MGS C;  5JRG B;  5JRG D;  4WZS B;  3MVD A;  2BYK A;  1KX3 B;  5AV8 C;  4J8U A;  5C3I B;  3X1V C;  3AFA B;  3AFA D;  1PZR A;  3C1B A;  2NQB B;  2CV5 B;  4XUJ B;  2DF4 C;  2CV5 D;  3X1T C;  4ZUX A;  3W97 B;  5BNV B;  3AZK A;  3W97 D;  3AZH B;  3AZH D;  1H3O B;  5B32 C;  4H9Q B;  3UTB C;  1P3A B;  1P3A D;  4M6B A;  1M19 B;  1M19 D;  1TAF B;  4QLC B;  4QLC D;  1P3F A;  5GT0 B;  2RIQ A;  4Z66 C;  5AVC C;  3MVD C;  5BNX A;  2YFW A;  4Z5T C;  5AV5 C;  5GSU A;  3MGQ B;  3MGQ D;  4CSR A;  1ZLA A;  3EPL A;  2F8N A;  2HIO B;  2HIO D;  4X23 A;  3AZE B;  3AZE D;  3UTA B;  3UTA D;  3AZK C;  3LJA B;  3LJA D;  3AZL B;  3AV1 A;  4NE6 A;  5G49 A;  3KXB B;  3KXB D;  5B24 C;  3AYW B;  3AYW D;  3WKJ A;  4UUZ B;  3C1C C;  3LEL B;  3LEL D;  2FJ7 A;  1P3F C;  1BH8 A;  3MNN B;  3MNN D;  4EO5 C;  5KDM A;  3REI B;  5B33 A;  3REI D;  4LD9 D;  3MGP B;  1ID3 A;  2HUE B;  3MGP D;  3MGS B;  3W96 B;  3MGS D;  4Z2M G;  5AV8 B;  5AV8 D;  2Y2L A;  4H9S A;  3LZ0 A;  4G92 C;  3X1V B;  3X1U A;  3X1V D;  5B31 A;  4R8P A;  3AV1 C;  3WAA C;  3REJ D;  5CPJ A;  5B32 G;  1U35 A;  3X1T B;  5CPK A;  3NQJ B;  3WA9 C;  3WKJ C;  3AZI D;  3AZJ A;  5B32 B;  5AV6 A;  3UTB B;  3UTB D;  1P3B A;  5B1M A;  4J8W A;  5B33 C;  2PYO A;  5B0Z A;  5GT3 A;  1P34 A;  4HGA C;  1ID3 C;  4Z66 B;  4Z66 D;  5AVC B;  5AVC D;  3MVD B;  5BO0 A;  3MVD D;  2BYK B;  3V9R A;  2RVQ C;  3VH6 T;  4Z5T B;  3P5J B;  4H9S C;  4Z5T D;  3W99 C;  5AV5 B;  5AV5 D;  3X1U C;  4R8P C;  3KWQ A;  1ULY A;  3A6N A;  5CPK C;  3AZK B;  3AZK D;  1Q9C A;  3AZJ C;  5B0Y A;  3X1S A;  5B24 B;  5B24 D;  2DQN C;  5DNN A;  4WV4 B;  3EPJ A;  1P3B C;  5B1M C;  4J8W C;  3C1C B;  3C1C D;  1P3G A;  4JJN A;  1P3F B;  1P3M A;  5F99 D;  4EO5 B;  3MGR A;  3NQU A;  1HQ3 A;  2F8N G;  3TU4 A;  2YFW B;  3AZM C;  1P3O A;  4KHA B;  3EPH A;  3KWQ C;  4J8X A;  4CSR B;  4YM6 A;  2LY8 A;  1WWS A;  5CP6 A;  2F8N B;  4NE3 A;  2F8N D;  3KSY A;  4G92 B;  3A6N C;  4H9O A;  5BS7 A;  3AZN C;  3AV1 B;  3WAA B;  3AV1 D;  3WAA D;  5B0Y C;  5G49 B;  3O62 A;  2JSS A;  3B0D C;  5DNN C;  3AZF C;  2JE5 A;  2Y2O A;  3UT9 A;  3WA9 B;  3WKJ B;  3WA9 D;  3WKJ D;  1WWI A;  3AV2 A;  1KX3 D;  1P3M C;  1BH8 B;  5B1L C;  1F66 C;  5B33 B;  1TZY C;  5B33 D;  1EQZ C;  1KX4 A;  3MGR C;  2NQB D;  4HGA B;  1ID3 B;  1ID3 D;  4XUJ D;  3B0C W;  1N1J B;  5CPI A;  5B31 G;  3W98 A;  1Z2C B;  5AV9 A;  4H9R B;  3FDD A;  5B2J A;  3KUY A;  5CP6 C;  4WU9 C;  1W2E A;  4KGC A;  3W99 B;  3W99 D;  3X1U B;  2F8N K;  3X1U D;  5BT1 C;  4R8P B;  1P3P A;  5GT0 D;  5CHL B;  3O62 C;  2BYM A;  1JFI A;  5CPK B;  3UT9 C;  3LZ1 A;  3AZJ B;  2F8N H;  3AZJ D;  3AV2 C;  4J8U C;  2XD1 A;  1P3B B;  1P3B D;  5B1M B;  4J8W B;  5B1M D;  4J8W D;  3C1B C;  3REK A;  4AWL C;  4ZUX C;  4NFT A;  5CPI C;  5AVB A;  3W98 C;  2ARO A;  3AZL D;  5BO0 B;  3AZG A;  2NZD A;  5B2J C;  3KUY C;  3AZM B;  3AZM D;  2JCH A;  3KWQ B;  3B0B A;  3KWQ D;  4J8V A;  3B6F A;  2FFF B;  1KU5 A;  4YS3 A;  1P3P C;  5B40 A;  3A6N B;  3A6N D;  3VH6 W;  4DRA A;  4WNN A;  3AZN B;  3LZ1 C;  3AZN D;  5B0Y B;  5B0Y D;  3W96 D;  1M1A A;  3B0D B; 
#chains in the Genus database with same CATH homology
 5DNN B;  3AZF B;  5DNN D;  4WU8 A;  3AZF D;  5GSU C;  5AY8 A;  1M18 A;  1ZLA C;  3REK C;  1P3M B;  1P3M D;  5B1L B;  4X23 C;  5B1L D;  4KUD A;  5JRG A;  1F66 B;  5AVB C;  1F66 D;  1BFM A;  1EQZ B;  1TZY B;  4H9P B;  1TZY D;  1EQZ D;  3MGR B;  2Y2I A;  3NQU B;  3AZG C;  2NZD C;  5E5A A;  3X1T D;  1BH9 A;  3VH6 A;  2FJ7 C;  4E45 A;  5B2I A;  4J8V C;  5B32 D;  3B6F C;  2CV5 A;  4YS3 C;  5CP6 B;  4WU9 B;  5CP6 D;  4WU9 D;  3W97 A;  1R4V A;  4H9O B;  5BT1 D;  1H3O A;  5JA4 A;  4G91 C;  2L5A A;  1P3A A;  3O62 B;  1M1A C;  2ZY3 A;  3O62 D;  4WU8 C;  3UT9 B;  3UT9 D;  1TAF A;  1M18 C;  3AN2 A;  3AV2 B;  3AV2 D;  4J8U B;  3LZ0 C;  4J8U D;  4KUD C;  5B31 C;  1P3I A;  2Y2M A;  5CPJ C;  3C1B B;  3C1B D;  1U35 C;  3WTP A;  5E5A C;  1KX5 A;  4ZUX B;  4ZUX D;  5DNM A;  5CPI B;  5CPI D;  3W98 B;  5B2I C;  2G5H C;  5AV6 C;  2HIO A;  5B2J B;  3KUY B;  5B2J D;  3KUY D;  3UTA A;  2VQR A;  3LJA A;  3VH5 T;  2PYO C;  4Z2M H;  2Y2G A;  2Y2N A;  5B0Z C;  5GT3 C;  1P34 C;  3KXB A;  1P3F D;  4DQY B;  3AYW A;  2Y2J A;  1P3P B;  1P3P D;  3LEL A;  3LZ1 B;  3LZ1 D;  5BNX B;  3REH A;  3AN2 C;  2IO5 C;  2Y2H A;  3REL A;  3A1I A;  3MNN A;  3B6G A;  4LD9 A;  3REI A;  5GSU B;  1P3I C;  5GSU D;  1A7W A;  1ZLA B;  3MGP A;  1ZLA D;  1P3K A;  3REK B;  3WTP C;  4X23 B;  4X23 D;  3MGS A;  1KX5 C;  4DRB A;  5DNM C;  5AVB B;  5AVB D;  3R45 A;  3AZG B;  3X1S C;  2NZD B;  2NZD D;  3REJ A;  1P3G C;  2FJ7 B;  2FJ7 D;  4JJN C;  4H9N A;  4J8V B;  4J8V D;  3B6F B;  3B6F D;  4YS3 B;  5GXQ A;  5KDM B;  3AZI A;  4WNN B;  1HQ3 C;  4G91 B;  3REH C;  3TU4 C;  1T3U A;  3REL C;  3UTB A;  3B6G C;  1P3O C;  1M1A B;  1M1A D;  4WU8 B;  4LD9 C;  4WU8 D;  2Y2Q A;  4J8X C;  1M18 B;  4YM6 C;  1M18 D;  2RVQ D;  2XD5 A;  1P3K C;  1AOI A;  2CWE A;  3LZ0 B;  3LZ0 D;  4XZQ A;  3H0L C;  4Z66 A;  4KUD B;  5B31 B;  4KUD D;  5BS7 C;  5B31 D;  5AVC A;  4R8P D;  5CPJ B;  5CPJ D;  4Z5T A;  1U35 B;  1U35 D;  5AV5 A;  5E5A B;  5E5A D;  1P3L A;  5CPK D;  1BH9 B;  3WTP E;  3REJ C;  5B2I B;  5B2I D;  2ZY5 A;  5FUG A;  5AV6 B;  5AV6 D;  1S32 A;  5GXQ C;  4UPK A;  3AZI C;  4ZBJ C;  2PYO B;  2PYO D;  1KX4 C;  5JA4 B;  5B0Z B;  5B0Z D;  5GT3 B;  1P34 B;  5GT3 D;  1P34 D;  5B24 A;  5AV9 C;  3H0R C;  2ZY4 A;  3C1C A;  3V9R B;  3AN2 B;  3AN2 D;  2IO5 B;  4KGC C;  1AOI C;  5F99 A;  4XZQ C;  1B67 A;  1P3I B;  1P3I D;  2ZM5 A;  3KFU G;  3WTP B;  3WTP D;  1P3L C;  2YFV A;  4KHA A;  1KX5 B;  4CAY A;  5DNM B;  1KX5 D;  5DNM D;  4E44 A;  2F2A C;  1HTA A;  3X1S B;  3X1S D;  1S32 C;  3WAA A;  1P3G B;  2Y2K A;  1P3G D;  4JJN B;  4JJN D;  2ARO C;  3WA9 A;  1KX3 A;  3MGR D;  3B0C T;  1HQ3 B;  1HQ3 D;  3VH5 W;  3REH B;  3REH D;  3TU4 B;  3A1K A;  3REL B;  3TU4 D;  3REL D;  5F99 C;  3B6G B;  3AFA A;  1P3O B;  1P3O D;  3B6G D;  4LD9 B;  4J8X B;  2NQB A;  4J8X D;  4YM6 B;  4XUJ A;  4YM6 D;  1P3K B;  1P3K D;  5B40 C;  1N1J A;  5BNV A;  1B6W A;  3AZH A;  3F6T A;  4H9Q A;  4H9R A;  3R45 B;  3H0M C;  4NE5 A;  3W99 A;  1M19 A;  5AY8 C;  4QLC A;  3REJ B;  3IP4 C;  4H9N B;  5GT0 A;  3VH5 A;  5JRG C;  5GXQ B;  5GXQ D;  3AZI B;  4ZBJ B;  1KX4 B;  1KX3 C;  1KX4 D;  4AWL B;  5C3I C;  3AFA C;  3MGQ A;  3W98 D;  5AV9 B;  5AV9 D;  2NQB C;  2CV5 C;  4XUJ C;  3AZE A;  1AOI B;  4KGC B;  1AOI D;  3W97 C;  4KGC D;  4XZQ B;  4XZQ D;  3AZL A;  3AZH C;  1P3A C;  2BYM B;  1P3L B;  1JFI B;  4UUZ A;  3AZM A;  1P3L D;  1M19 C;  2G5I C;  4QLC C;  2Y2P A;  3EG5 B;  3AL0 C;  5GT0 C;  5FUG B;  1S32 B;  1F1E A;  1S32 D;  4WJ3 C;  3AZN A;  3REK D;  2UWX A;  3W96 A;  3AZF A;  2BG1 A;  2ARO B;  3MGQ C;  2ARO D;  5AV8 A;  3AZG D;  2HIO C;  5B1L A;  3X1V A;  2W8S A;  3AZE C;  5F99 B;  3UTA C;  1F66 A;  3LJA C;  3AZL C;  1EQZ A;  4H9P A;  1TZY A;  3KXB C;  3AYW C;  2J8P A;  4YS3 D;  3X1T A;  5B40 B;  5B40 D;  3NQJ A;  2YFV B;  4CAY B;  3LEL C;  5B32 A;  2ZY2 A;  4WU9 A;  3MNN C;  3REI C;  5AY8 B;  5AY8 D;  3MGP C;  2HUE C;  3EPK A;  3W96 C;  3MGS C;  5JRG B;  5JRG D;  4WZS B;  3MVD A;  2BYK A;  1KX3 B;  5AV8 C;  4J8U A;  5C3I B;  3X1V C;  3AFA B;  3AFA D;  1PZR A;  3C1B A;  2NQB B;  2CV5 B;  4XUJ B;  2DF4 C;  2CV5 D;  3X1T C;  4ZUX A;  3W97 B;  5BNV B;  3AZK A;  3W97 D;  3AZH B;  3AZH D;  1H3O B;  5B32 C;  4H9Q B;  3UTB C;  1P3A B;  1P3A D;  4M6B A;  1M19 B;  1M19 D;  1TAF B;  4QLC B;  4QLC D;  1P3F A;  5GT0 B;  2RIQ A;  4Z66 C;  5AVC C;  3MVD C;  5BNX A;  2YFW A;  4Z5T C;  5AV5 C;  5GSU A;  3MGQ B;  3MGQ D;  4CSR A;  1ZLA A;  3EPL A;  2F8N A;  2HIO B;  2HIO D;  4X23 A;  3AZE B;  3AZE D;  3UTA B;  3UTA D;  3AZK C;  3LJA B;  3LJA D;  3AZL B;  3AV1 A;  4NE6 A;  5G49 A;  3KXB B;  3KXB D;  5B24 C;  3AYW B;  3AYW D;  3WKJ A;  4UUZ B;  3C1C C;  3LEL B;  3LEL D;  2FJ7 A;  1P3F C;  1BH8 A;  3MNN B;  3MNN D;  4EO5 C;  5KDM A;  3REI B;  5B33 A;  3REI D;  4LD9 D;  3MGP B;  1ID3 A;  2HUE B;  3MGP D;  3MGS B;  3W96 B;  3MGS D;  4Z2M G;  5AV8 B;  5AV8 D;  2Y2L A;  4H9S A;  3LZ0 A;  4G92 C;  3X1V B;  3X1U A;  3X1V D;  5B31 A;  4R8P A;  3AV1 C;  3WAA C;  3REJ D;  5CPJ A;  5B32 G;  1U35 A;  3X1T B;  5CPK A;  3NQJ B;  3WA9 C;  3WKJ C;  3AZI D;  3AZJ A;  5B32 B;  5AV6 A;  3UTB B;  3UTB D;  1P3B A;  5B1M A;  4J8W A;  5B33 C;  2PYO A;  5B0Z A;  5GT3 A;  1P34 A;  4HGA C;  1ID3 C;  4Z66 B;  4Z66 D;  5AVC B;  5AVC D;  3MVD B;  5BO0 A;  3MVD D;  2BYK B;  3V9R A;  2RVQ C;  3VH6 T;  4Z5T B;  3P5J B;  4H9S C;  4Z5T D;  3W99 C;  5AV5 B;  5AV5 D;  3X1U C;  4R8P C;  3KWQ A;  1ULY A;  3A6N A;  5CPK C;  3AZK B;  3AZK D;  1Q9C A;  3AZJ C;  5B0Y A;  3X1S A;  5B24 B;  5B24 D;  2DQN C;  5DNN A;  4WV4 B;  3EPJ A;  1P3B C;  5B1M C;  4J8W C;  3C1C B;  3C1C D;  1P3G A;  4JJN A;  1P3F B;  1P3M A;  5F99 D;  4EO5 B;  3MGR A;  3NQU A;  1HQ3 A;  2F8N G;  3TU4 A;  2YFW B;  3AZM C;  1P3O A;  4KHA B;  3EPH A;  3KWQ C;  4J8X A;  4CSR B;  4YM6 A;  2LY8 A;  1WWS A;  5CP6 A;  2F8N B;  4NE3 A;  2F8N D;  3KSY A;  4G92 B;  3A6N C;  4H9O A;  5BS7 A;  3AZN C;  3AV1 B;  3WAA B;  3AV1 D;  3WAA D;  5B0Y C;  5G49 B;  3O62 A;  2JSS A;  3B0D C;  5DNN C;  3AZF C;  2JE5 A;  2Y2O A;  3UT9 A;  3WA9 B;  3WKJ B;  3WA9 D;  3WKJ D;  1WWI A;  3AV2 A;  1KX3 D;  1P3M C;  1BH8 B;  5B1L C;  1F66 C;  5B33 B;  1TZY C;  5B33 D;  1EQZ C;  1KX4 A;  3MGR C;  2NQB D;  4HGA B;  1ID3 B;  1ID3 D;  4XUJ D;  3B0C W;  1N1J B;  5CPI A;  5B31 G;  3W98 A;  1Z2C B;  5AV9 A;  4H9R B;  3FDD A;  5B2J A;  3KUY A;  5CP6 C;  4WU9 C;  1W2E A;  4KGC A;  3W99 B;  3W99 D;  3X1U B;  2F8N K;  3X1U D;  5BT1 C;  4R8P B;  1P3P A;  5GT0 D;  5CHL B;  3O62 C;  2BYM A;  1JFI A;  5CPK B;  3UT9 C;  3LZ1 A;  3AZJ B;  2F8N H;  3AZJ D;  3AV2 C;  4J8U C;  2XD1 A;  1P3B B;  1P3B D;  5B1M B;  4J8W B;  5B1M D;  4J8W D;  3C1B C;  3REK A;  4AWL C;  4ZUX C;  4NFT A;  5CPI C;  5AVB A;  3W98 C;  2ARO A;  3AZL D;  5BO0 B;  3AZG A;  2NZD A;  5B2J C;  3KUY C;  3AZM B;  3AZM D;  2JCH A;  3KWQ B;  3B0B A;  3KWQ D;  4J8V A;  3B6F A;  2FFF B;  1KU5 A;  4YS3 A;  1P3P C;  5B40 A;  3A6N B;  3A6N D;  3VH6 W;  4DRA A;  4WNN A;  3AZN B;  3LZ1 C;  3AZN D;  5B0Y B;  5B0Y D;  3W96 D;  1M1A A;  3B0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...