3WTPB

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpB00
3A6ND 4HGAC 4H9RA 3LJAC 4YS3D 3AYWD 5AV6D 3UT9A 3MGPD 3AFAA 5G49A 5JA4A 5AV9A 5CP6B 4XZQB 3WTPA 2FJ7D 5GT0C 5B2IB 3TU4A 4Z66A 2F8NK 3REJA 3MGQC 1U35A 5B0YA 3VH6T 2PYOC 2YFWA 4EO5B 4CAYA 3VH5A 3UTAD 1P34A 3W96C 5GXQA 1H3OA 3AV2D 5B40D 1S32B 3WA9B 3X1UD 3WKJC 4G91B 4YM6A 4Z5TB 3W99C 2BYMB 2AROD 3B0DC 4H9SC 4ZUXC 3AZKC 4LD9A 2RVQC 1JFIA 3X1SD 1P3LB 3W97B 2HIOD 5AV5C 3AZEA 5GT3A 3B6FC 4H9PB 2F8NB 1ULYA 3O62C 3AZJB 5CPJB 4H9QA 5C3IB 1M18B 5B31B 1TAFB 5AV8C 5BT1D 1EQZC 4R8PD 3B6GB 1HQ3C 3A6NB 2YFVA 3AZGA 3REIC 1B67A 3AZIB 5B24D 4J8XC 2NQBD 3LZ1A 3AYWB 4KGCA 5B1MA 3C1BC 1P3BD 3KXBB 3LZ0A 1N1JA 3KWQD 3KUYB 4J8WD 3RELC 3AZFA 4KUDD 1ZLAA 4WU8B 5BNVB 1M1AD 1F66C 3MVDD 3REKA 3AZHA 1P3FD 5GSUD 1P3MA 5B2JA 3X1VD 3LJAA 1AOIB 4NE3A 5CPIB 4AWLB 2NZDD 2FJ7B 1P3AA 3C1CB 5B32D 4X23C 5B33B 1KX3A 3X1TB 3AN2C 3UTAB 4XUJA 3AV2B 5AVBC 4JJNC 3X1UB 1M19B 3UTBD 1BH8A 5GT0A 4WU9B 1P3IC 2AROB 5DNNA 5CPKA 5B0YC 3X1SB 4G92B 3AZNB 2CWEA 2PYOA 4J8VD 5E5AD 1P3PC 3W96A 4J8UC 3REHC 1P3OB 3NQUB 4KHAB 5B1LB 1B6WA 2BYKA 3WKJA 5B2ID 4R8PB 2JSSA 4YS3C 4ZUXA 3AZKA 1P3GC 5AV6C 4HGAB 5AV5A 3B6FA 2NQBB 3LELD 3MGPC 3O62A 4E45A 5BO0B 2CV5C 3WA9D 1KX4A 5AV8A 4Z5TD 1TZYB 3MVDB 3MGSD 1HQ3A 2HUEB 3AZGC 3REIA 5AY8B 2F8ND 4WZSB 4UUZA 3AZJD 5B0ZB 5CPJD 3UT9D 5B32B 1F66A 3B6GD 1A7WA 5B2JC 3MNNB 5AVCB 3AFAD 3MGQB 3AZID 1ID3B 3KXBD 3KUYD 5KDMA 5JRGC 1P3AC 1HTAA 4WU8D 3UTBB 2HIOC 3WAAC 5FUGA 3AV1B 4X23A 3TU4D 3W99B 1KX3C 3REJD 4CSRA 4Z2MG 3AN2A 1AOID 4J8VB 5E5AB 5CPID 4XUJC 1R4VA 5AVBA 1P3KB 4QLCB 4JJNA 4WV4B 3C1CD 5B24C 1P3IA 1WWIA 5DNNC 5CPKC 5B33D 3X1TD 3W98B 3KWQC 4J8XB 5BS7C 4Z2MH 3MGRC 3LELB 1P3PA 1KX5B 1P3FC 3C1BB 3NQJA 5GSUC 4NE5A 4J8UA 3REHA 1M19D 3RELB 3X1VC 5DNMB 4WU9D 5F99C 4YS3A 3MGSB 1P3GA 5AV6A 1BH9A 4H9RB 2NZDC 3AZND 3AZLC 3MGPA 3LZ0D 3AZMD 1P3MC 1P3OD 2CV5A 1KX4C 5B1LD 3UT9B 3REKD 3AFAB 5G49B 5JA4B 5AV9B 2FJ7A 3LJAD 2LY8A 3WTPB 5BNXA 1TZYD 3TU4B 4Z66B 5CP6C 4XZQC 3REJB 1U35B 5B40A 2YFWB 4CAYB 4DRBA 5AY8D 5B2IC 1P34B 5GXQB 1H3OB 2AROA 5B0ZD 4WNNA 5JRGA 3R45A 2HIOA 4EO5C 4YM6B 3WAAA 4LD9B 1JFIB 4ZBJB 3MNND 5AVCD 3MGQD 1S32C 3AZEB 1ID3D 5GT3B 4Z5TC 4H9QB 3V9RA 1P3LC 3W97C 3AV1D 5B24A 3W99D 3AZKD 2RVQD 2YFVB 3AZJC 1P3BA 3AZGB 5C3IC 3KWQA 4J8WA 4KUDA 1M18C 3LZ1B 5B31C 5BS7A 4H9NA 3MGRA 4KGCB 5B1MB 1M1AA 1P3KD 1P3FA 4QLCD 3LZ0B 5GSUA 1N1JB 3A6NC 3AZFB 3AZMB 3X1VA 1ZLAB 3AZIC 5AV8D 1EQZD 5F99A 3AYWC 5B31G 3REKB 3AZHB 1P3MB 4H9OA 1KU5A 5B2JB 3KXBC 3W98D 2NZDA 3LJAB 4J8XD 3VH5W 3AZLA 1KX5D 3C1BD 3RELD 5DNMD 2F8NH 5CPIC 1KX3B 2FJ7C 4NFTA 5B33C 3X1TC 1BH8B 5GT0B 3UTAC 5DNNB 5CP6A 5CPKB 4XZQA 3AV2C 5B40C 5AV9D 2PYOB 3X1UC 1M19C 4WU9C 5B2IA 2AROC 3W96B 5AVBD 3WTPD 3X1SC 4G92C 3WKJB 2BYKB 3AZNC 3B0DB 4Z66D 4ZUXB 3AZKB 3B0BA 1U35D 5B0YD 1S32A 3B0CW 5AV5B 3B6FB 3WA9A 5B1LC 1P34D 1P3PD 5BT1C 4Z5TA 4R8PC 2BYMA 5GXQD 3O62B 3REHD 1KX4B 3VH6A 1P3LA 3W97A 5AV8B 4YM6D 2NQBC 1EQZB 2IO5C 4H9PA 4LD9D 1P3GD 1HQ3B 2F8NA 1P3BC 3AZJA 5CPJA 3REIB 3AZED 4J8WC 4KUDC 5GT3D 1M18A 1F1EA 5B31A 1TAFA 1BFMA 1TZYC 1M1AC 4UUZB 3MVDC 3B6GA 2HUEC 4DRAA 3A6NA 2CV5D 3AZIA 1F66B 3AYWA 5AY8C 5B0ZC 3AZGD 3KXBA 3KUYA 3LZ1D 4WU8A 4KGCD 5B32C 5B1MD 5BNVA 3AZFD 5KDMB 3MNNC 5AVCC 1ZLAD 1ID3C 5FUGB 4X23B 1AOIA 3AZHD 1P3MD 5CPIA 5B32G 5B2JD 4CSRB 1WWSA 3AN2B 3VH5T 3UTBC 3C1CA 3AV1C 5AVBB 4JJNB 5B33A 3X1TA 1P3AD 5JRGD 3WAAD 1P3IB 2L5AA 4J8VC 5E5AC 3UTAA 1KX3D 3AV2A 1P3KC 5B0YB 4QLCC 3X1UA 1M19A 4WU9A 1P3PB 4XUJD 4J8UB 3NQJB 3REHB 3X1SA 3W98C 5GT0D 3AZNA 4YS3B 5DNND 3LELC 5CPKD 1P3GB 5AV6B 1BH9B 1KX5C 2PYOD 3AZMA 1P3OA 3WA9C 3NQUA 4KHAA 5B1LA 5DNMC 4G91C 3MGRD 3W96D 4R8PA 3MGPB 3MGSC 2CV5B 3WKJD 2NQBA 5F99D 4ZUXD 5CPJC 3B0CT 5BO0A 5AV5D 3B6FD 3UT9C 3AZLD 1TZYA 3B6GC 3MVDA 3O62D 2F8NG 1KX4D 3AFAC 5AV9C 3VH6W 5BNXB 5CHLB 5AY8A 1HQ3D 5B0ZA 3WTPC 3KUYC 5B40B 3REID 4WU8C 4E44A 5B32A 3TU4C 4Z66C 3REJC 1Q9CA 4WNNB 5JRGB 3R45B 5AVCA 3MNNA 3MGQA 1U35C 1P3AB 1ID3A 2HIOB 3WAAB 1AOIC 1F66D 1P34C 5CP6D 4AWLC 4NE6A 5GXQC 4XZQD 3C1CC 3UTBA 4YM6C 3AV1A 4XUJB 3W99A 4H9SA 4LD9C 4ZBJC 3V9RB 3KSYA 3AZEC 5GT3C 3WTPE 5B24B 4X23D 2IO5B 5E5AA 4J8VA 1P3KA 4M6BA 4QLCA 1P3BB 3KWQB 1S32D 4J8WB 4KUDB 3AN2D 3MGRB 4H9NB 1M1AB 1EQZA 1P3FB 4JJND 5GSUB 3X1VB 1P3LD 3W98A 3W97D 1P3ID 3LZ1C 5F99B 4J8XA 4KGCC 3LELA 5B1MC 4H9OB 1KX5A 3LZ0C 3C1BA 3AZHC 3AZFC 3AZMC 1P3OC 2NZDB 3RELA 5DNMA 1M18D 1ZLAC 5B31D 3AZLB 3REKC 4J8UD 3MGSA
chains in the Genus database with same CATH superfamily
3A6ND 4HGAC 4H9RA 2XD5A 3LJAC 2Y2HA 4YS3D 3AYWD 5AV6D 3UT9A 3MGPD 3AFAA 5G49A 5JA4A 2ZY5A 5AV9A 5CP6B 2ZY2A 4XZQB 3WTPA 2FJ7D 2Y2MA 5GT0C 5B2IB 3TU4A 4Z66A 2F8NK 3REJA 3MGQC 4DQYB 5B0YA 1U35A 3VH6T 2PYOC 2YFWA 4EO5B 4CAYA 3VH5A 3UTAD 1P34A 4WJ3C 3W96C 5GXQA 1H3OA 3AV2D 5B40D 1S32B 3WA9B 3X1UD 3WKJC 2JE5A 2Y2LA 4G91B 4YM6A 4Z5TB 3W99C 2BYMB 2AROD 3B0DC 4H9SC 4ZUXC 3AZKC 4LD9A 2RVQC 1JFIA 3X1SD 3EPLA 1P3LB 3W97B 2HIOD 5AV5C 3AZEA 5GT3A 3B6FC 4H9PB 2F8NB 1ULYA 3O62C 3AZJB 2Y2IA 5CPJB 4H9QA 5C3IB 1M18B 5B31B 1TAFB 5AV8C 5BT1D 1EQZC 4R8PD 3B6GB 1HQ3C 3A6NB 2YFVA 3AZGA 3REIC 1B67A 3AZIB 5B24D 4J8XC 2NQBD 3LZ1A 3AYWB 4KGCA 5B1MA 3C1BC 1P3BD 3KXBB 3LZ0A 1N1JA 3KWQD 3KUYB 4J8WD 3RELC 3AZFA 4KUDD 1ZLAA 4WU8B 5BNVB 1M1AD 1F66C 3MVDD 3REKA 3AZHA 1P3FD 5GSUD 1P3MA 5B2JA 3X1VD 3LJAA 4UPKA 1AOIB 4NE3A 5CPIB 4AWLB 3EG5B 2NZDD 2FJ7B 1P3AA 3C1CB 5B32D 4X23C 3A1IA 5B33B 1KX3A 3X1TB 3AN2C 3UTAB 2G5IC 4XUJA 3AV2B 5AVBC 4JJNC 3X1UB 1M19B 3UTBD 1BH8A 5GT0A 4WU9B 1P3IC 2AROB 3FDDA 5DNNA 5CPKA 5B0YC 3X1SB 4G92B 3AZNB 2CWEA 2PYOA 3H0MC 4J8VD 5E5AD 1P3PC 3W96A 4J8UC 3REHC 1P3OB 3NQUB 4KHAB 5B1LB 1B6WA 2BYKA 3WKJA 5B2ID 2JSSA 4R8PB 4YS3C 4ZUXA 3AZKA 1P3GC 5AV6C 4HGAB 5AV5A 3B6FA 2NQBB 3LELD 3MGPC 3O62A 4E45A 5BO0B 2CV5C 3WA9D 1KX4A 5AV8A 4Z5TD 1TZYB 2F2AC 3MVDB 3MGSD 1HQ3A 2HUEB 3AZGC 2Y2PA 3REIA 5AY8B 2F8ND 4WZSB 4UUZA 3AZJD 5B0ZB 5CPJD 3UT9D 5B32B 1F66A 3B6GD 1A7WA 5B2JC 3MNNB 5AVCB 3AFAD 3MGQB 3AZID 1ID3B 3KXBD 3KUYD 5KDMA 5JRGC 1P3AC 1HTAA 4WU8D 3UTBB 2HIOC 3WAAC 5FUGA 3AV1B 4X23A 3TU4D 3W99B 1KX3C 3REJD 4CSRA 4Z2MG 3AN2A 1AOID 4J8VB 5E5AB 5CPID 4XUJC 1R4VA 5AVBA 1P3KB 4QLCB 4JJNA 4WV4B 3C1CD 5B24C 1P3IA 1WWIA 5DNNC 5CPKC 5B33D 3X1TD 3W98B 3KWQC 4J8XB 5BS7C 4Z2MH 3MGRC 3LELB 1P3PA 1KX5B 1P3FC 3C1BB 3NQJA 5GSUC 4NE5A 4J8UA 3REHA 1M19D 3RELB 3X1VC 5DNMB 3P5JB 4WU9D 5F99C 4YS3A 3MGSB 1P3GA 2XD1A 5AV6A 1BH9A 4H9RB 2NZDC 3AZND 3AZLC 3MGPA 3LZ0D 3AZMD 1P3MC 1P3OD 2CV5A 1KX4C 5B1LD 3UT9B 3REKD 3AFAB 5G49B 1T3UA 5JA4B 5AV9B 2FJ7A 2DQNC 3LJAD 2LY8A 3WTPB 5BNXA 1TZYD 3TU4B 4Z66B 5CP6C 4XZQC 3REJB 1U35B 5B40A 2YFWB 4CAYB 4DRBA 5AY8D 5B2IC 1P34B 5GXQB 1H3OB 2AROA 5B0ZD 4WNNA 5JRGA 3R45A 2HIOA 4EO5C 4YM6B 3WAAA 4LD9B 1JFIB 4ZBJB 3MNND 5AVCD 3MGQD 1S32C 3AZEB 1ID3D 5GT3B 4Z5TC 4H9QB 3V9RA 1P3LC 3W97C 3AV1D 5B24A 3W99D 3AZKD 2RVQD 2YFVB 3AZJC 1P3BA 3AZGB 5C3IC 3KWQA 4J8WA 4KUDA 1M18C 3LZ1B 5B31C 5BS7A 4H9NA 3MGRA 4KGCB 5B1MB 1M1AA 1P3KD 1P3FA 4QLCD 3LZ0B 5GSUA 1N1JB 3A6NC 3AZFB 3AZMB 3X1VA 1ZLAB 3AZIC 5AV8D 1EQZD 2RIQA 5F99A 3AYWC 5B31G 3REKB 3AZHB 1P3MB 4H9OA 1KU5A 5B2JB 3KXBC 3W98D 2NZDA 3LJAB 4J8XD 3VH5W 3AZLA 1KX5D 3C1BD 3RELD 5DNMD 2F8NH 1W2EA 5CPIC 1KX3B 2FJ7C 4NFTA 5B33C 2BG1A 3X1TC 1BH8B 5GT0B 3UTAC 5DNNB 5CP6A 5CPKB 4XZQA 3AV2C 5B40C 5AV9D 2PYOB 3X1UC 1M19C 4WU9C 5B2IA 2AROC 3W96B 5AVBD 3WTPD 3X1SC 4G92C 3WKJB 2BYKB 3AZNC 3B0DB 4Z66D 4ZUXB 3AZKB 3B0BA 2JCHA 1U35D 5B0YD 2W8SA 2Y2JA 3B0CW 5AV5B 1S32A 3B6FB 3WA9A 5B1LC 1P34D 1P3PD 5BT1C 4Z5TA 4R8PC 2BYMA 5GXQD 3O62B 3REHD 3A1KA 1KX4B 3VH6A 1P3LA 3W97A 5AV8B 4YM6D 2NQBC 1EQZB 2IO5C 4H9PA 4LD9D 3KFUG 1P3GD 1HQ3B 2F8NA 3EPHA 1P3BC 3AZJA 3H0LC 3REIB 3AZED 4J8WC 5CPJA 5GT3D 4KUDC 1PZRA 1M18A 1F1EA 5B31A 1TAFA 1BFMA 1TZYC 1M1AC 4UUZB 2Y2GA 3MVDC 3B6GA 2HUEC 4DRAA 3A6NA 2CV5D 3AZIA 1F66B 3AYWA 5AY8C 2ZY3A 2ZY4A 5B0ZC 3AZGD 3KXBA 3KUYA 3LZ1D 4WU8A 4KGCD 5B32C 5B1MD 5BNVA 1Z2CB 3AZFD 5KDMB 3MNNC 5AVCC 1ZLAD 1ID3C 5FUGB 4X23B 1AOIA 3AZHD 1P3MD 5CPIA 3IP4C 5B32G 5B2JD 4CSRB 1WWSA 3AN2B 3VH5T 3UTBC 3C1CA 3AV1C 2Y2KA 5AVBB 4JJNB 5B33A 3X1TA 1P3AD 5JRGD 3AL0C 3WAAD 1P3IB 2L5AA 4J8VC 5E5AC 3UTAA 1KX3D 3AV2A 1P3KC 5B0YB 4QLCC 3X1UA 1M19A 4WU9A 1P3PB 4XUJD 4J8UB 3NQJB 3REHB 3X1SA 3W98C 5GT0D 3AZNA 4YS3B 5DNND 3LELC 5CPKD 1P3GB 5AV6B 1BH9B 1KX5C 2PYOD 3AZMA 1P3OA 3WA9C 3NQUA 4KHAA 5B1LA 5DNMC 2G5HC 4G91C 3MGRD 3EPKA 3W96D 4R8PA 3MGPB 3MGSC 2CV5B 3WKJD 2NQBA 5F99D 4ZUXD 3F6TA 5CPJC 3B0CT 5BO0A 5AV5D 3B6FD 2VQRA 3UT9C 3AZLD 1TZYA 3B6GC 3MVDA 3O62D 2F8NG 1KX4D 3AFAC 5AV9C 3VH6W 5BNXB 5CHLB 5AY8A 2J8PA 1HQ3D 5B0ZA 3WTPC 3KUYC 5B40B 3REID 4WU8C 4E44A 5B32A 3TU4C 4Z66C 3REJC 2Y2QA 1Q9CA 4WNNB 5JRGB 3R45B 5AVCA 3MNNA 3MGQA 1U35C 1P3AB 1ID3A 2HIOB 3WAAB 1AOIC 1F66D 1P34C 5CP6D 4AWLC 4NE6A 5GXQC 4XZQD 2DF4C 3C1CC 3UTBA 4YM6C 3AV1A 4XUJB 3W99A 4H9SA 4LD9C 2ZM5A 4ZBJC 3V9RB 3KSYA 3AZEC 5GT3C 3WTPE 5B24B 2FFFB 4X23D 2IO5B 5E5AA 4J8VA 1P3KA 4M6BA 4QLCA 1P3BB 3KWQB 1S32D 4J8WB 4KUDB 3AN2D 2UWXA 3MGRB 4H9NB 2Y2OA 1M1AB 1EQZA 1P3FB 4JJND 5GSUB 3X1VB 1P3LD 3W98A 3W97D 1P3ID 3LZ1C 5F99B 4J8XA 4KGCC 3LELA 5B1MC 4H9OB 1KX5A 3LZ0C 3C1BA 3AZHC 3EPJA 3AZFC 3AZMC 1P3OC 2NZDB 3RELA 5DNMA 1M18D 1ZLAC 5B31D 2Y2NA 3AZLB 3REKC 3H0RC 4J8UD 3MGSA
chains in the Genus database with same CATH topology
3A6ND 4HGAC 4H9RA 2XD5A 3LJAC 2Y2HA 4YS3D 3AYWD 5AV6D 3UT9A 3MGPD 3AFAA 5G49A 5JA4A 2ZY5A 5AV9A 5CP6B 2ZY2A 4XZQB 3WTPA 2FJ7D 2Y2MA 5GT0C 5B2IB 3TU4A 4Z66A 2F8NK 3REJA 3MGQC 4DQYB 5B0YA 1U35A 3VH6T 2PYOC 2YFWA 4EO5B 4CAYA 3VH5A 3UTAD 1P34A 4WJ3C 3W96C 5GXQA 1H3OA 3AV2D 5B40D 1S32B 3WA9B 3X1UD 3WKJC 2JE5A 2Y2LA 4G91B 4YM6A 4Z5TB 3W99C 2BYMB 2AROD 3B0DC 4H9SC 4ZUXC 3AZKC 4LD9A 2RVQC 1JFIA 3X1SD 3EPLA 1P3LB 3W97B 2HIOD 5AV5C 3AZEA 5GT3A 3B6FC 4H9PB 2F8NB 1ULYA 3O62C 3AZJB 2Y2IA 5CPJB 4H9QA 5C3IB 1M18B 5B31B 1TAFB 5AV8C 5BT1D 1EQZC 4R8PD 3B6GB 1HQ3C 3A6NB 2YFVA 3AZGA 3REIC 1B67A 3AZIB 5B24D 4J8XC 2NQBD 3LZ1A 3AYWB 4KGCA 5B1MA 3C1BC 1P3BD 3KXBB 3LZ0A 1N1JA 3KWQD 3KUYB 4J8WD 3RELC 3AZFA 4KUDD 1ZLAA 4WU8B 5BNVB 1M1AD 1F66C 3MVDD 3REKA 3AZHA 1P3FD 5GSUD 1P3MA 5B2JA 3X1VD 3LJAA 4UPKA 1AOIB 4NE3A 5CPIB 4AWLB 3EG5B 2NZDD 2FJ7B 1P3AA 3C1CB 5B32D 4X23C 3A1IA 5B33B 1KX3A 3X1TB 3AN2C 3UTAB 2G5IC 4XUJA 3AV2B 5AVBC 4JJNC 3X1UB 1M19B 3UTBD 1BH8A 5GT0A 4WU9B 1P3IC 2AROB 3FDDA 5DNNA 5CPKA 5B0YC 3X1SB 4G92B 3AZNB 2CWEA 2PYOA 3H0MC 4J8VD 5E5AD 1P3PC 3W96A 4J8UC 3REHC 1P3OB 3NQUB 4KHAB 5B1LB 1B6WA 2BYKA 3WKJA 5B2ID 2JSSA 4R8PB 4YS3C 4ZUXA 3AZKA 1P3GC 5AV6C 4HGAB 5AV5A 3B6FA 2NQBB 3LELD 3MGPC 3O62A 4E45A 5BO0B 2CV5C 3WA9D 1KX4A 5AV8A 4Z5TD 1TZYB 2F2AC 3MVDB 3MGSD 1HQ3A 2HUEB 3AZGC 2Y2PA 3REIA 5AY8B 2F8ND 4WZSB 4UUZA 3AZJD 5B0ZB 5CPJD 3UT9D 5B32B 1F66A 3B6GD 1A7WA 5B2JC 3MNNB 5AVCB 3AFAD 3MGQB 3AZID 1ID3B 3KXBD 3KUYD 5KDMA 5JRGC 1P3AC 1HTAA 4WU8D 3UTBB 2HIOC 3WAAC 5FUGA 3AV1B 4X23A 3TU4D 3W99B 1KX3C 3REJD 4CSRA 4Z2MG 3AN2A 1AOID 4J8VB 5E5AB 5CPID 4XUJC 1R4VA 5AVBA 1P3KB 4QLCB 4JJNA 4WV4B 3C1CD 5B24C 1P3IA 1WWIA 5DNNC 5CPKC 5B33D 3X1TD 3W98B 3KWQC 4J8XB 5BS7C 4Z2MH 3MGRC 3LELB 1P3PA 1KX5B 1P3FC 3C1BB 3NQJA 5GSUC 4NE5A 4J8UA 3REHA 1M19D 3RELB 3X1VC 5DNMB 3P5JB 4WU9D 5F99C 4YS3A 3MGSB 1P3GA 2XD1A 5AV6A 1BH9A 4H9RB 2NZDC 3AZND 3AZLC 3MGPA 3LZ0D 3AZMD 1P3MC 1P3OD 2CV5A 1KX4C 5B1LD 3UT9B 3REKD 3AFAB 5G49B 1T3UA 5JA4B 5AV9B 2FJ7A 2DQNC 3LJAD 2LY8A 3WTPB 5BNXA 1TZYD 3TU4B 4Z66B 5CP6C 4XZQC 3REJB 1U35B 5B40A 2YFWB 4CAYB 4DRBA 5AY8D 5B2IC 1P34B 5GXQB 1H3OB 2AROA 5B0ZD 4WNNA 5JRGA 3R45A 2HIOA 4EO5C 4YM6B 3WAAA 4LD9B 1JFIB 4ZBJB 3MNND 5AVCD 3MGQD 1S32C 3AZEB 1ID3D 5GT3B 4Z5TC 4H9QB 3V9RA 1P3LC 3W97C 3AV1D 5B24A 3W99D 3AZKD 2RVQD 2YFVB 3AZJC 1P3BA 3AZGB 5C3IC 3KWQA 4J8WA 4KUDA 1M18C 3LZ1B 5B31C 5BS7A 4H9NA 3MGRA 4KGCB 5B1MB 1M1AA 1P3KD 1P3FA 4QLCD 3LZ0B 5GSUA 1N1JB 3A6NC 3AZFB 3AZMB 3X1VA 1ZLAB 3AZIC 5AV8D 1EQZD 2RIQA 5F99A 3AYWC 5B31G 3REKB 3AZHB 1P3MB 4H9OA 1KU5A 5B2JB 3KXBC 3W98D 2NZDA 3LJAB 4J8XD 3VH5W 3AZLA 1KX5D 3C1BD 3RELD 5DNMD 2F8NH 1W2EA 5CPIC 1KX3B 2FJ7C 4NFTA 5B33C 2BG1A 3X1TC 1BH8B 5GT0B 3UTAC 5DNNB 5CP6A 5CPKB 4XZQA 3AV2C 5B40C 5AV9D 2PYOB 3X1UC 1M19C 4WU9C 5B2IA 2AROC 3W96B 5AVBD 3WTPD 3X1SC 4G92C 3WKJB 2BYKB 3AZNC 3B0DB 4Z66D 4ZUXB 3AZKB 3B0BA 2JCHA 1U35D 5B0YD 2W8SA 2Y2JA 3B0CW 5AV5B 1S32A 3B6FB 3WA9A 5B1LC 1P34D 1P3PD 5BT1C 4Z5TA 4R8PC 2BYMA 5GXQD 3O62B 3REHD 3A1KA 1KX4B 3VH6A 1P3LA 3W97A 5AV8B 4YM6D 2NQBC 1EQZB 2IO5C 4H9PA 4LD9D 3KFUG 1P3GD 1HQ3B 2F8NA 3EPHA 1P3BC 3AZJA 3H0LC 3REIB 3AZED 4J8WC 5CPJA 5GT3D 4KUDC 1PZRA 1M18A 1F1EA 5B31A 1TAFA 1BFMA 1TZYC 1M1AC 4UUZB 2Y2GA 3MVDC 3B6GA 2HUEC 4DRAA 3A6NA 2CV5D 3AZIA 1F66B 3AYWA 5AY8C 2ZY3A 2ZY4A 5B0ZC 3AZGD 3KXBA 3KUYA 3LZ1D 4WU8A 4KGCD 5B32C 5B1MD 5BNVA 1Z2CB 3AZFD 5KDMB 3MNNC 5AVCC 1ZLAD 1ID3C 5FUGB 4X23B 1AOIA 3AZHD 1P3MD 5CPIA 3IP4C 5B32G 5B2JD 4CSRB 1WWSA 3AN2B 3VH5T 3UTBC 3C1CA 3AV1C 2Y2KA 5AVBB 4JJNB 5B33A 3X1TA 1P3AD 5JRGD 3AL0C 3WAAD 1P3IB 2L5AA 4J8VC 5E5AC 3UTAA 1KX3D 3AV2A 1P3KC 5B0YB 4QLCC 3X1UA 1M19A 4WU9A 1P3PB 4XUJD 4J8UB 3NQJB 3REHB 3X1SA 3W98C 5GT0D 3AZNA 4YS3B 5DNND 3LELC 5CPKD 1P3GB 5AV6B 1BH9B 1KX5C 2PYOD 3AZMA 1P3OA 3WA9C 3NQUA 4KHAA 5B1LA 5DNMC 2G5HC 4G91C 3MGRD 3EPKA 3W96D 4R8PA 3MGPB 3MGSC 2CV5B 3WKJD 2NQBA 5F99D 4ZUXD 3F6TA 5CPJC 3B0CT 5BO0A 5AV5D 3B6FD 2VQRA 3UT9C 3AZLD 1TZYA 3B6GC 3MVDA 3O62D 2F8NG 1KX4D 3AFAC 5AV9C 3VH6W 5BNXB 5CHLB 5AY8A 2J8PA 1HQ3D 5B0ZA 3WTPC 3KUYC 5B40B 3REID 4WU8C 4E44A 5B32A 3TU4C 4Z66C 3REJC 2Y2QA 1Q9CA 4WNNB 5JRGB 3R45B 5AVCA 3MNNA 3MGQA 1U35C 1P3AB 1ID3A 2HIOB 3WAAB 1AOIC 1F66D 1P34C 5CP6D 4AWLC 4NE6A 5GXQC 4XZQD 2DF4C 3C1CC 3UTBA 4YM6C 3AV1A 4XUJB 3W99A 4H9SA 4LD9C 2ZM5A 4ZBJC 3V9RB 3KSYA 3AZEC 5GT3C 3WTPE 5B24B 2FFFB 4X23D 2IO5B 5E5AA 4J8VA 1P3KA 4M6BA 4QLCA 1P3BB 3KWQB 1S32D 4J8WB 4KUDB 3AN2D 2UWXA 3MGRB 4H9NB 2Y2OA 1M1AB 1EQZA 1P3FB 4JJND 5GSUB 3X1VB 1P3LD 3W98A 3W97D 1P3ID 3LZ1C 5F99B 4J8XA 4KGCC 3LELA 5B1MC 4H9OB 1KX5A 3LZ0C 3C1BA 3AZHC 3EPJA 3AZFC 3AZMC 1P3OC 2NZDB 3RELA 5DNMA 1M18D 1ZLAC 5B31D 2Y2NA 3AZLB 3REKC 3H0RC 4J8UD 3MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N D;  4HGA C;  4H9R A;  3LJA C;  4YS3 D;  3AYW D;  5AV6 D;  3UT9 A;  3MGP D;  3AFA A;  5G49 A;  5JA4 A;  5AV9 A;  5CP6 B;  4XZQ B;  3WTP A;  2FJ7 D;  5GT0 C;  5B2I B;  3TU4 A;  4Z66 A;  2F8N K;  3REJ A;  3MGQ C;  1U35 A;  5B0Y A;  3VH6 T;  2PYO C;  2YFW A;  4EO5 B;  4CAY A;  3VH5 A;  3UTA D;  1P34 A;  3W96 C;  5GXQ A;  1H3O A;  3AV2 D;  5B40 D;  1S32 B;  3WA9 B;  3X1U D;  3WKJ C;  4G91 B;  4YM6 A;  4Z5T B;  3W99 C;  2BYM B;  2ARO D;  3B0D C;  4H9S C;  4ZUX C;  3AZK C;  4LD9 A;  2RVQ C;  1JFI A;  3X1S D;  1P3L B;  3W97 B;  2HIO D;  5AV5 C;  3AZE A;  5GT3 A;  3B6F C;  4H9P B;  2F8N B;  1ULY A;  3O62 C;  3AZJ B;  5CPJ B;  4H9Q A;  5C3I B;  1M18 B;  5B31 B;  1TAF B;  5AV8 C;  5BT1 D;  1EQZ C;  4R8P D;  3B6G B;  1HQ3 C;  3A6N B;  2YFV A;  3AZG A;  3REI C;  1B67 A;  3AZI B;  5B24 D;  4J8X C;  2NQB D;  3LZ1 A;  3AYW B;  4KGC A;  5B1M A;  3C1B C;  1P3B D;  3KXB B;  3LZ0 A;  1N1J A;  3KWQ D;  3KUY B;  4J8W D;  3REL C;  3AZF A;  4KUD D;  1ZLA A;  4WU8 B;  5BNV B;  1M1A D;  1F66 C;  3MVD D;  3REK A;  3AZH A;  1P3F D;  5GSU D;  1P3M A;  5B2J A;  3X1V D;  3LJA A;  1AOI B;  4NE3 A;  5CPI B;  4AWL B;  2NZD D;  2FJ7 B;  1P3A A;  3C1C B;  5B32 D;  4X23 C;  5B33 B;  1KX3 A;  3X1T B;  3AN2 C;  3UTA B;  4XUJ A;  3AV2 B;  5AVB C;  4JJN C;  3X1U B;  1M19 B;  3UTB D;  1BH8 A;  5GT0 A;  4WU9 B;  1P3I C;  2ARO B;  5DNN A;  5CPK A;  5B0Y C;  3X1S B;  4G92 B;  3AZN B;  2CWE A;  2PYO A;  4J8V D;  5E5A D;  1P3P C;  3W96 A;  4J8U C;  3REH C;  1P3O B;  3NQU B;  4KHA B;  5B1L B;  1B6W A;  2BYK A;  3WKJ A;  5B2I D;  4R8P B;  2JSS A;  4YS3 C;  4ZUX A;  3AZK A;  1P3G C;  5AV6 C;  4HGA B;  5AV5 A;  3B6F A;  2NQB B;  3LEL D;  3MGP C;  3O62 A;  4E45 A;  5BO0 B;  2CV5 C;  3WA9 D;  1KX4 A;  5AV8 A;  4Z5T D;  1TZY B;  3MVD B;  3MGS D;  1HQ3 A;  2HUE B;  3AZG C;  3REI A;  5AY8 B;  2F8N D;  4WZS B;  4UUZ A;  3AZJ D;  5B0Z B;  5CPJ D;  3UT9 D;  5B32 B;  1F66 A;  3B6G D;  1A7W A;  5B2J C;  3MNN B;  5AVC B;  3AFA D;  3MGQ B;  3AZI D;  1ID3 B;  3KXB D;  3KUY D;  5KDM A;  5JRG C;  1P3A C;  1HTA A;  4WU8 D;  3UTB B;  2HIO C;  3WAA C;  5FUG A;  3AV1 B;  4X23 A;  3TU4 D;  3W99 B;  1KX3 C;  3REJ D;  4CSR A;  4Z2M G;  3AN2 A;  1AOI D;  4J8V B;  5E5A B;  5CPI D;  4XUJ C;  1R4V A;  5AVB A;  1P3K B;  4QLC B;  4JJN A;  4WV4 B;  3C1C D;  5B24 C;  1P3I A;  1WWI A;  5DNN C;  5CPK C;  5B33 D;  3X1T D;  3W98 B;  3KWQ C;  4J8X B;  5BS7 C;  4Z2M H;  3MGR C;  3LEL B;  1P3P A;  1KX5 B;  1P3F C;  3C1B B;  3NQJ A;  5GSU C;  4NE5 A;  4J8U A;  3REH A;  1M19 D;  3REL B;  3X1V C;  5DNM B;  4WU9 D;  5F99 C;  4YS3 A;  3MGS B;  1P3G A;  5AV6 A;  1BH9 A;  4H9R B;  2NZD C;  3AZN D;  3AZL C;  3MGP A;  3LZ0 D;  3AZM D;  1P3M C;  1P3O D;  2CV5 A;  1KX4 C;  5B1L D;  3UT9 B;  3REK D;  3AFA B;  5G49 B;  5JA4 B;  5AV9 B;  2FJ7 A;  3LJA D;  2LY8 A;  3WTP B;  5BNX A;  1TZY D;  3TU4 B;  4Z66 B;  5CP6 C;  4XZQ C;  3REJ B;  1U35 B;  5B40 A;  2YFW B;  4CAY B;  4DRB A;  5AY8 D;  5B2I C;  1P34 B;  5GXQ B;  1H3O B;  2ARO A;  5B0Z D;  4WNN A;  5JRG A;  3R45 A;  2HIO A;  4EO5 C;  4YM6 B;  3WAA A;  4LD9 B;  1JFI B;  4ZBJ B;  3MNN D;  5AVC D;  3MGQ D;  1S32 C;  3AZE B;  1ID3 D;  5GT3 B;  4Z5T C;  4H9Q B;  3V9R A;  1P3L C;  3W97 C;  3AV1 D;  5B24 A;  3W99 D;  3AZK D;  2RVQ D;  2YFV B;  3AZJ C;  1P3B A;  3AZG B;  5C3I C;  3KWQ A;  4J8W A;  4KUD A;  1M18 C;  3LZ1 B;  5B31 C;  5BS7 A;  4H9N A;  3MGR A;  4KGC B;  5B1M B;  1M1A A;  1P3K D;  1P3F A;  4QLC D;  3LZ0 B;  5GSU A;  1N1J B;  3A6N C;  3AZF B;  3AZM B;  3X1V A;  1ZLA B;  3AZI C;  5AV8 D;  1EQZ D;  5F99 A;  3AYW C;  5B31 G;  3REK B;  3AZH B;  1P3M B;  4H9O A;  1KU5 A;  5B2J B;  3KXB C;  3W98 D;  2NZD A;  3LJA B;  4J8X D;  3VH5 W;  3AZL A;  1KX5 D;  3C1B D;  3REL D;  5DNM D;  2F8N H;  5CPI C;  1KX3 B;  2FJ7 C;  4NFT A;  5B33 C;  3X1T C;  1BH8 B;  5GT0 B;  3UTA C;  5DNN B;  5CP6 A;  5CPK B;  4XZQ A;  3AV2 C;  5B40 C;  5AV9 D;  2PYO B;  3X1U C;  1M19 C;  4WU9 C;  5B2I A;  2ARO C;  3W96 B;  5AVB D;  3WTP D;  3X1S C;  4G92 C;  3WKJ B;  2BYK B;  3AZN C;  3B0D B;  4Z66 D;  4ZUX B;  3AZK B;  3B0B A;  1U35 D;  5B0Y D;  1S32 A;  3B0C W;  5AV5 B;  3B6F B;  3WA9 A;  5B1L C;  1P34 D;  1P3P D;  5BT1 C;  4Z5T A;  4R8P C;  2BYM A;  5GXQ D;  3O62 B;  3REH D;  1KX4 B;  3VH6 A;  1P3L A;  3W97 A;  5AV8 B;  4YM6 D;  2NQB C;  1EQZ B;  2IO5 C;  4H9P A;  4LD9 D;  1P3G D;  1HQ3 B;  2F8N A;  1P3B C;  3AZJ A;  5CPJ A;  3REI B;  3AZE D;  4J8W C;  4KUD C;  5GT3 D;  1M18 A;  1F1E A;  5B31 A;  1TAF A;  1BFM A;  1TZY C;  1M1A C;  4UUZ B;  3MVD C;  3B6G A;  2HUE C;  4DRA A;  3A6N A;  2CV5 D;  3AZI A;  1F66 B;  3AYW A;  5AY8 C;  5B0Z C;  3AZG D;  3KXB A;  3KUY A;  3LZ1 D;  4WU8 A;  4KGC D;  5B32 C;  5B1M D;  5BNV A;  3AZF D;  5KDM B;  3MNN C;  5AVC C;  1ZLA D;  1ID3 C;  5FUG B;  4X23 B;  1AOI A;  3AZH D;  1P3M D;  5CPI A;  5B32 G;  5B2J D;  4CSR B;  1WWS A;  3AN2 B;  3VH5 T;  3UTB C;  3C1C A;  3AV1 C;  5AVB B;  4JJN B;  5B33 A;  3X1T A;  1P3A D;  5JRG D;  3WAA D;  1P3I B;  2L5A A;  4J8V C;  5E5A C;  3UTA A;  1KX3 D;  3AV2 A;  1P3K C;  5B0Y B;  4QLC C;  3X1U A;  1M19 A;  4WU9 A;  1P3P B;  4XUJ D;  4J8U B;  3NQJ B;  3REH B;  3X1S A;  3W98 C;  5GT0 D;  3AZN A;  4YS3 B;  5DNN D;  3LEL C;  5CPK D;  1P3G B;  5AV6 B;  1BH9 B;  1KX5 C;  2PYO D;  3AZM A;  1P3O A;  3WA9 C;  3NQU A;  4KHA A;  5B1L A;  5DNM C;  4G91 C;  3MGR D;  3W96 D;  4R8P A;  3MGP B;  3MGS C;  2CV5 B;  3WKJ D;  2NQB A;  5F99 D;  4ZUX D;  5CPJ C;  3B0C T;  5BO0 A;  5AV5 D;  3B6F D;  3UT9 C;  3AZL D;  1TZY A;  3B6G C;  3MVD A;  3O62 D;  2F8N G;  1KX4 D;  3AFA C;  5AV9 C;  3VH6 W;  5BNX B;  5CHL B;  5AY8 A;  1HQ3 D;  5B0Z A;  3WTP C;  3KUY C;  5B40 B;  3REI D;  4WU8 C;  4E44 A;  5B32 A;  3TU4 C;  4Z66 C;  3REJ C;  1Q9C A;  4WNN B;  5JRG B;  3R45 B;  5AVC A;  3MNN A;  3MGQ A;  1U35 C;  1P3A B;  1ID3 A;  2HIO B;  3WAA B;  1AOI C;  1F66 D;  1P34 C;  5CP6 D;  4AWL C;  4NE6 A;  5GXQ C;  4XZQ D;  3C1C C;  3UTB A;  4YM6 C;  3AV1 A;  4XUJ B;  3W99 A;  4H9S A;  4LD9 C;  4ZBJ C;  3V9R B;  3KSY A;  3AZE C;  5GT3 C;  3WTP E;  5B24 B;  4X23 D;  2IO5 B;  5E5A A;  4J8V A;  1P3K A;  4M6B A;  4QLC A;  1P3B B;  3KWQ B;  1S32 D;  4J8W B;  4KUD B;  3AN2 D;  3MGR B;  4H9N B;  1M1A B;  1EQZ A;  1P3F B;  4JJN D;  5GSU B;  3X1V B;  1P3L D;  3W98 A;  3W97 D;  1P3I D;  3LZ1 C;  5F99 B;  4J8X A;  4KGC C;  3LEL A;  5B1M C;  4H9O B;  1KX5 A;  3LZ0 C;  3C1B A;  3AZH C;  3AZF C;  3AZM C;  1P3O C;  2NZD B;  3REL A;  5DNM A;  1M18 D;  1ZLA C;  5B31 D;  3AZL B;  3REK C;  4J8U D;  3MGS A; 
#chains in the Genus database with same CATH topology
 3A6N D;  4HGA C;  4H9R A;  2XD5 A;  3LJA C;  2Y2H A;  4YS3 D;  3AYW D;  5AV6 D;  3UT9 A;  3MGP D;  3AFA A;  5G49 A;  5JA4 A;  2ZY5 A;  5AV9 A;  5CP6 B;  2ZY2 A;  4XZQ B;  3WTP A;  2FJ7 D;  2Y2M A;  5GT0 C;  5B2I B;  3TU4 A;  4Z66 A;  2F8N K;  3REJ A;  3MGQ C;  4DQY B;  5B0Y A;  1U35 A;  3VH6 T;  2PYO C;  2YFW A;  4EO5 B;  4CAY A;  3VH5 A;  3UTA D;  1P34 A;  4WJ3 C;  3W96 C;  5GXQ A;  1H3O A;  3AV2 D;  5B40 D;  1S32 B;  3WA9 B;  3X1U D;  3WKJ C;  2JE5 A;  2Y2L A;  4G91 B;  4YM6 A;  4Z5T B;  3W99 C;  2BYM B;  2ARO D;  3B0D C;  4H9S C;  4ZUX C;  3AZK C;  4LD9 A;  2RVQ C;  1JFI A;  3X1S D;  3EPL A;  1P3L B;  3W97 B;  2HIO D;  5AV5 C;  3AZE A;  5GT3 A;  3B6F C;  4H9P B;  2F8N B;  1ULY A;  3O62 C;  3AZJ B;  2Y2I A;  5CPJ B;  4H9Q A;  5C3I B;  1M18 B;  5B31 B;  1TAF B;  5AV8 C;  5BT1 D;  1EQZ C;  4R8P D;  3B6G B;  1HQ3 C;  3A6N B;  2YFV A;  3AZG A;  3REI C;  1B67 A;  3AZI B;  5B24 D;  4J8X C;  2NQB D;  3LZ1 A;  3AYW B;  4KGC A;  5B1M A;  3C1B C;  1P3B D;  3KXB B;  3LZ0 A;  1N1J A;  3KWQ D;  3KUY B;  4J8W D;  3REL C;  3AZF A;  4KUD D;  1ZLA A;  4WU8 B;  5BNV B;  1M1A D;  1F66 C;  3MVD D;  3REK A;  3AZH A;  1P3F D;  5GSU D;  1P3M A;  5B2J A;  3X1V D;  3LJA A;  4UPK A;  1AOI B;  4NE3 A;  5CPI B;  4AWL B;  3EG5 B;  2NZD D;  2FJ7 B;  1P3A A;  3C1C B;  5B32 D;  4X23 C;  3A1I A;  5B33 B;  1KX3 A;  3X1T B;  3AN2 C;  3UTA B;  2G5I C;  4XUJ A;  3AV2 B;  5AVB C;  4JJN C;  3X1U B;  1M19 B;  3UTB D;  1BH8 A;  5GT0 A;  4WU9 B;  1P3I C;  2ARO B;  3FDD A;  5DNN A;  5CPK A;  5B0Y C;  3X1S B;  4G92 B;  3AZN B;  2CWE A;  2PYO A;  3H0M C;  4J8V D;  5E5A D;  1P3P C;  3W96 A;  4J8U C;  3REH C;  1P3O B;  3NQU B;  4KHA B;  5B1L B;  1B6W A;  2BYK A;  3WKJ A;  5B2I D;  2JSS A;  4R8P B;  4YS3 C;  4ZUX A;  3AZK A;  1P3G C;  5AV6 C;  4HGA B;  5AV5 A;  3B6F A;  2NQB B;  3LEL D;  3MGP C;  3O62 A;  4E45 A;  5BO0 B;  2CV5 C;  3WA9 D;  1KX4 A;  5AV8 A;  4Z5T D;  1TZY B;  2F2A C;  3MVD B;  3MGS D;  1HQ3 A;  2HUE B;  3AZG C;  2Y2P A;  3REI A;  5AY8 B;  2F8N D;  4WZS B;  4UUZ A;  3AZJ D;  5B0Z B;  5CPJ D;  3UT9 D;  5B32 B;  1F66 A;  3B6G D;  1A7W A;  5B2J C;  3MNN B;  5AVC B;  3AFA D;  3MGQ B;  3AZI D;  1ID3 B;  3KXB D;  3KUY D;  5KDM A;  5JRG C;  1P3A C;  1HTA A;  4WU8 D;  3UTB B;  2HIO C;  3WAA C;  5FUG A;  3AV1 B;  4X23 A;  3TU4 D;  3W99 B;  1KX3 C;  3REJ D;  4CSR A;  4Z2M G;  3AN2 A;  1AOI D;  4J8V B;  5E5A B;  5CPI D;  4XUJ C;  1R4V A;  5AVB A;  1P3K B;  4QLC B;  4JJN A;  4WV4 B;  3C1C D;  5B24 C;  1P3I A;  1WWI A;  5DNN C;  5CPK C;  5B33 D;  3X1T D;  3W98 B;  3KWQ C;  4J8X B;  5BS7 C;  4Z2M H;  3MGR C;  3LEL B;  1P3P A;  1KX5 B;  1P3F C;  3C1B B;  3NQJ A;  5GSU C;  4NE5 A;  4J8U A;  3REH A;  1M19 D;  3REL B;  3X1V C;  5DNM B;  3P5J B;  4WU9 D;  5F99 C;  4YS3 A;  3MGS B;  1P3G A;  2XD1 A;  5AV6 A;  1BH9 A;  4H9R B;  2NZD C;  3AZN D;  3AZL C;  3MGP A;  3LZ0 D;  3AZM D;  1P3M C;  1P3O D;  2CV5 A;  1KX4 C;  5B1L D;  3UT9 B;  3REK D;  3AFA B;  5G49 B;  1T3U A;  5JA4 B;  5AV9 B;  2FJ7 A;  2DQN C;  3LJA D;  2LY8 A;  3WTP B;  5BNX A;  1TZY D;  3TU4 B;  4Z66 B;  5CP6 C;  4XZQ C;  3REJ B;  1U35 B;  5B40 A;  2YFW B;  4CAY B;  4DRB A;  5AY8 D;  5B2I C;  1P34 B;  5GXQ B;  1H3O B;  2ARO A;  5B0Z D;  4WNN A;  5JRG A;  3R45 A;  2HIO A;  4EO5 C;  4YM6 B;  3WAA A;  4LD9 B;  1JFI B;  4ZBJ B;  3MNN D;  5AVC D;  3MGQ D;  1S32 C;  3AZE B;  1ID3 D;  5GT3 B;  4Z5T C;  4H9Q B;  3V9R A;  1P3L C;  3W97 C;  3AV1 D;  5B24 A;  3W99 D;  3AZK D;  2RVQ D;  2YFV B;  3AZJ C;  1P3B A;  3AZG B;  5C3I C;  3KWQ A;  4J8W A;  4KUD A;  1M18 C;  3LZ1 B;  5B31 C;  5BS7 A;  4H9N A;  3MGR A;  4KGC B;  5B1M B;  1M1A A;  1P3K D;  1P3F A;  4QLC D;  3LZ0 B;  5GSU A;  1N1J B;  3A6N C;  3AZF B;  3AZM B;  3X1V A;  1ZLA B;  3AZI C;  5AV8 D;  1EQZ D;  2RIQ A;  5F99 A;  3AYW C;  5B31 G;  3REK B;  3AZH B;  1P3M B;  4H9O A;  1KU5 A;  5B2J B;  3KXB C;  3W98 D;  2NZD A;  3LJA B;  4J8X D;  3VH5 W;  3AZL A;  1KX5 D;  3C1B D;  3REL D;  5DNM D;  2F8N H;  1W2E A;  5CPI C;  1KX3 B;  2FJ7 C;  4NFT A;  5B33 C;  2BG1 A;  3X1T C;  1BH8 B;  5GT0 B;  3UTA C;  5DNN B;  5CP6 A;  5CPK B;  4XZQ A;  3AV2 C;  5B40 C;  5AV9 D;  2PYO B;  3X1U C;  1M19 C;  4WU9 C;  5B2I A;  2ARO C;  3W96 B;  5AVB D;  3WTP D;  3X1S C;  4G92 C;  3WKJ B;  2BYK B;  3AZN C;  3B0D B;  4Z66 D;  4ZUX B;  3AZK B;  3B0B A;  2JCH A;  1U35 D;  5B0Y D;  2W8S A;  2Y2J A;  3B0C W;  5AV5 B;  1S32 A;  3B6F B;  3WA9 A;  5B1L C;  1P34 D;  1P3P D;  5BT1 C;  4Z5T A;  4R8P C;  2BYM A;  5GXQ D;  3O62 B;  3REH D;  3A1K A;  1KX4 B;  3VH6 A;  1P3L A;  3W97 A;  5AV8 B;  4YM6 D;  2NQB C;  1EQZ B;  2IO5 C;  4H9P A;  4LD9 D;  3KFU G;  1P3G D;  1HQ3 B;  2F8N A;  3EPH A;  1P3B C;  3AZJ A;  3H0L C;  3REI B;  3AZE D;  4J8W C;  5CPJ A;  5GT3 D;  4KUD C;  1PZR A;  1M18 A;  1F1E A;  5B31 A;  1TAF A;  1BFM A;  1TZY C;  1M1A C;  4UUZ B;  2Y2G A;  3MVD C;  3B6G A;  2HUE C;  4DRA A;  3A6N A;  2CV5 D;  3AZI A;  1F66 B;  3AYW A;  5AY8 C;  2ZY3 A;  2ZY4 A;  5B0Z C;  3AZG D;  3KXB A;  3KUY A;  3LZ1 D;  4WU8 A;  4KGC D;  5B32 C;  5B1M D;  5BNV A;  1Z2C B;  3AZF D;  5KDM B;  3MNN C;  5AVC C;  1ZLA D;  1ID3 C;  5FUG B;  4X23 B;  1AOI A;  3AZH D;  1P3M D;  5CPI A;  3IP4 C;  5B32 G;  5B2J D;  4CSR B;  1WWS A;  3AN2 B;  3VH5 T;  3UTB C;  3C1C A;  3AV1 C;  2Y2K A;  5AVB B;  4JJN B;  5B33 A;  3X1T A;  1P3A D;  5JRG D;  3AL0 C;  3WAA D;  1P3I B;  2L5A A;  4J8V C;  5E5A C;  3UTA A;  1KX3 D;  3AV2 A;  1P3K C;  5B0Y B;  4QLC C;  3X1U A;  1M19 A;  4WU9 A;  1P3P B;  4XUJ D;  4J8U B;  3NQJ B;  3REH B;  3X1S A;  3W98 C;  5GT0 D;  3AZN A;  4YS3 B;  5DNN D;  3LEL C;  5CPK D;  1P3G B;  5AV6 B;  1BH9 B;  1KX5 C;  2PYO D;  3AZM A;  1P3O A;  3WA9 C;  3NQU A;  4KHA A;  5B1L A;  5DNM C;  2G5H C;  4G91 C;  3MGR D;  3EPK A;  3W96 D;  4R8P A;  3MGP B;  3MGS C;  2CV5 B;  3WKJ D;  2NQB A;  5F99 D;  4ZUX D;  3F6T A;  5CPJ C;  3B0C T;  5BO0 A;  5AV5 D;  3B6F D;  2VQR A;  3UT9 C;  3AZL D;  1TZY A;  3B6G C;  3MVD A;  3O62 D;  2F8N G;  1KX4 D;  3AFA C;  5AV9 C;  3VH6 W;  5BNX B;  5CHL B;  5AY8 A;  2J8P A;  1HQ3 D;  5B0Z A;  3WTP C;  3KUY C;  5B40 B;  3REI D;  4WU8 C;  4E44 A;  5B32 A;  3TU4 C;  4Z66 C;  3REJ C;  2Y2Q A;  1Q9C A;  4WNN B;  5JRG B;  3R45 B;  5AVC A;  3MNN A;  3MGQ A;  1U35 C;  1P3A B;  1ID3 A;  2HIO B;  3WAA B;  1AOI C;  1F66 D;  1P34 C;  5CP6 D;  4AWL C;  4NE6 A;  5GXQ C;  4XZQ D;  2DF4 C;  3C1C C;  3UTB A;  4YM6 C;  3AV1 A;  4XUJ B;  3W99 A;  4H9S A;  4LD9 C;  2ZM5 A;  4ZBJ C;  3V9R B;  3KSY A;  3AZE C;  5GT3 C;  3WTP E;  5B24 B;  2FFF B;  4X23 D;  2IO5 B;  5E5A A;  4J8V A;  1P3K A;  4M6B A;  4QLC A;  1P3B B;  3KWQ B;  1S32 D;  4J8W B;  4KUD B;  3AN2 D;  2UWX A;  3MGR B;  4H9N B;  2Y2O A;  1M1A B;  1EQZ A;  1P3F B;  4JJN D;  5GSU B;  3X1V B;  1P3L D;  3W98 A;  3W97 D;  1P3I D;  3LZ1 C;  5F99 B;  4J8X A;  4KGC C;  3LEL A;  5B1M C;  4H9O B;  1KX5 A;  3LZ0 C;  3C1B A;  3AZH C;  3EPJ A;  3AZF C;  3AZM C;  1P3O C;  2NZD B;  3REL A;  5DNM A;  1M18 D;  1ZLA C;  5B31 D;  2Y2N A;  3AZL B;  3REK C;  3H0R C;  4J8U D;  3MGS A; 
#chains in the Genus database with same CATH homology
 3A6N D;  4HGA C;  4H9R A;  2XD5 A;  3LJA C;  2Y2H A;  4YS3 D;  3AYW D;  5AV6 D;  3UT9 A;  3MGP D;  3AFA A;  5G49 A;  5JA4 A;  2ZY5 A;  5AV9 A;  5CP6 B;  2ZY2 A;  4XZQ B;  3WTP A;  2FJ7 D;  2Y2M A;  5GT0 C;  5B2I B;  3TU4 A;  4Z66 A;  2F8N K;  3REJ A;  3MGQ C;  4DQY B;  5B0Y A;  1U35 A;  3VH6 T;  2PYO C;  2YFW A;  4EO5 B;  4CAY A;  3VH5 A;  3UTA D;  1P34 A;  4WJ3 C;  3W96 C;  5GXQ A;  1H3O A;  3AV2 D;  5B40 D;  1S32 B;  3WA9 B;  3X1U D;  3WKJ C;  2JE5 A;  2Y2L A;  4G91 B;  4YM6 A;  4Z5T B;  3W99 C;  2BYM B;  2ARO D;  3B0D C;  4H9S C;  4ZUX C;  3AZK C;  4LD9 A;  2RVQ C;  1JFI A;  3X1S D;  3EPL A;  1P3L B;  3W97 B;  2HIO D;  5AV5 C;  3AZE A;  5GT3 A;  3B6F C;  4H9P B;  2F8N B;  1ULY A;  3O62 C;  3AZJ B;  2Y2I A;  5CPJ B;  4H9Q A;  5C3I B;  1M18 B;  5B31 B;  1TAF B;  5AV8 C;  5BT1 D;  1EQZ C;  4R8P D;  3B6G B;  1HQ3 C;  3A6N B;  2YFV A;  3AZG A;  3REI C;  1B67 A;  3AZI B;  5B24 D;  4J8X C;  2NQB D;  3LZ1 A;  3AYW B;  4KGC A;  5B1M A;  3C1B C;  1P3B D;  3KXB B;  3LZ0 A;  1N1J A;  3KWQ D;  3KUY B;  4J8W D;  3REL C;  3AZF A;  4KUD D;  1ZLA A;  4WU8 B;  5BNV B;  1M1A D;  1F66 C;  3MVD D;  3REK A;  3AZH A;  1P3F D;  5GSU D;  1P3M A;  5B2J A;  3X1V D;  3LJA A;  4UPK A;  1AOI B;  4NE3 A;  5CPI B;  4AWL B;  3EG5 B;  2NZD D;  2FJ7 B;  1P3A A;  3C1C B;  5B32 D;  4X23 C;  3A1I A;  5B33 B;  1KX3 A;  3X1T B;  3AN2 C;  3UTA B;  2G5I C;  4XUJ A;  3AV2 B;  5AVB C;  4JJN C;  3X1U B;  1M19 B;  3UTB D;  1BH8 A;  5GT0 A;  4WU9 B;  1P3I C;  2ARO B;  3FDD A;  5DNN A;  5CPK A;  5B0Y C;  3X1S B;  4G92 B;  3AZN B;  2CWE A;  2PYO A;  3H0M C;  4J8V D;  5E5A D;  1P3P C;  3W96 A;  4J8U C;  3REH C;  1P3O B;  3NQU B;  4KHA B;  5B1L B;  1B6W A;  2BYK A;  3WKJ A;  5B2I D;  2JSS A;  4R8P B;  4YS3 C;  4ZUX A;  3AZK A;  1P3G C;  5AV6 C;  4HGA B;  5AV5 A;  3B6F A;  2NQB B;  3LEL D;  3MGP C;  3O62 A;  4E45 A;  5BO0 B;  2CV5 C;  3WA9 D;  1KX4 A;  5AV8 A;  4Z5T D;  1TZY B;  2F2A C;  3MVD B;  3MGS D;  1HQ3 A;  2HUE B;  3AZG C;  2Y2P A;  3REI A;  5AY8 B;  2F8N D;  4WZS B;  4UUZ A;  3AZJ D;  5B0Z B;  5CPJ D;  3UT9 D;  5B32 B;  1F66 A;  3B6G D;  1A7W A;  5B2J C;  3MNN B;  5AVC B;  3AFA D;  3MGQ B;  3AZI D;  1ID3 B;  3KXB D;  3KUY D;  5KDM A;  5JRG C;  1P3A C;  1HTA A;  4WU8 D;  3UTB B;  2HIO C;  3WAA C;  5FUG A;  3AV1 B;  4X23 A;  3TU4 D;  3W99 B;  1KX3 C;  3REJ D;  4CSR A;  4Z2M G;  3AN2 A;  1AOI D;  4J8V B;  5E5A B;  5CPI D;  4XUJ C;  1R4V A;  5AVB A;  1P3K B;  4QLC B;  4JJN A;  4WV4 B;  3C1C D;  5B24 C;  1P3I A;  1WWI A;  5DNN C;  5CPK C;  5B33 D;  3X1T D;  3W98 B;  3KWQ C;  4J8X B;  5BS7 C;  4Z2M H;  3MGR C;  3LEL B;  1P3P A;  1KX5 B;  1P3F C;  3C1B B;  3NQJ A;  5GSU C;  4NE5 A;  4J8U A;  3REH A;  1M19 D;  3REL B;  3X1V C;  5DNM B;  3P5J B;  4WU9 D;  5F99 C;  4YS3 A;  3MGS B;  1P3G A;  2XD1 A;  5AV6 A;  1BH9 A;  4H9R B;  2NZD C;  3AZN D;  3AZL C;  3MGP A;  3LZ0 D;  3AZM D;  1P3M C;  1P3O D;  2CV5 A;  1KX4 C;  5B1L D;  3UT9 B;  3REK D;  3AFA B;  5G49 B;  1T3U A;  5JA4 B;  5AV9 B;  2FJ7 A;  2DQN C;  3LJA D;  2LY8 A;  3WTP B;  5BNX A;  1TZY D;  3TU4 B;  4Z66 B;  5CP6 C;  4XZQ C;  3REJ B;  1U35 B;  5B40 A;  2YFW B;  4CAY B;  4DRB A;  5AY8 D;  5B2I C;  1P34 B;  5GXQ B;  1H3O B;  2ARO A;  5B0Z D;  4WNN A;  5JRG A;  3R45 A;  2HIO A;  4EO5 C;  4YM6 B;  3WAA A;  4LD9 B;  1JFI B;  4ZBJ B;  3MNN D;  5AVC D;  3MGQ D;  1S32 C;  3AZE B;  1ID3 D;  5GT3 B;  4Z5T C;  4H9Q B;  3V9R A;  1P3L C;  3W97 C;  3AV1 D;  5B24 A;  3W99 D;  3AZK D;  2RVQ D;  2YFV B;  3AZJ C;  1P3B A;  3AZG B;  5C3I C;  3KWQ A;  4J8W A;  4KUD A;  1M18 C;  3LZ1 B;  5B31 C;  5BS7 A;  4H9N A;  3MGR A;  4KGC B;  5B1M B;  1M1A A;  1P3K D;  1P3F A;  4QLC D;  3LZ0 B;  5GSU A;  1N1J B;  3A6N C;  3AZF B;  3AZM B;  3X1V A;  1ZLA B;  3AZI C;  5AV8 D;  1EQZ D;  2RIQ A;  5F99 A;  3AYW C;  5B31 G;  3REK B;  3AZH B;  1P3M B;  4H9O A;  1KU5 A;  5B2J B;  3KXB C;  3W98 D;  2NZD A;  3LJA B;  4J8X D;  3VH5 W;  3AZL A;  1KX5 D;  3C1B D;  3REL D;  5DNM D;  2F8N H;  1W2E A;  5CPI C;  1KX3 B;  2FJ7 C;  4NFT A;  5B33 C;  2BG1 A;  3X1T C;  1BH8 B;  5GT0 B;  3UTA C;  5DNN B;  5CP6 A;  5CPK B;  4XZQ A;  3AV2 C;  5B40 C;  5AV9 D;  2PYO B;  3X1U C;  1M19 C;  4WU9 C;  5B2I A;  2ARO C;  3W96 B;  5AVB D;  3WTP D;  3X1S C;  4G92 C;  3WKJ B;  2BYK B;  3AZN C;  3B0D B;  4Z66 D;  4ZUX B;  3AZK B;  3B0B A;  2JCH A;  1U35 D;  5B0Y D;  2W8S A;  2Y2J A;  3B0C W;  5AV5 B;  1S32 A;  3B6F B;  3WA9 A;  5B1L C;  1P34 D;  1P3P D;  5BT1 C;  4Z5T A;  4R8P C;  2BYM A;  5GXQ D;  3O62 B;  3REH D;  3A1K A;  1KX4 B;  3VH6 A;  1P3L A;  3W97 A;  5AV8 B;  4YM6 D;  2NQB C;  1EQZ B;  2IO5 C;  4H9P A;  4LD9 D;  3KFU G;  1P3G D;  1HQ3 B;  2F8N A;  3EPH A;  1P3B C;  3AZJ A;  3H0L C;  3REI B;  3AZE D;  4J8W C;  5CPJ A;  5GT3 D;  4KUD C;  1PZR A;  1M18 A;  1F1E A;  5B31 A;  1TAF A;  1BFM A;  1TZY C;  1M1A C;  4UUZ B;  2Y2G A;  3MVD C;  3B6G A;  2HUE C;  4DRA A;  3A6N A;  2CV5 D;  3AZI A;  1F66 B;  3AYW A;  5AY8 C;  2ZY3 A;  2ZY4 A;  5B0Z C;  3AZG D;  3KXB A;  3KUY A;  3LZ1 D;  4WU8 A;  4KGC D;  5B32 C;  5B1M D;  5BNV A;  1Z2C B;  3AZF D;  5KDM B;  3MNN C;  5AVC C;  1ZLA D;  1ID3 C;  5FUG B;  4X23 B;  1AOI A;  3AZH D;  1P3M D;  5CPI A;  3IP4 C;  5B32 G;  5B2J D;  4CSR B;  1WWS A;  3AN2 B;  3VH5 T;  3UTB C;  3C1C A;  3AV1 C;  2Y2K A;  5AVB B;  4JJN B;  5B33 A;  3X1T A;  1P3A D;  5JRG D;  3AL0 C;  3WAA D;  1P3I B;  2L5A A;  4J8V C;  5E5A C;  3UTA A;  1KX3 D;  3AV2 A;  1P3K C;  5B0Y B;  4QLC C;  3X1U A;  1M19 A;  4WU9 A;  1P3P B;  4XUJ D;  4J8U B;  3NQJ B;  3REH B;  3X1S A;  3W98 C;  5GT0 D;  3AZN A;  4YS3 B;  5DNN D;  3LEL C;  5CPK D;  1P3G B;  5AV6 B;  1BH9 B;  1KX5 C;  2PYO D;  3AZM A;  1P3O A;  3WA9 C;  3NQU A;  4KHA A;  5B1L A;  5DNM C;  2G5H C;  4G91 C;  3MGR D;  3EPK A;  3W96 D;  4R8P A;  3MGP B;  3MGS C;  2CV5 B;  3WKJ D;  2NQB A;  5F99 D;  4ZUX D;  3F6T A;  5CPJ C;  3B0C T;  5BO0 A;  5AV5 D;  3B6F D;  2VQR A;  3UT9 C;  3AZL D;  1TZY A;  3B6G C;  3MVD A;  3O62 D;  2F8N G;  1KX4 D;  3AFA C;  5AV9 C;  3VH6 W;  5BNX B;  5CHL B;  5AY8 A;  2J8P A;  1HQ3 D;  5B0Z A;  3WTP C;  3KUY C;  5B40 B;  3REI D;  4WU8 C;  4E44 A;  5B32 A;  3TU4 C;  4Z66 C;  3REJ C;  2Y2Q A;  1Q9C A;  4WNN B;  5JRG B;  3R45 B;  5AVC A;  3MNN A;  3MGQ A;  1U35 C;  1P3A B;  1ID3 A;  2HIO B;  3WAA B;  1AOI C;  1F66 D;  1P34 C;  5CP6 D;  4AWL C;  4NE6 A;  5GXQ C;  4XZQ D;  2DF4 C;  3C1C C;  3UTB A;  4YM6 C;  3AV1 A;  4XUJ B;  3W99 A;  4H9S A;  4LD9 C;  2ZM5 A;  4ZBJ C;  3V9R B;  3KSY A;  3AZE C;  5GT3 C;  3WTP E;  5B24 B;  2FFF B;  4X23 D;  2IO5 B;  5E5A A;  4J8V A;  1P3K A;  4M6B A;  4QLC A;  1P3B B;  3KWQ B;  1S32 D;  4J8W B;  4KUD B;  3AN2 D;  2UWX A;  3MGR B;  4H9N B;  2Y2O A;  1M1A B;  1EQZ A;  1P3F B;  4JJN D;  5GSU B;  3X1V B;  1P3L D;  3W98 A;  3W97 D;  1P3I D;  3LZ1 C;  5F99 B;  4J8X A;  4KGC C;  3LEL A;  5B1M C;  4H9O B;  1KX5 A;  3LZ0 C;  3C1B A;  3AZH C;  3EPJ A;  3AZF C;  3AZM C;  1P3O C;  2NZD B;  3REL A;  5DNM A;  1M18 D;  1ZLA C;  5B31 D;  2Y2N A;  3AZL B;  3REK C;  3H0R C;  4J8U D;  3MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...