5GXQD

The crystal structure of the nucleosome containing h3.6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 38
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqD00
3MGRA 4Z5TD 4DRBA 5B1MD 3AZJB 5B1LB 3C1BA 5B40C 5B1MB 5B24A 3B6GC 5AV6D 5DNMC 5AV6B 4YM6D 4AWLC 1KX3A 1BH9B 4Z66A 4YM6B 5C3IC 1HTAA 4JJNA 3AZNC 1KX5B 1EQZD 3W99A 3WA9D 2PYOB 4H9RA 5B32B 1P3KA 3TU4C 3B6FD 3AZHD 4CSRB 5AV9D 3B6FB 3O62A 3AZHB 4KUDC 4LD9A 3AV1A 3W97C 3MVDA 1M19C 3AZED 1M18C 2HUEB 1H3OB 3AZEB 3C1CC 5B0YA 3X1UC 1KX4B 5B33D 1P3FC 5AV8C 4X23A 1P3PD 1B67A 4ZBJC 3KWQA 4YS3D 1R4VA 1U35C 3MGQC 3A6NA 3LZ0A 4J8WD 3WTPD 3AZLD 5B31C 3MGSD 5CP6D 3MGSB 3RELC 4J8VB 4DRAA 4R8PD 3REHC 2BYKA 4R8PB 3UTAA 5BNVA 4NE3A 2CV5D 1P3AC 2F8NA 4XUJB 3X1VB 2NZDD 5B1LA 5CPID 5B31G 1AOIC 2AROA 3LZ1B 3V9RB 5CHLB 3B0CW 1P3BD 2HIOC 2NQBC 4H9QB 1P3BB 1ULYA 1HQ3B 3VH6A 3MGRB 3AZGC 3C1BD 5BT1D 1BH9A 3AYWA 1KX5A 5B24D 4EO5C 2PYOA 3WAAC 4Z2MG 5B32A 3UTBC 3AFAB 2IO5B 5B0ZC 2FJ7C 5AY8C 3LJAB 5CPJB 3AN2C 3AV2D 5AVBC 4WU8B 4Z66D 4CSRA 4JJND 1KX3D 3WA9C 3W99D 5AV5B 1KX3B 4Z66B 3LELC 3REIC 5AVCA 4H9RB 5B40B 1P3KD 3B6GB 5F99B 1P3LA 3O62D 1KX4A 4LD9D 1JFIB 3AV1D 4AWLB 4LD9B 4WU9A 3MVDD 3AV1B 4H9OB 2L5AA 3MVDB 3AZKC 5B0YD 3AZFC 3WTPE 3B0DC 4G91B 3TU4B 5GT0C 4X23D 3KWQD 5GXQC 4X23B 4WNNB 4J8VA 4KUDB 3KWQB 1ID3A 5BO0B 3A6ND 3LZ0D 4J8WC 3MGPC 3REJC 3LZ0B 3AZIC 5JA4A 4XUJA 3C1CB 1P3MC 1M1AD 3LZ1A 1P3FB 5DNNC 2BYKB 5AV8B 3UTAD 4ZBJB 4QLCC 2RVQD 2CV5C 4H9QA 5JRGC 3UTAB 4NFTA 5BNVB 4J8UB 1HQ3A 4HGAB 5BS7A 5B1LD 2F8NB 2AROD 4KHAB 1ZLAA 4XZQB 1S32C 2AROB 3UT9C 4J8XC 3AFAA 3X1SA 3REHB 3LJAA 5CPJA 5BT1C 2BYMB 4H9NB 5B2JA 4WU8A 1P34C 5AV5A 1KX5D 5B24C 2PYOD 5B2IA 3AYWB 5B32D 1P3AB 4KGCC 1AOIB 5B40A 3AV2C 5BNXB 3B6GA 5F99A 3W99C 5DNMA 3MNNC 1JFIA 2YFWB 4H9OA 4WZSB 5AVCB 3AZNA 4EO5B 4ZUXC 3WKJC 3UTBB 1P3LD 1WWSA 1KX4D 3KUYC 2YFVA 1P3LB 1Q9CA 3TU4A 1P3IC 4WU9D 3AN2B 5AVBB 5FUGA 4E44A 4WU9B 4WNNA 5E5AC 4KUDA 3LELB 3VH5T 3W97A 5BO0A 5GT3C 1M19A 5GSUC 3X1TC 1N1JB 3W98C 3NQJB 1P3GC 3C1CA 3X1UA 4J8VD 3REKC 1ID3D 2LY8A 4UUZA 1P3FA 5AV8A 1ID3B 3KXBC 1U35A 4J8UA 1P3OC 4XUJD 1TZYC 3AZKB 1F66C 3X1VD 3AZFB 5JA4B 3B0DB 4KHAA 3LZ1D 4XZQA 3AZMC 5CPKC 3W96C 3RELA 3REHA 1M1AC 1HQ3D 3AZJC 3MGRD 5B1LC 2BYMA 4H9NA 4Z5TC 1BFMA 5B1MC 3REJB 1ZLAD 1P3AA 1ZLAB 4NE5A 3AFAD 1P3MB 5AV6C 1AOIA 3LJAD 5CPJD 5DNNB 3X1SB 5BNXA 4WU8D 4YM6C 2F8NH 2HIOA 5AV5D 4QLCB 4WV4B 5B2ID 5JRGB 5B2JB 1EQZC 2NQBA 2PYOC 5B2IB 2YFWA 3AZGA 5B40D 3B6GD 1S32B 5F99D 3WAAA 3UTBA 3B6FC 5DNMD 3AZHC 4J8XB 5AV9C 5B0ZA 5DNMB 2FJ7A 5AY8A 3AN2A 1B6WA 5AVBA 3WA9A 3AZND 5B32G 2HUEC 5C3IB 3LELA 3AZEC 3AZNB 2F8NK 3REIA 5B33C 3TU4D 1N1JA 2YFVB 3NQJA 1P3PC 4KUDD 5FUGB 4YS3C 3VH5W 1M19D 3W97B 5KDMB 1M19B 3WTPC 3AZKA 3AZLC 1M18B 3WKJB 3MGSC 3C1CD 3X1UD 3AZFA 4H9SA 5CP6C 3X1UB 1P3FD 4R8PC 5GT0A 5AV8D 4UUZB 5GXQA 1U35D 4J8UD 3X1VC 1U35B 2F8ND 5GT3B 3MGQB 4J8WA 3MGPA 2NZDC 5GSUB 3REJA 4XZQD 5CPIC 3AZIA 1P3GB 5B31B 3RELD 3REKB 1P3BC 3REHD 4G92C 1P3MA 3RELB 3MGRC 5DNNA 4QLCA 3C1BC 3KXBB 2CV5A 5JRGA 3AYWD 1P3AD 1WWIA 1F66B 3AFAC 1AOID 1F1EA 5CPJC 1S32A 3UT9A 1KX3C 4Z66C 4JJNC 4J8XA 3W96B 2HIOB 1M1AB 2NQBB 3AZGD 4Z5TB 1P34A 5AVCD 3AZGB 5F99C 1P3KC 1BH8A 3UTBD 3WAAD 3VH5A 4KGCA 3WAAB 5B0ZD 3O62C 2FJ7D 5AY8D 4LD9C 3AN2D 3AV2A 5AVBD 5B0ZB 3AV1C 2FJ7B 5AY8B 3MVDC 3B0BA 1EQZB 3MNNA 3WA9B 3LELD 3REID 4G91C 1TAFB 5B0YC 4H9PA 5KDMA 3REIB 3VH6W 4ZUXA 3WKJA 1M18A 4X23C 3KWQC 3KUYA 5AV9B 1P3IA 3A6NC 3LZ0C 5E5AA 1KU5A 3AZKD 3AZFD 5GT3A 3MGQA 5GSUA 3X1TA 5B33B 4E45A 5GT0D 3W98A 1P3GA 5GXQD 5GT0B 5B31A 1P3PB 3REKA 3UTAC 4J8UC 3R45B 4YS3B 2RVQC 5GXQB 4HGAC 3MGPD 3REJD 4XZQC 3KXBA 3NQUA 4J8WB 3AZID 3MGPB 2AROC 1P3OA 3WTPB 1TZYA 3AZLB 1F66A 3AZIB 1P3MD 5CP6B 3KSYA 5DNND 3X1SD 3AZMA 4QLCD 5CPKA 3W96A 5JRGD 5B2JD 3AYWC 5G49B 1M1AA 1KX5C 2F8NG 2CV5B 3AZJA 5B32C 4Z5TA 5B1MA 2NZDB 4CAYB 1S32D 5CPIB 3UT9D 4J8XD 4G92B 5AV6A 3UT9B 4NE6A 1P34D 4YM6A 5AVCC 3C1BB 1EQZA 1P34B 4Z2MH 5B24B 4KGCD 1BH8B 1P3LC 1TAFA 1KX4C 4KGCB 3VH6T 4WU9C 3B6FA 3AV2B 3AZHA 3MNND 4JJNB 5AV9A 3W99B 2JSSA 3MNNB 3W97D 4ZUXD 4H9PB 1P3KB 1H3OA 3AZEA 1M18D 3WKJD 4ZUXB 3KUYD 3O62B 4J8VC 5B33A 1P3ID 3KUYB 1ID3C 1P3IB 1P3PA 5E5AD 3R45A 4YS3A 5E5AB 4M6BA 4H9SC 5GT3D 4XUJC 3MGQD 5GSUD 5B0YB 3X1TD 3W98D 1P3GD 3LZ1C 3WTPA 3X1TB 3AZLA 5B31D 3MGSA 3W98B 3REKD 5CP6A 4R8PA 5CPKB 1HQ3C 5BS7C 2CWEA 3KXBD 3A6NB 5G49A 1P3OD 1F66D 1TZYD 1ZLAC 3NQUB 1A7WA 3X1VA 1P3OB 1TZYB 2NZDA 2IO5C 3V9RA 4CAYA 3X1SC 3AZMD 5CPIA 3LJAC 3B0CT 4WU8C 5CPKD 5B2JC 3AZMB 3W96D 1P3BA 2HIOD 5AV5C 2NQBD 5B2IC 3AZJD
chains in the Genus database with same CATH superfamily
3MGRA 3A1IA 4Z5TD 4DRBA 5B1MD 3EPKA 3AZJB 5B1LB 3C1BA 5B40C 5B1MB 5B24A 3B6GC 5AV6D 5DNMC 5AV6B 4YM6D 4AWLC 1KX3A 1BH9B 4Z66A 4YM6B 5C3IC 1HTAA 4JJNA 3AZNC 1KX5B 1EQZD 3W99A 3WA9D 2W8SA 2PYOB 4H9RA 5B32B 1P3KA 3TU4C 3B6FD 2ZM5A 3AZHD 4CSRB 5AV9D 3B6FB 3O62A 3AZHB 4KUDC 4LD9A 3AV1A 3W97C 3MVDA 1M19C 3H0RC 3AZED 1PZRA 1M18C 2HUEB 1H3OB 3AZEB 3C1CC 5B0YA 3X1UC 1KX4B 5B33D 1P3FC 5AV8C 4X23A 1P3PD 1B67A 4ZBJC 3KWQA 4YS3D 1R4VA 1U35C 3MGQC 1Z2CB 2Y2LA 3A6NA 3LZ0A 4J8WD 3WTPD 3AZLD 5B31C 3MGSD 5CP6D 3MGSB 3RELC 4J8VB 4DRAA 4R8PD 3REHC 2BYKA 4R8PB 3UTAA 5BNVA 1T3UA 4NE3A 2CV5D 1P3AC 2F8NA 4XUJB 3X1VB 2NZDD 5B1LA 3H0LC 5CPID 5B31G 1AOIC 2AROA 3LZ1B 3V9RB 5CHLB 3B0CW 1P3BD 2HIOC 2NQBC 4H9QB 1P3BB 4WJ3C 1ULYA 1HQ3B 3VH6A 3MGRB 3AZGC 3C1BD 5BT1D 1BH9A 3AYWA 1KX5A 5B24D 4EO5C 2PYOA 3WAAC 4Z2MG 5B32A 3UTBC 2ZY3A 3AFAB 2IO5B 5B0ZC 2FJ7C 5AY8C 3LJAB 2Y2JA 5CPJB 3AN2C 3AV2D 5AVBC 4WU8B 4Z66D 4CSRA 4JJND 1KX3D 3WA9C 3W99D 5AV5B 1KX3B 4Z66B 3LELC 3REIC 5AVCA 4H9RB 5B40B 1P3KD 3B6GB 3A1KA 5F99B 1P3LA 3O62D 1KX4A 4LD9D 1JFIB 3AV1D 4AWLB 4LD9B 4WU9A 3MVDD 3AV1B 4H9OB 2L5AA 2G5HC 3MVDB 3AZKC 5B0YD 3AZFC 3WTPE 3B0DC 4G91B 3TU4B 5GT0C 4X23D 3KWQD 5GXQC 4X23B 4WNNB 4J8VA 4KUDB 3KWQB 1ID3A 2J8PA 5BO0B 3A6ND 3LZ0D 4J8WC 3MGPC 3REJC 2DF4C 3LZ0B 3AZIC 5JA4A 4XUJA 3C1CB 1P3MC 1M1AD 3LZ1A 1P3FB 5DNNC 2BYKB 5AV8B 3UTAD 4ZBJB 4QLCC 2RVQD 2CV5C 4H9QA 5JRGC 3UTAB 4NFTA 5BNVB 4J8UB 1HQ3A 4HGAB 5BS7A 5B1LD 2F8NB 2AROD 4KHAB 1ZLAA 4XZQB 1S32C 2AROB 3UT9C 4J8XC 3AFAA 3X1SA 3REHB 3LJAA 5CPJA 5BT1C 2BYMB 4H9NB 5B2JA 4WU8A 1P34C 5AV5A 1KX5D 5B24C 2PYOD 5B2IA 3AYWB 5B32D 1P3AB 4KGCC 1AOIB 5B40A 3AV2C 5BNXB 3B6GA 5F99A 3W99C 5DNMA 3MNNC 1JFIA 2BG1A 2YFWB 2UWXA 4H9OA 4WZSB 5AVCB 3AZNA 4EO5B 4ZUXC 3WKJC 3UTBB 1P3LD 1WWSA 1KX4D 3KUYC 2YFVA 1P3LB 2XD1A 1Q9CA 3TU4A 1P3IC 4WU9D 3AN2B 5AVBB 5FUGA 4E44A 4WU9B 4WNNA 5E5AC 4KUDA 2Y2MA 3VH5T 3LELB 3W97A 1W2EA 5BO0A 5GT3C 1M19A 5GSUC 3X1TC 1N1JB 3W98C 3NQJB 1P3GC 2F2AC 3C1CA 3X1UA 4J8VD 3REKC 1ID3D 2LY8A 4UUZA 1P3FA 5AV8A 1ID3B 3KXBC 1U35A 4J8UA 1P3OC 4XUJD 1TZYC 3AZKB 1F66C 3X1VD 3AZFB 5JA4B 3B0DB 3EPLA 3EG5B 4KHAA 3LZ1D 2XD5A 4XZQA 2DQNC 3AZMC 5CPKC 3W96C 3RELA 3REHA 1M1AC 1HQ3D 3AZJC 3MGRD 5B1LC 2BYMA 4H9NA 4Z5TC 1BFMA 5B1MC 2ZY2A 3REJB 1ZLAD 3KFUG 1P3AA 1ZLAB 4NE5A 3AFAD 1P3MB 5AV6C 1AOIA 2JE5A 3LJAD 5CPJD 5DNNB 3X1SB 5BNXA 4WU8D 4YM6C 2Y2QA 2F8NH 2HIOA 5AV5D 4QLCB 4WV4B 5B2ID 5JRGB 5B2JB 1EQZC 2NQBA 2PYOC 5B2IB 2YFWA 3AZGA 5B40D 3B6GD 1S32B 5F99D 3WAAA 3UTBA 3B6FC 5DNMD 3AZHC 4J8XB 5AV9C 5B0ZA 5DNMB 2Y2IA 5AY8A 2FJ7A 3AN2A 1B6WA 5AVBA 2ZY5A 3WA9A 3AZND 5B32G 2HUEC 5C3IB 3LELA 2Y2GA 3AZEC 3AZNB 2F8NK 3REIA 5B33C 3TU4D 1N1JA 2YFVB 3NQJA 1P3PC 2Y2NA 4KUDD 5FUGB 4YS3C 3EPJA 3P5JB 3VH5W 1M19D 3W97B 2Y2OA 5KDMB 1M19B 3WTPC 3AZKA 3AZLC 1M18B 3WKJB 3MGSC 3C1CD 3X1UD 3AZFA 4H9SA 5CP6C 3X1UB 1P3FD 4R8PC 5GT0A 5AV8D 4UUZB 5GXQA 1U35D 4J8UD 3X1VC 1U35B 2F8ND 5GT3B 3MGQB 4J8WA 3MGPA 2NZDC 5GSUB 3REJA 4XZQD 5CPIC 3AZIA 1P3GB 5B31B 3RELD 3REKB 1P3BC 3REHD 4G92C 1P3MA 3RELB 3MGRC 5DNNA 4QLCA 3C1BC 3KXBB 2CV5A 5JRGA 3AYWD 1P3AD 1WWIA 1F66B 2G5IC 3AFAC 1AOID 1F1EA 3H0MC 5CPJC 1S32A 3UT9A 1KX3C 4Z66C 4JJNC 4J8XA 3W96B 2HIOB 4UPKA 1M1AB 2NQBB 3AZGD 2FFFB 4Z5TB 1P34A 5AVCD 3AZGB 5F99C 1P3KC 1BH8A 3UTBD 3WAAD 3VH5A 4KGCA 3WAAB 5B0ZD 3O62C 2FJ7D 5AY8D 4LD9C 3AL0C 3AN2D 3AV2A 5AVBD 5B0ZB 3AV1C 2FJ7B 5AY8B 3MVDC 3B0BA 1EQZB 3MNNA 3WA9B 3LELD 3REID 4G91C 1TAFB 5B0YC 4H9PA 5KDMA 3REIB 3VH6W 4ZUXA 3WKJA 1M18A 4X23C 3KWQC 3KUYA 5AV9B 1P3IA 3A6NC 3LZ0C 5E5AA 1KU5A 2JCHA 3AZKD 3AZFD 5GT3A 3MGQA 5GSUA 3X1TA 5B33B 4E45A 5GT0D 3W98A 1P3GA 5GXQD 5GT0B 5B31A 1P3PB 3REKA 3UTAC 4J8UC 3R45B 4YS3B 2RVQC 5GXQB 4HGAC 3F6TA 2Y2PA 3MGPD 3REJD 4XZQC 3KXBA 2VQRA 3NQUA 4J8WB 3AZID 3MGPB 2AROC 1P3OA 3WTPB 1TZYA 3AZLB 1F66A 3AZIB 1P3MD 5CP6B 3KSYA 5DNND 3X1SD 3AZMA 4QLCD 2RIQA 5CPKA 3W96A 5JRGD 5B2JD 3AYWC 5G49B 1M1AA 1KX5C 2F8NG 2CV5B 3AZJA 5B32C 4Z5TA 5B1MA 2NZDB 4CAYB 1S32D 5CPIB 3UT9D 4J8XD 4G92B 5AV6A 3UT9B 4NE6A 1P34D 4YM6A 2Y2KA 5AVCC 3C1BB 4DQYB 1EQZA 1P34B 4Z2MH 2Y2HA 5B24B 4KGCD 1BH8B 1P3LC 1TAFA 1KX4C 4KGCB 3VH6T 4WU9C 3B6FA 3AV2B 3AZHA 3MNND 4JJNB 5AV9A 3W99B 2JSSA 3MNNB 3W97D 4ZUXD 4H9PB 3IP4C 1P3KB 1H3OA 3AZEA 1M18D 3WKJD 4ZUXB 3FDDA 3KUYD 3O62B 4J8VC 5B33A 1P3ID 3KUYB 1ID3C 1P3IB 1P3PA 5E5AD 3R45A 4YS3A 5E5AB 4M6BA 4H9SC 5GT3D 4XUJC 3MGQD 5GSUD 5B0YB 3X1TD 3EPHA 3W98D 1P3GD 3LZ1C 3WTPA 3X1TB 3AZLA 5B31D 3MGSA 3W98B 3REKD 5CP6A 4R8PA 5CPKB 1HQ3C 5BS7C 2CWEA 3KXBD 3A6NB 5G49A 1P3OD 1F66D 1TZYD 1ZLAC 3NQUB 1A7WA 3X1VA 1P3OB 1TZYB 2NZDA 2IO5C 3V9RA 4CAYA 3X1SC 3AZMD 5CPIA 3LJAC 2ZY4A 3B0CT 4WU8C 5CPKD 5B2JC 3AZMB 3W96D 1P3BA 2HIOD 5AV5C 2NQBD 5B2IC 3AZJD
chains in the Genus database with same CATH topology
3MGRA 3A1IA 4Z5TD 4DRBA 5B1MD 3EPKA 3AZJB 5B1LB 3C1BA 5B40C 5B1MB 5B24A 3B6GC 5AV6D 5DNMC 5AV6B 4YM6D 4AWLC 1KX3A 1BH9B 4Z66A 4YM6B 5C3IC 1HTAA 4JJNA 3AZNC 1KX5B 1EQZD 3W99A 3WA9D 2W8SA 2PYOB 4H9RA 5B32B 1P3KA 3TU4C 3B6FD 2ZM5A 3AZHD 4CSRB 5AV9D 3B6FB 3O62A 3AZHB 4KUDC 4LD9A 3AV1A 3W97C 3MVDA 1M19C 3H0RC 3AZED 1PZRA 1M18C 2HUEB 1H3OB 3AZEB 3C1CC 5B0YA 3X1UC 1KX4B 5B33D 1P3FC 5AV8C 4X23A 1P3PD 1B67A 4ZBJC 3KWQA 4YS3D 1R4VA 1U35C 3MGQC 1Z2CB 2Y2LA 3A6NA 3LZ0A 4J8WD 3WTPD 3AZLD 5B31C 3MGSD 5CP6D 3MGSB 3RELC 4J8VB 4DRAA 4R8PD 3REHC 2BYKA 4R8PB 3UTAA 5BNVA 1T3UA 4NE3A 2CV5D 1P3AC 2F8NA 4XUJB 3X1VB 2NZDD 5B1LA 3H0LC 5CPID 5B31G 1AOIC 2AROA 3LZ1B 3V9RB 5CHLB 3B0CW 1P3BD 2HIOC 2NQBC 4H9QB 1P3BB 4WJ3C 1ULYA 1HQ3B 3VH6A 3MGRB 3AZGC 3C1BD 5BT1D 1BH9A 3AYWA 1KX5A 5B24D 4EO5C 2PYOA 3WAAC 4Z2MG 5B32A 3UTBC 2ZY3A 3AFAB 2IO5B 5B0ZC 2FJ7C 5AY8C 3LJAB 2Y2JA 5CPJB 3AN2C 3AV2D 5AVBC 4WU8B 4Z66D 4CSRA 4JJND 1KX3D 3WA9C 3W99D 5AV5B 1KX3B 4Z66B 3LELC 3REIC 5AVCA 4H9RB 5B40B 1P3KD 3B6GB 3A1KA 5F99B 1P3LA 3O62D 1KX4A 4LD9D 1JFIB 3AV1D 4AWLB 4LD9B 4WU9A 3MVDD 3AV1B 4H9OB 2L5AA 2G5HC 3MVDB 3AZKC 5B0YD 3AZFC 3WTPE 3B0DC 4G91B 3TU4B 5GT0C 4X23D 3KWQD 5GXQC 4X23B 4WNNB 4J8VA 4KUDB 3KWQB 1ID3A 2J8PA 5BO0B 3A6ND 3LZ0D 4J8WC 3MGPC 3REJC 2DF4C 3LZ0B 3AZIC 5JA4A 4XUJA 3C1CB 1P3MC 1M1AD 3LZ1A 1P3FB 5DNNC 2BYKB 5AV8B 3UTAD 4ZBJB 4QLCC 2RVQD 2CV5C 4H9QA 5JRGC 3UTAB 4NFTA 5BNVB 4J8UB 1HQ3A 4HGAB 5BS7A 5B1LD 2F8NB 2AROD 4KHAB 1ZLAA 4XZQB 1S32C 2AROB 3UT9C 4J8XC 3AFAA 3X1SA 3REHB 3LJAA 5CPJA 5BT1C 2BYMB 4H9NB 5B2JA 4WU8A 1P34C 5AV5A 1KX5D 5B24C 2PYOD 5B2IA 3AYWB 5B32D 1P3AB 4KGCC 1AOIB 5B40A 3AV2C 5BNXB 3B6GA 5F99A 3W99C 5DNMA 3MNNC 1JFIA 2BG1A 2YFWB 2UWXA 4H9OA 4WZSB 5AVCB 3AZNA 4EO5B 4ZUXC 3WKJC 3UTBB 1P3LD 1WWSA 1KX4D 3KUYC 2YFVA 1P3LB 2XD1A 1Q9CA 3TU4A 1P3IC 4WU9D 3AN2B 5AVBB 5FUGA 4E44A 4WU9B 4WNNA 5E5AC 4KUDA 2Y2MA 3VH5T 3LELB 3W97A 1W2EA 5BO0A 5GT3C 1M19A 5GSUC 3X1TC 1N1JB 3W98C 3NQJB 1P3GC 2F2AC 3C1CA 3X1UA 4J8VD 3REKC 1ID3D 2LY8A 4UUZA 1P3FA 5AV8A 1ID3B 3KXBC 1U35A 4J8UA 1P3OC 4XUJD 1TZYC 3AZKB 1F66C 3X1VD 3AZFB 5JA4B 3B0DB 3EPLA 3EG5B 4KHAA 3LZ1D 2XD5A 4XZQA 2DQNC 3AZMC 5CPKC 3W96C 3RELA 3REHA 1M1AC 1HQ3D 3AZJC 3MGRD 5B1LC 2BYMA 4H9NA 4Z5TC 1BFMA 5B1MC 2ZY2A 3REJB 1ZLAD 3KFUG 1P3AA 1ZLAB 4NE5A 3AFAD 1P3MB 5AV6C 1AOIA 2JE5A 3LJAD 5CPJD 5DNNB 3X1SB 5BNXA 4WU8D 4YM6C 2Y2QA 2F8NH 2HIOA 5AV5D 4QLCB 4WV4B 5B2ID 5JRGB 5B2JB 1EQZC 2NQBA 2PYOC 5B2IB 2YFWA 3AZGA 5B40D 3B6GD 1S32B 5F99D 3WAAA 3UTBA 3B6FC 5DNMD 3AZHC 4J8XB 5AV9C 5B0ZA 5DNMB 2Y2IA 5AY8A 2FJ7A 3AN2A 1B6WA 5AVBA 2ZY5A 3WA9A 3AZND 5B32G 2HUEC 5C3IB 3LELA 2Y2GA 3AZEC 3AZNB 2F8NK 3REIA 5B33C 3TU4D 1N1JA 2YFVB 3NQJA 1P3PC 2Y2NA 4KUDD 5FUGB 4YS3C 3EPJA 3P5JB 3VH5W 1M19D 3W97B 2Y2OA 5KDMB 1M19B 3WTPC 3AZKA 3AZLC 1M18B 3WKJB 3MGSC 3C1CD 3X1UD 3AZFA 4H9SA 5CP6C 3X1UB 1P3FD 4R8PC 5GT0A 5AV8D 4UUZB 5GXQA 1U35D 4J8UD 3X1VC 1U35B 2F8ND 5GT3B 3MGQB 4J8WA 3MGPA 2NZDC 5GSUB 3REJA 4XZQD 5CPIC 3AZIA 1P3GB 5B31B 3RELD 3REKB 1P3BC 3REHD 4G92C 1P3MA 3RELB 3MGRC 5DNNA 4QLCA 3C1BC 3KXBB 2CV5A 5JRGA 3AYWD 1P3AD 1WWIA 1F66B 2G5IC 3AFAC 1AOID 1F1EA 3H0MC 5CPJC 1S32A 3UT9A 1KX3C 4Z66C 4JJNC 4J8XA 3W96B 2HIOB 4UPKA 1M1AB 2NQBB 3AZGD 2FFFB 4Z5TB 1P34A 5AVCD 3AZGB 5F99C 1P3KC 1BH8A 3UTBD 3WAAD 3VH5A 4KGCA 3WAAB 5B0ZD 3O62C 2FJ7D 5AY8D 4LD9C 3AL0C 3AN2D 3AV2A 5AVBD 5B0ZB 3AV1C 2FJ7B 5AY8B 3MVDC 3B0BA 1EQZB 3MNNA 3WA9B 3LELD 3REID 4G91C 1TAFB 5B0YC 4H9PA 5KDMA 3REIB 3VH6W 4ZUXA 3WKJA 1M18A 4X23C 3KWQC 3KUYA 5AV9B 1P3IA 3A6NC 3LZ0C 5E5AA 1KU5A 2JCHA 3AZKD 3AZFD 5GT3A 3MGQA 5GSUA 3X1TA 5B33B 4E45A 5GT0D 3W98A 1P3GA 5GXQD 5GT0B 5B31A 1P3PB 3REKA 3UTAC 4J8UC 3R45B 4YS3B 2RVQC 5GXQB 4HGAC 3F6TA 2Y2PA 3MGPD 3REJD 4XZQC 3KXBA 2VQRA 3NQUA 4J8WB 3AZID 3MGPB 2AROC 1P3OA 3WTPB 1TZYA 3AZLB 1F66A 3AZIB 1P3MD 5CP6B 3KSYA 5DNND 3X1SD 3AZMA 4QLCD 2RIQA 5CPKA 3W96A 5JRGD 5B2JD 3AYWC 5G49B 1M1AA 1KX5C 2F8NG 2CV5B 3AZJA 5B32C 4Z5TA 5B1MA 2NZDB 4CAYB 1S32D 5CPIB 3UT9D 4J8XD 4G92B 5AV6A 3UT9B 4NE6A 1P34D 4YM6A 2Y2KA 5AVCC 3C1BB 4DQYB 1EQZA 1P34B 4Z2MH 2Y2HA 5B24B 4KGCD 1BH8B 1P3LC 1TAFA 1KX4C 4KGCB 3VH6T 4WU9C 3B6FA 3AV2B 3AZHA 3MNND 4JJNB 5AV9A 3W99B 2JSSA 3MNNB 3W97D 4ZUXD 4H9PB 3IP4C 1P3KB 1H3OA 3AZEA 1M18D 3WKJD 4ZUXB 3FDDA 3KUYD 3O62B 4J8VC 5B33A 1P3ID 3KUYB 1ID3C 1P3IB 1P3PA 5E5AD 3R45A 4YS3A 5E5AB 4M6BA 4H9SC 5GT3D 4XUJC 3MGQD 5GSUD 5B0YB 3X1TD 3EPHA 3W98D 1P3GD 3LZ1C 3WTPA 3X1TB 3AZLA 5B31D 3MGSA 3W98B 3REKD 5CP6A 4R8PA 5CPKB 1HQ3C 5BS7C 2CWEA 3KXBD 3A6NB 5G49A 1P3OD 1F66D 1TZYD 1ZLAC 3NQUB 1A7WA 3X1VA 1P3OB 1TZYB 2NZDA 2IO5C 3V9RA 4CAYA 3X1SC 3AZMD 5CPIA 3LJAC 2ZY4A 3B0CT 4WU8C 5CPKD 5B2JC 3AZMB 3W96D 1P3BA 2HIOD 5AV5C 2NQBD 5B2IC 3AZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR A;  4Z5T D;  4DRB A;  5B1M D;  3AZJ B;  5B1L B;  3C1B A;  5B40 C;  5B1M B;  5B24 A;  3B6G C;  5AV6 D;  5DNM C;  5AV6 B;  4YM6 D;  4AWL C;  1KX3 A;  1BH9 B;  4Z66 A;  4YM6 B;  5C3I C;  1HTA A;  4JJN A;  3AZN C;  1KX5 B;  1EQZ D;  3W99 A;  3WA9 D;  2PYO B;  4H9R A;  5B32 B;  1P3K A;  3TU4 C;  3B6F D;  3AZH D;  4CSR B;  5AV9 D;  3B6F B;  3O62 A;  3AZH B;  4KUD C;  4LD9 A;  3AV1 A;  3W97 C;  3MVD A;  1M19 C;  3AZE D;  1M18 C;  2HUE B;  1H3O B;  3AZE B;  3C1C C;  5B0Y A;  3X1U C;  1KX4 B;  5B33 D;  1P3F C;  5AV8 C;  4X23 A;  1P3P D;  1B67 A;  4ZBJ C;  3KWQ A;  4YS3 D;  1R4V A;  1U35 C;  3MGQ C;  3A6N A;  3LZ0 A;  4J8W D;  3WTP D;  3AZL D;  5B31 C;  3MGS D;  5CP6 D;  3MGS B;  3REL C;  4J8V B;  4DRA A;  4R8P D;  3REH C;  2BYK A;  4R8P B;  3UTA A;  5BNV A;  4NE3 A;  2CV5 D;  1P3A C;  2F8N A;  4XUJ B;  3X1V B;  2NZD D;  5B1L A;  5CPI D;  5B31 G;  1AOI C;  2ARO A;  3LZ1 B;  3V9R B;  5CHL B;  3B0C W;  1P3B D;  2HIO C;  2NQB C;  4H9Q B;  1P3B B;  1ULY A;  1HQ3 B;  3VH6 A;  3MGR B;  3AZG C;  3C1B D;  5BT1 D;  1BH9 A;  3AYW A;  1KX5 A;  5B24 D;  4EO5 C;  2PYO A;  3WAA C;  4Z2M G;  5B32 A;  3UTB C;  3AFA B;  2IO5 B;  5B0Z C;  2FJ7 C;  5AY8 C;  3LJA B;  5CPJ B;  3AN2 C;  3AV2 D;  5AVB C;  4WU8 B;  4Z66 D;  4CSR A;  4JJN D;  1KX3 D;  3WA9 C;  3W99 D;  5AV5 B;  1KX3 B;  4Z66 B;  3LEL C;  3REI C;  5AVC A;  4H9R B;  5B40 B;  1P3K D;  3B6G B;  5F99 B;  1P3L A;  3O62 D;  1KX4 A;  4LD9 D;  1JFI B;  3AV1 D;  4AWL B;  4LD9 B;  4WU9 A;  3MVD D;  3AV1 B;  4H9O B;  2L5A A;  3MVD B;  3AZK C;  5B0Y D;  3AZF C;  3WTP E;  3B0D C;  4G91 B;  3TU4 B;  5GT0 C;  4X23 D;  3KWQ D;  5GXQ C;  4X23 B;  4WNN B;  4J8V A;  4KUD B;  3KWQ B;  1ID3 A;  5BO0 B;  3A6N D;  3LZ0 D;  4J8W C;  3MGP C;  3REJ C;  3LZ0 B;  3AZI C;  5JA4 A;  4XUJ A;  3C1C B;  1P3M C;  1M1A D;  3LZ1 A;  1P3F B;  5DNN C;  2BYK B;  5AV8 B;  3UTA D;  4ZBJ B;  4QLC C;  2RVQ D;  2CV5 C;  4H9Q A;  5JRG C;  3UTA B;  4NFT A;  5BNV B;  4J8U B;  1HQ3 A;  4HGA B;  5BS7 A;  5B1L D;  2F8N B;  2ARO D;  4KHA B;  1ZLA A;  4XZQ B;  1S32 C;  2ARO B;  3UT9 C;  4J8X C;  3AFA A;  3X1S A;  3REH B;  3LJA A;  5CPJ A;  5BT1 C;  2BYM B;  4H9N B;  5B2J A;  4WU8 A;  1P34 C;  5AV5 A;  1KX5 D;  5B24 C;  2PYO D;  5B2I A;  3AYW B;  5B32 D;  1P3A B;  4KGC C;  1AOI B;  5B40 A;  3AV2 C;  5BNX B;  3B6G A;  5F99 A;  3W99 C;  5DNM A;  3MNN C;  1JFI A;  2YFW B;  4H9O A;  4WZS B;  5AVC B;  3AZN A;  4EO5 B;  4ZUX C;  3WKJ C;  3UTB B;  1P3L D;  1WWS A;  1KX4 D;  3KUY C;  2YFV A;  1P3L B;  1Q9C A;  3TU4 A;  1P3I C;  4WU9 D;  3AN2 B;  5AVB B;  5FUG A;  4E44 A;  4WU9 B;  4WNN A;  5E5A C;  4KUD A;  3LEL B;  3VH5 T;  3W97 A;  5BO0 A;  5GT3 C;  1M19 A;  5GSU C;  3X1T C;  1N1J B;  3W98 C;  3NQJ B;  1P3G C;  3C1C A;  3X1U A;  4J8V D;  3REK C;  1ID3 D;  2LY8 A;  4UUZ A;  1P3F A;  5AV8 A;  1ID3 B;  3KXB C;  1U35 A;  4J8U A;  1P3O C;  4XUJ D;  1TZY C;  3AZK B;  1F66 C;  3X1V D;  3AZF B;  5JA4 B;  3B0D B;  4KHA A;  3LZ1 D;  4XZQ A;  3AZM C;  5CPK C;  3W96 C;  3REL A;  3REH A;  1M1A C;  1HQ3 D;  3AZJ C;  3MGR D;  5B1L C;  2BYM A;  4H9N A;  4Z5T C;  1BFM A;  5B1M C;  3REJ B;  1ZLA D;  1P3A A;  1ZLA B;  4NE5 A;  3AFA D;  1P3M B;  5AV6 C;  1AOI A;  3LJA D;  5CPJ D;  5DNN B;  3X1S B;  5BNX A;  4WU8 D;  4YM6 C;  2F8N H;  2HIO A;  5AV5 D;  4QLC B;  4WV4 B;  5B2I D;  5JRG B;  5B2J B;  1EQZ C;  2NQB A;  2PYO C;  5B2I B;  2YFW A;  3AZG A;  5B40 D;  3B6G D;  1S32 B;  5F99 D;  3WAA A;  3UTB A;  3B6F C;  5DNM D;  3AZH C;  4J8X B;  5AV9 C;  5B0Z A;  5DNM B;  2FJ7 A;  5AY8 A;  3AN2 A;  1B6W A;  5AVB A;  3WA9 A;  3AZN D;  5B32 G;  2HUE C;  5C3I B;  3LEL A;  3AZE C;  3AZN B;  2F8N K;  3REI A;  5B33 C;  3TU4 D;  1N1J A;  2YFV B;  3NQJ A;  1P3P C;  4KUD D;  5FUG B;  4YS3 C;  3VH5 W;  1M19 D;  3W97 B;  5KDM B;  1M19 B;  3WTP C;  3AZK A;  3AZL C;  1M18 B;  3WKJ B;  3MGS C;  3C1C D;  3X1U D;  3AZF A;  4H9S A;  5CP6 C;  3X1U B;  1P3F D;  4R8P C;  5GT0 A;  5AV8 D;  4UUZ B;  5GXQ A;  1U35 D;  4J8U D;  3X1V C;  1U35 B;  2F8N D;  5GT3 B;  3MGQ B;  4J8W A;  3MGP A;  2NZD C;  5GSU B;  3REJ A;  4XZQ D;  5CPI C;  3AZI A;  1P3G B;  5B31 B;  3REL D;  3REK B;  1P3B C;  3REH D;  4G92 C;  1P3M A;  3REL B;  3MGR C;  5DNN A;  4QLC A;  3C1B C;  3KXB B;  2CV5 A;  5JRG A;  3AYW D;  1P3A D;  1WWI A;  1F66 B;  3AFA C;  1AOI D;  1F1E A;  5CPJ C;  1S32 A;  3UT9 A;  1KX3 C;  4Z66 C;  4JJN C;  4J8X A;  3W96 B;  2HIO B;  1M1A B;  2NQB B;  3AZG D;  4Z5T B;  1P34 A;  5AVC D;  3AZG B;  5F99 C;  1P3K C;  1BH8 A;  3UTB D;  3WAA D;  3VH5 A;  4KGC A;  3WAA B;  5B0Z D;  3O62 C;  2FJ7 D;  5AY8 D;  4LD9 C;  3AN2 D;  3AV2 A;  5AVB D;  5B0Z B;  3AV1 C;  2FJ7 B;  5AY8 B;  3MVD C;  3B0B A;  1EQZ B;  3MNN A;  3WA9 B;  3LEL D;  3REI D;  4G91 C;  1TAF B;  5B0Y C;  4H9P A;  5KDM A;  3REI B;  3VH6 W;  4ZUX A;  3WKJ A;  1M18 A;  4X23 C;  3KWQ C;  3KUY A;  5AV9 B;  1P3I A;  3A6N C;  3LZ0 C;  5E5A A;  1KU5 A;  3AZK D;  3AZF D;  5GT3 A;  3MGQ A;  5GSU A;  3X1T A;  5B33 B;  4E45 A;  5GT0 D;  3W98 A;  1P3G A;  5GXQ D;  5GT0 B;  5B31 A;  1P3P B;  3REK A;  3UTA C;  4J8U C;  3R45 B;  4YS3 B;  2RVQ C;  5GXQ B;  4HGA C;  3MGP D;  3REJ D;  4XZQ C;  3KXB A;  3NQU A;  4J8W B;  3AZI D;  3MGP B;  2ARO C;  1P3O A;  3WTP B;  1TZY A;  3AZL B;  1F66 A;  3AZI B;  1P3M D;  5CP6 B;  3KSY A;  5DNN D;  3X1S D;  3AZM A;  4QLC D;  5CPK A;  3W96 A;  5JRG D;  5B2J D;  3AYW C;  5G49 B;  1M1A A;  1KX5 C;  2F8N G;  2CV5 B;  3AZJ A;  5B32 C;  4Z5T A;  5B1M A;  2NZD B;  4CAY B;  1S32 D;  5CPI B;  3UT9 D;  4J8X D;  4G92 B;  5AV6 A;  3UT9 B;  4NE6 A;  1P34 D;  4YM6 A;  5AVC C;  3C1B B;  1EQZ A;  1P34 B;  4Z2M H;  5B24 B;  4KGC D;  1BH8 B;  1P3L C;  1TAF A;  1KX4 C;  4KGC B;  3VH6 T;  4WU9 C;  3B6F A;  3AV2 B;  3AZH A;  3MNN D;  4JJN B;  5AV9 A;  3W99 B;  2JSS A;  3MNN B;  3W97 D;  4ZUX D;  4H9P B;  1P3K B;  1H3O A;  3AZE A;  1M18 D;  3WKJ D;  4ZUX B;  3KUY D;  3O62 B;  4J8V C;  5B33 A;  1P3I D;  3KUY B;  1ID3 C;  1P3I B;  1P3P A;  5E5A D;  3R45 A;  4YS3 A;  5E5A B;  4M6B A;  4H9S C;  5GT3 D;  4XUJ C;  3MGQ D;  5GSU D;  5B0Y B;  3X1T D;  3W98 D;  1P3G D;  3LZ1 C;  3WTP A;  3X1T B;  3AZL A;  5B31 D;  3MGS A;  3W98 B;  3REK D;  5CP6 A;  4R8P A;  5CPK B;  1HQ3 C;  5BS7 C;  2CWE A;  3KXB D;  3A6N B;  5G49 A;  1P3O D;  1F66 D;  1TZY D;  1ZLA C;  3NQU B;  1A7W A;  3X1V A;  1P3O B;  1TZY B;  2NZD A;  2IO5 C;  3V9R A;  4CAY A;  3X1S C;  3AZM D;  5CPI A;  3LJA C;  3B0C T;  4WU8 C;  5CPK D;  5B2J C;  3AZM B;  3W96 D;  1P3B A;  2HIO D;  5AV5 C;  2NQB D;  5B2I C;  3AZJ D; 
#chains in the Genus database with same CATH topology
 3MGR A;  3A1I A;  4Z5T D;  4DRB A;  5B1M D;  3EPK A;  3AZJ B;  5B1L B;  3C1B A;  5B40 C;  5B1M B;  5B24 A;  3B6G C;  5AV6 D;  5DNM C;  5AV6 B;  4YM6 D;  4AWL C;  1KX3 A;  1BH9 B;  4Z66 A;  4YM6 B;  5C3I C;  1HTA A;  4JJN A;  3AZN C;  1KX5 B;  1EQZ D;  3W99 A;  3WA9 D;  2W8S A;  2PYO B;  4H9R A;  5B32 B;  1P3K A;  3TU4 C;  3B6F D;  2ZM5 A;  3AZH D;  4CSR B;  5AV9 D;  3B6F B;  3O62 A;  3AZH B;  4KUD C;  4LD9 A;  3AV1 A;  3W97 C;  3MVD A;  1M19 C;  3H0R C;  3AZE D;  1PZR A;  1M18 C;  2HUE B;  1H3O B;  3AZE B;  3C1C C;  5B0Y A;  3X1U C;  1KX4 B;  5B33 D;  1P3F C;  5AV8 C;  4X23 A;  1P3P D;  1B67 A;  4ZBJ C;  3KWQ A;  4YS3 D;  1R4V A;  1U35 C;  3MGQ C;  1Z2C B;  2Y2L A;  3A6N A;  3LZ0 A;  4J8W D;  3WTP D;  3AZL D;  5B31 C;  3MGS D;  5CP6 D;  3MGS B;  3REL C;  4J8V B;  4DRA A;  4R8P D;  3REH C;  2BYK A;  4R8P B;  3UTA A;  5BNV A;  1T3U A;  4NE3 A;  2CV5 D;  1P3A C;  2F8N A;  4XUJ B;  3X1V B;  2NZD D;  5B1L A;  3H0L C;  5CPI D;  5B31 G;  1AOI C;  2ARO A;  3LZ1 B;  3V9R B;  5CHL B;  3B0C W;  1P3B D;  2HIO C;  2NQB C;  4H9Q B;  1P3B B;  4WJ3 C;  1ULY A;  1HQ3 B;  3VH6 A;  3MGR B;  3AZG C;  3C1B D;  5BT1 D;  1BH9 A;  3AYW A;  1KX5 A;  5B24 D;  4EO5 C;  2PYO A;  3WAA C;  4Z2M G;  5B32 A;  3UTB C;  2ZY3 A;  3AFA B;  2IO5 B;  5B0Z C;  2FJ7 C;  5AY8 C;  3LJA B;  2Y2J A;  5CPJ B;  3AN2 C;  3AV2 D;  5AVB C;  4WU8 B;  4Z66 D;  4CSR A;  4JJN D;  1KX3 D;  3WA9 C;  3W99 D;  5AV5 B;  1KX3 B;  4Z66 B;  3LEL C;  3REI C;  5AVC A;  4H9R B;  5B40 B;  1P3K D;  3B6G B;  3A1K A;  5F99 B;  1P3L A;  3O62 D;  1KX4 A;  4LD9 D;  1JFI B;  3AV1 D;  4AWL B;  4LD9 B;  4WU9 A;  3MVD D;  3AV1 B;  4H9O B;  2L5A A;  2G5H C;  3MVD B;  3AZK C;  5B0Y D;  3AZF C;  3WTP E;  3B0D C;  4G91 B;  3TU4 B;  5GT0 C;  4X23 D;  3KWQ D;  5GXQ C;  4X23 B;  4WNN B;  4J8V A;  4KUD B;  3KWQ B;  1ID3 A;  2J8P A;  5BO0 B;  3A6N D;  3LZ0 D;  4J8W C;  3MGP C;  3REJ C;  2DF4 C;  3LZ0 B;  3AZI C;  5JA4 A;  4XUJ A;  3C1C B;  1P3M C;  1M1A D;  3LZ1 A;  1P3F B;  5DNN C;  2BYK B;  5AV8 B;  3UTA D;  4ZBJ B;  4QLC C;  2RVQ D;  2CV5 C;  4H9Q A;  5JRG C;  3UTA B;  4NFT A;  5BNV B;  4J8U B;  1HQ3 A;  4HGA B;  5BS7 A;  5B1L D;  2F8N B;  2ARO D;  4KHA B;  1ZLA A;  4XZQ B;  1S32 C;  2ARO B;  3UT9 C;  4J8X C;  3AFA A;  3X1S A;  3REH B;  3LJA A;  5CPJ A;  5BT1 C;  2BYM B;  4H9N B;  5B2J A;  4WU8 A;  1P34 C;  5AV5 A;  1KX5 D;  5B24 C;  2PYO D;  5B2I A;  3AYW B;  5B32 D;  1P3A B;  4KGC C;  1AOI B;  5B40 A;  3AV2 C;  5BNX B;  3B6G A;  5F99 A;  3W99 C;  5DNM A;  3MNN C;  1JFI A;  2BG1 A;  2YFW B;  2UWX A;  4H9O A;  4WZS B;  5AVC B;  3AZN A;  4EO5 B;  4ZUX C;  3WKJ C;  3UTB B;  1P3L D;  1WWS A;  1KX4 D;  3KUY C;  2YFV A;  1P3L B;  2XD1 A;  1Q9C A;  3TU4 A;  1P3I C;  4WU9 D;  3AN2 B;  5AVB B;  5FUG A;  4E44 A;  4WU9 B;  4WNN A;  5E5A C;  4KUD A;  2Y2M A;  3VH5 T;  3LEL B;  3W97 A;  1W2E A;  5BO0 A;  5GT3 C;  1M19 A;  5GSU C;  3X1T C;  1N1J B;  3W98 C;  3NQJ B;  1P3G C;  2F2A C;  3C1C A;  3X1U A;  4J8V D;  3REK C;  1ID3 D;  2LY8 A;  4UUZ A;  1P3F A;  5AV8 A;  1ID3 B;  3KXB C;  1U35 A;  4J8U A;  1P3O C;  4XUJ D;  1TZY C;  3AZK B;  1F66 C;  3X1V D;  3AZF B;  5JA4 B;  3B0D B;  3EPL A;  3EG5 B;  4KHA A;  3LZ1 D;  2XD5 A;  4XZQ A;  2DQN C;  3AZM C;  5CPK C;  3W96 C;  3REL A;  3REH A;  1M1A C;  1HQ3 D;  3AZJ C;  3MGR D;  5B1L C;  2BYM A;  4H9N A;  4Z5T C;  1BFM A;  5B1M C;  2ZY2 A;  3REJ B;  1ZLA D;  3KFU G;  1P3A A;  1ZLA B;  4NE5 A;  3AFA D;  1P3M B;  5AV6 C;  1AOI A;  2JE5 A;  3LJA D;  5CPJ D;  5DNN B;  3X1S B;  5BNX A;  4WU8 D;  4YM6 C;  2Y2Q A;  2F8N H;  2HIO A;  5AV5 D;  4QLC B;  4WV4 B;  5B2I D;  5JRG B;  5B2J B;  1EQZ C;  2NQB A;  2PYO C;  5B2I B;  2YFW A;  3AZG A;  5B40 D;  3B6G D;  1S32 B;  5F99 D;  3WAA A;  3UTB A;  3B6F C;  5DNM D;  3AZH C;  4J8X B;  5AV9 C;  5B0Z A;  5DNM B;  2Y2I A;  5AY8 A;  2FJ7 A;  3AN2 A;  1B6W A;  5AVB A;  2ZY5 A;  3WA9 A;  3AZN D;  5B32 G;  2HUE C;  5C3I B;  3LEL A;  2Y2G A;  3AZE C;  3AZN B;  2F8N K;  3REI A;  5B33 C;  3TU4 D;  1N1J A;  2YFV B;  3NQJ A;  1P3P C;  2Y2N A;  4KUD D;  5FUG B;  4YS3 C;  3EPJ A;  3P5J B;  3VH5 W;  1M19 D;  3W97 B;  2Y2O A;  5KDM B;  1M19 B;  3WTP C;  3AZK A;  3AZL C;  1M18 B;  3WKJ B;  3MGS C;  3C1C D;  3X1U D;  3AZF A;  4H9S A;  5CP6 C;  3X1U B;  1P3F D;  4R8P C;  5GT0 A;  5AV8 D;  4UUZ B;  5GXQ A;  1U35 D;  4J8U D;  3X1V C;  1U35 B;  2F8N D;  5GT3 B;  3MGQ B;  4J8W A;  3MGP A;  2NZD C;  5GSU B;  3REJ A;  4XZQ D;  5CPI C;  3AZI A;  1P3G B;  5B31 B;  3REL D;  3REK B;  1P3B C;  3REH D;  4G92 C;  1P3M A;  3REL B;  3MGR C;  5DNN A;  4QLC A;  3C1B C;  3KXB B;  2CV5 A;  5JRG A;  3AYW D;  1P3A D;  1WWI A;  1F66 B;  2G5I C;  3AFA C;  1AOI D;  1F1E A;  3H0M C;  5CPJ C;  1S32 A;  3UT9 A;  1KX3 C;  4Z66 C;  4JJN C;  4J8X A;  3W96 B;  2HIO B;  4UPK A;  1M1A B;  2NQB B;  3AZG D;  2FFF B;  4Z5T B;  1P34 A;  5AVC D;  3AZG B;  5F99 C;  1P3K C;  1BH8 A;  3UTB D;  3WAA D;  3VH5 A;  4KGC A;  3WAA B;  5B0Z D;  3O62 C;  2FJ7 D;  5AY8 D;  4LD9 C;  3AL0 C;  3AN2 D;  3AV2 A;  5AVB D;  5B0Z B;  3AV1 C;  2FJ7 B;  5AY8 B;  3MVD C;  3B0B A;  1EQZ B;  3MNN A;  3WA9 B;  3LEL D;  3REI D;  4G91 C;  1TAF B;  5B0Y C;  4H9P A;  5KDM A;  3REI B;  3VH6 W;  4ZUX A;  3WKJ A;  1M18 A;  4X23 C;  3KWQ C;  3KUY A;  5AV9 B;  1P3I A;  3A6N C;  3LZ0 C;  5E5A A;  1KU5 A;  2JCH A;  3AZK D;  3AZF D;  5GT3 A;  3MGQ A;  5GSU A;  3X1T A;  5B33 B;  4E45 A;  5GT0 D;  3W98 A;  1P3G A;  5GXQ D;  5GT0 B;  5B31 A;  1P3P B;  3REK A;  3UTA C;  4J8U C;  3R45 B;  4YS3 B;  2RVQ C;  5GXQ B;  4HGA C;  3F6T A;  2Y2P A;  3MGP D;  3REJ D;  4XZQ C;  3KXB A;  2VQR A;  3NQU A;  4J8W B;  3AZI D;  3MGP B;  2ARO C;  1P3O A;  3WTP B;  1TZY A;  3AZL B;  1F66 A;  3AZI B;  1P3M D;  5CP6 B;  3KSY A;  5DNN D;  3X1S D;  3AZM A;  4QLC D;  2RIQ A;  5CPK A;  3W96 A;  5JRG D;  5B2J D;  3AYW C;  5G49 B;  1M1A A;  1KX5 C;  2F8N G;  2CV5 B;  3AZJ A;  5B32 C;  4Z5T A;  5B1M A;  2NZD B;  4CAY B;  1S32 D;  5CPI B;  3UT9 D;  4J8X D;  4G92 B;  5AV6 A;  3UT9 B;  4NE6 A;  1P34 D;  4YM6 A;  2Y2K A;  5AVC C;  3C1B B;  4DQY B;  1EQZ A;  1P34 B;  4Z2M H;  2Y2H A;  5B24 B;  4KGC D;  1BH8 B;  1P3L C;  1TAF A;  1KX4 C;  4KGC B;  3VH6 T;  4WU9 C;  3B6F A;  3AV2 B;  3AZH A;  3MNN D;  4JJN B;  5AV9 A;  3W99 B;  2JSS A;  3MNN B;  3W97 D;  4ZUX D;  4H9P B;  3IP4 C;  1P3K B;  1H3O A;  3AZE A;  1M18 D;  3WKJ D;  4ZUX B;  3FDD A;  3KUY D;  3O62 B;  4J8V C;  5B33 A;  1P3I D;  3KUY B;  1ID3 C;  1P3I B;  1P3P A;  5E5A D;  3R45 A;  4YS3 A;  5E5A B;  4M6B A;  4H9S C;  5GT3 D;  4XUJ C;  3MGQ D;  5GSU D;  5B0Y B;  3X1T D;  3EPH A;  3W98 D;  1P3G D;  3LZ1 C;  3WTP A;  3X1T B;  3AZL A;  5B31 D;  3MGS A;  3W98 B;  3REK D;  5CP6 A;  4R8P A;  5CPK B;  1HQ3 C;  5BS7 C;  2CWE A;  3KXB D;  3A6N B;  5G49 A;  1P3O D;  1F66 D;  1TZY D;  1ZLA C;  3NQU B;  1A7W A;  3X1V A;  1P3O B;  1TZY B;  2NZD A;  2IO5 C;  3V9R A;  4CAY A;  3X1S C;  3AZM D;  5CPI A;  3LJA C;  2ZY4 A;  3B0C T;  4WU8 C;  5CPK D;  5B2J C;  3AZM B;  3W96 D;  1P3B A;  2HIO D;  5AV5 C;  2NQB D;  5B2I C;  3AZJ D; 
#chains in the Genus database with same CATH homology
 3MGR A;  3A1I A;  4Z5T D;  4DRB A;  5B1M D;  3EPK A;  3AZJ B;  5B1L B;  3C1B A;  5B40 C;  5B1M B;  5B24 A;  3B6G C;  5AV6 D;  5DNM C;  5AV6 B;  4YM6 D;  4AWL C;  1KX3 A;  1BH9 B;  4Z66 A;  4YM6 B;  5C3I C;  1HTA A;  4JJN A;  3AZN C;  1KX5 B;  1EQZ D;  3W99 A;  3WA9 D;  2W8S A;  2PYO B;  4H9R A;  5B32 B;  1P3K A;  3TU4 C;  3B6F D;  2ZM5 A;  3AZH D;  4CSR B;  5AV9 D;  3B6F B;  3O62 A;  3AZH B;  4KUD C;  4LD9 A;  3AV1 A;  3W97 C;  3MVD A;  1M19 C;  3H0R C;  3AZE D;  1PZR A;  1M18 C;  2HUE B;  1H3O B;  3AZE B;  3C1C C;  5B0Y A;  3X1U C;  1KX4 B;  5B33 D;  1P3F C;  5AV8 C;  4X23 A;  1P3P D;  1B67 A;  4ZBJ C;  3KWQ A;  4YS3 D;  1R4V A;  1U35 C;  3MGQ C;  1Z2C B;  2Y2L A;  3A6N A;  3LZ0 A;  4J8W D;  3WTP D;  3AZL D;  5B31 C;  3MGS D;  5CP6 D;  3MGS B;  3REL C;  4J8V B;  4DRA A;  4R8P D;  3REH C;  2BYK A;  4R8P B;  3UTA A;  5BNV A;  1T3U A;  4NE3 A;  2CV5 D;  1P3A C;  2F8N A;  4XUJ B;  3X1V B;  2NZD D;  5B1L A;  3H0L C;  5CPI D;  5B31 G;  1AOI C;  2ARO A;  3LZ1 B;  3V9R B;  5CHL B;  3B0C W;  1P3B D;  2HIO C;  2NQB C;  4H9Q B;  1P3B B;  4WJ3 C;  1ULY A;  1HQ3 B;  3VH6 A;  3MGR B;  3AZG C;  3C1B D;  5BT1 D;  1BH9 A;  3AYW A;  1KX5 A;  5B24 D;  4EO5 C;  2PYO A;  3WAA C;  4Z2M G;  5B32 A;  3UTB C;  2ZY3 A;  3AFA B;  2IO5 B;  5B0Z C;  2FJ7 C;  5AY8 C;  3LJA B;  2Y2J A;  5CPJ B;  3AN2 C;  3AV2 D;  5AVB C;  4WU8 B;  4Z66 D;  4CSR A;  4JJN D;  1KX3 D;  3WA9 C;  3W99 D;  5AV5 B;  1KX3 B;  4Z66 B;  3LEL C;  3REI C;  5AVC A;  4H9R B;  5B40 B;  1P3K D;  3B6G B;  3A1K A;  5F99 B;  1P3L A;  3O62 D;  1KX4 A;  4LD9 D;  1JFI B;  3AV1 D;  4AWL B;  4LD9 B;  4WU9 A;  3MVD D;  3AV1 B;  4H9O B;  2L5A A;  2G5H C;  3MVD B;  3AZK C;  5B0Y D;  3AZF C;  3WTP E;  3B0D C;  4G91 B;  3TU4 B;  5GT0 C;  4X23 D;  3KWQ D;  5GXQ C;  4X23 B;  4WNN B;  4J8V A;  4KUD B;  3KWQ B;  1ID3 A;  2J8P A;  5BO0 B;  3A6N D;  3LZ0 D;  4J8W C;  3MGP C;  3REJ C;  2DF4 C;  3LZ0 B;  3AZI C;  5JA4 A;  4XUJ A;  3C1C B;  1P3M C;  1M1A D;  3LZ1 A;  1P3F B;  5DNN C;  2BYK B;  5AV8 B;  3UTA D;  4ZBJ B;  4QLC C;  2RVQ D;  2CV5 C;  4H9Q A;  5JRG C;  3UTA B;  4NFT A;  5BNV B;  4J8U B;  1HQ3 A;  4HGA B;  5BS7 A;  5B1L D;  2F8N B;  2ARO D;  4KHA B;  1ZLA A;  4XZQ B;  1S32 C;  2ARO B;  3UT9 C;  4J8X C;  3AFA A;  3X1S A;  3REH B;  3LJA A;  5CPJ A;  5BT1 C;  2BYM B;  4H9N B;  5B2J A;  4WU8 A;  1P34 C;  5AV5 A;  1KX5 D;  5B24 C;  2PYO D;  5B2I A;  3AYW B;  5B32 D;  1P3A B;  4KGC C;  1AOI B;  5B40 A;  3AV2 C;  5BNX B;  3B6G A;  5F99 A;  3W99 C;  5DNM A;  3MNN C;  1JFI A;  2BG1 A;  2YFW B;  2UWX A;  4H9O A;  4WZS B;  5AVC B;  3AZN A;  4EO5 B;  4ZUX C;  3WKJ C;  3UTB B;  1P3L D;  1WWS A;  1KX4 D;  3KUY C;  2YFV A;  1P3L B;  2XD1 A;  1Q9C A;  3TU4 A;  1P3I C;  4WU9 D;  3AN2 B;  5AVB B;  5FUG A;  4E44 A;  4WU9 B;  4WNN A;  5E5A C;  4KUD A;  2Y2M A;  3VH5 T;  3LEL B;  3W97 A;  1W2E A;  5BO0 A;  5GT3 C;  1M19 A;  5GSU C;  3X1T C;  1N1J B;  3W98 C;  3NQJ B;  1P3G C;  2F2A C;  3C1C A;  3X1U A;  4J8V D;  3REK C;  1ID3 D;  2LY8 A;  4UUZ A;  1P3F A;  5AV8 A;  1ID3 B;  3KXB C;  1U35 A;  4J8U A;  1P3O C;  4XUJ D;  1TZY C;  3AZK B;  1F66 C;  3X1V D;  3AZF B;  5JA4 B;  3B0D B;  3EPL A;  3EG5 B;  4KHA A;  3LZ1 D;  2XD5 A;  4XZQ A;  2DQN C;  3AZM C;  5CPK C;  3W96 C;  3REL A;  3REH A;  1M1A C;  1HQ3 D;  3AZJ C;  3MGR D;  5B1L C;  2BYM A;  4H9N A;  4Z5T C;  1BFM A;  5B1M C;  2ZY2 A;  3REJ B;  1ZLA D;  3KFU G;  1P3A A;  1ZLA B;  4NE5 A;  3AFA D;  1P3M B;  5AV6 C;  1AOI A;  2JE5 A;  3LJA D;  5CPJ D;  5DNN B;  3X1S B;  5BNX A;  4WU8 D;  4YM6 C;  2Y2Q A;  2F8N H;  2HIO A;  5AV5 D;  4QLC B;  4WV4 B;  5B2I D;  5JRG B;  5B2J B;  1EQZ C;  2NQB A;  2PYO C;  5B2I B;  2YFW A;  3AZG A;  5B40 D;  3B6G D;  1S32 B;  5F99 D;  3WAA A;  3UTB A;  3B6F C;  5DNM D;  3AZH C;  4J8X B;  5AV9 C;  5B0Z A;  5DNM B;  2Y2I A;  5AY8 A;  2FJ7 A;  3AN2 A;  1B6W A;  5AVB A;  2ZY5 A;  3WA9 A;  3AZN D;  5B32 G;  2HUE C;  5C3I B;  3LEL A;  2Y2G A;  3AZE C;  3AZN B;  2F8N K;  3REI A;  5B33 C;  3TU4 D;  1N1J A;  2YFV B;  3NQJ A;  1P3P C;  2Y2N A;  4KUD D;  5FUG B;  4YS3 C;  3EPJ A;  3P5J B;  3VH5 W;  1M19 D;  3W97 B;  2Y2O A;  5KDM B;  1M19 B;  3WTP C;  3AZK A;  3AZL C;  1M18 B;  3WKJ B;  3MGS C;  3C1C D;  3X1U D;  3AZF A;  4H9S A;  5CP6 C;  3X1U B;  1P3F D;  4R8P C;  5GT0 A;  5AV8 D;  4UUZ B;  5GXQ A;  1U35 D;  4J8U D;  3X1V C;  1U35 B;  2F8N D;  5GT3 B;  3MGQ B;  4J8W A;  3MGP A;  2NZD C;  5GSU B;  3REJ A;  4XZQ D;  5CPI C;  3AZI A;  1P3G B;  5B31 B;  3REL D;  3REK B;  1P3B C;  3REH D;  4G92 C;  1P3M A;  3REL B;  3MGR C;  5DNN A;  4QLC A;  3C1B C;  3KXB B;  2CV5 A;  5JRG A;  3AYW D;  1P3A D;  1WWI A;  1F66 B;  2G5I C;  3AFA C;  1AOI D;  1F1E A;  3H0M C;  5CPJ C;  1S32 A;  3UT9 A;  1KX3 C;  4Z66 C;  4JJN C;  4J8X A;  3W96 B;  2HIO B;  4UPK A;  1M1A B;  2NQB B;  3AZG D;  2FFF B;  4Z5T B;  1P34 A;  5AVC D;  3AZG B;  5F99 C;  1P3K C;  1BH8 A;  3UTB D;  3WAA D;  3VH5 A;  4KGC A;  3WAA B;  5B0Z D;  3O62 C;  2FJ7 D;  5AY8 D;  4LD9 C;  3AL0 C;  3AN2 D;  3AV2 A;  5AVB D;  5B0Z B;  3AV1 C;  2FJ7 B;  5AY8 B;  3MVD C;  3B0B A;  1EQZ B;  3MNN A;  3WA9 B;  3LEL D;  3REI D;  4G91 C;  1TAF B;  5B0Y C;  4H9P A;  5KDM A;  3REI B;  3VH6 W;  4ZUX A;  3WKJ A;  1M18 A;  4X23 C;  3KWQ C;  3KUY A;  5AV9 B;  1P3I A;  3A6N C;  3LZ0 C;  5E5A A;  1KU5 A;  2JCH A;  3AZK D;  3AZF D;  5GT3 A;  3MGQ A;  5GSU A;  3X1T A;  5B33 B;  4E45 A;  5GT0 D;  3W98 A;  1P3G A;  5GXQ D;  5GT0 B;  5B31 A;  1P3P B;  3REK A;  3UTA C;  4J8U C;  3R45 B;  4YS3 B;  2RVQ C;  5GXQ B;  4HGA C;  3F6T A;  2Y2P A;  3MGP D;  3REJ D;  4XZQ C;  3KXB A;  2VQR A;  3NQU A;  4J8W B;  3AZI D;  3MGP B;  2ARO C;  1P3O A;  3WTP B;  1TZY A;  3AZL B;  1F66 A;  3AZI B;  1P3M D;  5CP6 B;  3KSY A;  5DNN D;  3X1S D;  3AZM A;  4QLC D;  2RIQ A;  5CPK A;  3W96 A;  5JRG D;  5B2J D;  3AYW C;  5G49 B;  1M1A A;  1KX5 C;  2F8N G;  2CV5 B;  3AZJ A;  5B32 C;  4Z5T A;  5B1M A;  2NZD B;  4CAY B;  1S32 D;  5CPI B;  3UT9 D;  4J8X D;  4G92 B;  5AV6 A;  3UT9 B;  4NE6 A;  1P34 D;  4YM6 A;  2Y2K A;  5AVC C;  3C1B B;  4DQY B;  1EQZ A;  1P34 B;  4Z2M H;  2Y2H A;  5B24 B;  4KGC D;  1BH8 B;  1P3L C;  1TAF A;  1KX4 C;  4KGC B;  3VH6 T;  4WU9 C;  3B6F A;  3AV2 B;  3AZH A;  3MNN D;  4JJN B;  5AV9 A;  3W99 B;  2JSS A;  3MNN B;  3W97 D;  4ZUX D;  4H9P B;  3IP4 C;  1P3K B;  1H3O A;  3AZE A;  1M18 D;  3WKJ D;  4ZUX B;  3FDD A;  3KUY D;  3O62 B;  4J8V C;  5B33 A;  1P3I D;  3KUY B;  1ID3 C;  1P3I B;  1P3P A;  5E5A D;  3R45 A;  4YS3 A;  5E5A B;  4M6B A;  4H9S C;  5GT3 D;  4XUJ C;  3MGQ D;  5GSU D;  5B0Y B;  3X1T D;  3EPH A;  3W98 D;  1P3G D;  3LZ1 C;  3WTP A;  3X1T B;  3AZL A;  5B31 D;  3MGS A;  3W98 B;  3REK D;  5CP6 A;  4R8P A;  5CPK B;  1HQ3 C;  5BS7 C;  2CWE A;  3KXB D;  3A6N B;  5G49 A;  1P3O D;  1F66 D;  1TZY D;  1ZLA C;  3NQU B;  1A7W A;  3X1V A;  1P3O B;  1TZY B;  2NZD A;  2IO5 C;  3V9R A;  4CAY A;  3X1S C;  3AZM D;  5CPI A;  3LJA C;  2ZY4 A;  3B0C T;  4WU8 C;  5CPK D;  5B2J C;  3AZM B;  3W96 D;  1P3B A;  2HIO D;  5AV5 C;  2NQB D;  5B2I C;  3AZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...