5GXQD

The crystal structure of the nucleosome containing h3.6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.6
publication title Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gxqD00
3O62C 5B33A 5B24A 4XZQD 5AY8D 3W97C 3LELA 4H9OA 2RVQC 1P34C 1HQ3C 3REJC 3MGQB 5B31A 4H9SA 5DNMC 5GT3A 5CP6B 2CV5B 1M19D 5GT0B 3B0CT 4Z5TA 5JA4B 3MVDC 3REHD 2F8NH 5B1LD 1N1JA 1P3LB 5B1MD 4KHAB 5B2IB 3AV1A 2AROD 1EQZC 2F8ND 3UTBC 1P3KA 2CWEA 4Z66D 4ZBJC 5CPKC 3AZMB 5DNND 5AV6C 2NQBB 4JJNB 4XUJC 2BYMB 3LZ0A 3AZGD 1F66D 3REIA 3AZKD 3AFAC 3C1CA 4J8XD 3X1VB 1KX5C 4WU9C 1BFMA 2HIOA 5BNVB 4M6BA 4QLCD 3KUYB 3UT9C 5AVBD 5AV5A 3AZNA 1M18B 2PYOC 5AVCB 4J8UC 3REKD 4WU8A 3AZJA 3WKJB 4HGAB 5AV9C 5GXQD 5CPID 1P3FD 3C1BB 3AZHB 1P3AA 5B0YD 3KXBA 1AOIB 4XZQC 5AY8C 3VH5W 5BO0B 5E5AB 4X23B 4AWLC 3MGRB 3B0BA 3AZED 1U35D 3VH5T 1P34B 3NQJA 3B6FB 1M19C 3W98B 5DNMB 1P3BD 4ZUXD 5B2JD 2L5AA 3MGQA 3A6NB 3REHC 5B1LC 4NFTA 5B1MC 5GT0A 2AROC 1P3BA 1S32B 5CPJB 5JA4A 4J8WB 4Z66C 4NE3A 3MGPD 5DNNC 5BS7A 1P3LA 3AZGC 4KHAA 4EO5B 4G92B 5B2IA 3X1TB 1F66C 3AZKC 4J8XC 1P3MD 3LJAD 4Z2MH 1P3IB 4KGCD 3AZMA 2FJ7D 4QLCC 2NQBA 5AVBC 4JJNA 2BYMA 4H9RA 5FUGB 3REKC 4LD9D 3X1SB 5B40D 3X1VA 5GXQC 5CPIC 1P3FC 5BNVA 5AV9B 3W99D 4G91C 4KUDB 3KUYA 2IO5C 1M18A 5B0YC 2BYKB 3AZEC 3WKJA 1U35C 5AV8B 3MGSB 3C1BA 4CSRB 3B6GB 1BH9B 2HUEB 5B32C 1AOIA 1P3BC 5BO0A 5JRGB 5E5AA 4ZUXC 4X23A 3MGRA 3AV2B 5B2JC 1M1AB 3WAAD 5GSUB 5G49B 3VH5A 1TZYB 3B6FA 3B0DB 3KWQB 3UTAB 5B1MB 5B33D 5B24D 3LELD 4NE5A 4WZSB 3MGPC 4YS3B 3A6NA 5C3IB 5B31D 1ZLAB 1ID3B 5GT3D 4Z5TD 3AZID 1S32A 5CPJA 1P3MC 3LJAC 1P3OB 4J8WA 5F99B 4KGCC 3AYWB 3AN2B 2FJ7C 4E45A 3X1TA 3AV1D 3AZIA 1P3PB 2YFWA 4LD9C 4CAYB 1P3KD 5B40C 1P3IA 3AZLD 1KX3B 5B0ZB 1KX4B 3W99C 3TU4B 3X1UB 2IO5B 3LZ0D 5KDMA 5FUGA 3REID 3X1SA 4R8PB 3C1CD 3AZLA 3MNND 3W96B 2HIOD 4KUDA 3AZND 5AV5D 1Q9CA 4UUZB 1P3GB 2YFVB 5B32B 3AZJD 4WU8D 2BYKA 3WAAC 4WV4B 4ZUXB 3MNNA 5AV8A 4J8VB 3MGSA 3WTPD 3B6GA 3WA9B 1BH9A 1P3AD 3KXBD 5B33C 3RELB 5B24C 5JRGA 3LZ1A 3LELC 3AZFB 3AV2A 1M1AA 2NZDB 5GSUA 5G49A 4H9PA 4DRAA 2F8NG 4YM6D 1TZYA 5B31C 4H9SC 3WTPA 3KWQA 5GT3C 3UTAA 3O62B 4Z5TC 3AZIC 4NE6A 5BNXB 3W97B 4YS3A 4YM6A 3MGQD 1HQ3B 3REJB 1ZLAA 1ID3A 5CP6D 2CV5D 5GT0D 3AV1C 1P3KC 1P3OA 3AZLC 5F99A 3AYWA 3MVDB 3AN2A 5CP6A 2CV5A 4E44A 1P3LD 3LZ0C 5B2ID 1P3PA 3REIC 4CAYA 1EQZB 3C1CC 3UTBB 5B0ZA 1KX4A 4ZBJB 3AZMD 2HIOC 5CPKB 3TU4A 3X1UA 4DRBA 1WWSA 5AV5C 4JJND 3AZNC 5AV6B 3R45B 2NQBD 4XUJB 3AZJC 4WU8C 4R8PA 3X1VD 5B32G 3AFAB 1KX5B 3W96A 4WU9B 1TAFB 3WTPC 3KUYD 1M18D 1P3AC 4UUZA 3KXBC 3UT9B 1P3GA 2YFVA 2PYOB 5B24B 4J8UB 3WKJD 4J8VA 5BT1D 3C1BD 3AZHD 5B31B 3WA9A 1AOID 5AVCA 3AZFA 5E5AD 4XZQB 4X23D 5AY8B 3MGRD 4AWLB 1B67A 4WNNB 3MGQC 1P34D 3AZHA 1H3OB 5CP6C 2CV5C 3B6FD 3W98D 4Z2MG 5GT0C 3O62A 1M19B 3AV1B 5BNXA 3W97A 2F8NK 1P34A 4H9NB 3A6ND 1HQ3A 3REJA 5BS7C 3W98A 3REHB 1P3LC 5B1LB 5DNMA 5B2IC 1S32D 5CPJD 2AROB 2F8NB 4J8WD 3NQUB 4Z66B 3KSYA 3AZMC 3MVDA 5DNNB 2NQBC 4JJNC 3X1TD 3AZGB 3WTPE 1F66B 1EQZA 3X1VC 3UTBA 3AZKB 1P3ID 4J8XB 5CHLB 3KUYC 1M18C 5AV6A 3R45A 1F1EA 4QLCB 5AVBB 4XUJA 3KXBB 3X1SD 3WKJC 4HGAC 3REKB 3AFAA 1KX5A 5BT1C 4WU9A 5GXQB 5AV9D 3C1BC 5CPIB 3AZHC 1P3FB 4KUDD 4G91B 3UT9A 1AOIC 2PYOA 5B31G 5B0YB 5E5AC 4X23C 4J8UA 3MGRC 4H9QB 3AZEB 5AV8D 1U35B 3MGSD 5AV9A 3B6FC 3W98C 3B0CW 3B6GD 5JRGD 3LZ1D 4XZQA 3AV2D 1P3BB 2LY8A 5AY8A 1M1AD 5GSUD 4WNNA 5B2JB 3A6NC 4CSRA 1TZYD 1H3OA 3KWQD 3UTAD 1R4VA 1M19A 1S32C 5CPJC 4J8WC 4YS3D 4H9NA 3VH6W 3MGPB 1A7WA 1ZLAD 3REHA 1ID3D 5B1LA 3VH6T 4EO5C 4G92C 3X1TC 5B1MA 4H9RB 2AROA 2F8NA 1P3OD 1P3IC 3NQUA 1P3MB 3LJAB 4Z66A 1BH8B 5F99D 3AYWD 4KGCB 1JFIB 3AN2D 5DNNA 2FJ7B 3AZGA 1F66A 1P3PD 3X1SC 4LD9B 3AZKA 4J8XA 5B40B 1KX3D 5B0ZD 1KX4D 4KUDC 3W99B 3TU4D 3X1UD 4QLCA 1WWIA 5AVBA 4R8PD 3REKA 1KX3A 3MNNC 5AV8C 3V9RB 3W96D 3MGSC 5GXQA 5CPIA 1P3FA 3B6GC 2HUEC 1P3GD 5B0YA 5B32D 5JRGC 3LZ1C 3AV2C 1M1AC 3WAAB 4H9QA 5GSUC 3AZEA 1U35A 4J8VD 1HTAA 1TZYC 3B0DC 3KWQC 3UTAC 3WA9D 5AVCD 3RELD 5B32A 5B33B 2NZDD 3AZFD 4ZUXA 3LELB 4H9OB 5B2JA 4YS3C 4YM6C 5C3IC 1ZLAC 1ID3C 5GT3B 3RELA 3O62D 1KU5A 2NZDA 2JSSA 4Z5TB 3AZIB 1P3OC 2YFWB 3W97D 2RVQD 5F99C 3AYWC 1HQ3D 3MGPA 3REJD 3AN2C 1N1JB 5DNMD 1P3PC 3VH6A 5KDMB 1P3KB 1P3MA 3LJAA 1KX3C 5B0ZC 3AZLB 1BH8A 1KX4C 3MVDD 1JFIA 4KGCA 3TU4C 3X1UC 2FJ7A 1ULYA 3LZ0B 4R8PC 1EQZD 3UTBD 3REIB 4LD9A 5B40A 3C1CB 3W96C 3MNNB 5CPKD 2HIOB 3W99A 5AV6D 1P3GC 3AZNB 5AV5B 4XUJD 3AZJB 4WU8B 3LZ1B 3AFAD 1KX5D 4J8VC 3V9RA 4WU9D 4H9PB 5CPKA 3WA9C 3WTPB 3UT9D 5AVCC 3RELC 1P3AB 2PYOD 1B6WA 2NZDC 3AZFC 4J8UD 3WAAA 4YM6B 1TAFA 3NQJB
chains in the Genus database with same CATH superfamily
3O62C 5B33A 5B24A 4XZQD 5AY8D 3W97C 3LELA 4H9OA 2RVQC 2ZM5A 1P34C 1HQ3C 3REJC 3MGQB 5B31A 2Y2HA 4H9SA 5DNMC 5GT3A 5CP6B 2CV5B 1M19D 5GT0B 2VQRA 3B0CT 4Z5TA 5JA4B 3P5JB 3MVDC 3REHD 2F8NH 5B1LD 1N1JA 1P3LB 5B1MD 2Y2LA 4KHAB 5B2IB 3AV1A 2AROD 1EQZC 2F8ND 3UTBC 1P3KA 2CWEA 4Z66D 4ZBJC 5CPKC 2ZY5A 3AZMB 5DNND 5AV6C 1T3UA 2NQBB 4JJNB 4XUJC 2BYMB 3LZ0A 3AZGD 1F66D 3REIA 3AZKD 3AFAC 3C1CA 4J8XD 3X1VB 1KX5C 4WU9C 2ZY3A 1BFMA 2HIOA 5BNVB 4M6BA 4QLCD 3KUYB 3UT9C 5AVBD 5AV5A 3AZNA 1M18B 2PYOC 5AVCB 4J8UC 3REKD 4WU8A 3AZJA 3WKJB 4HGAB 5AV9C 5GXQD 5CPID 1P3FD 3C1BB 3AZHB 2Y2OA 1P3AA 5B0YD 3KXBA 1AOIB 4XZQC 5AY8C 3VH5W 5BO0B 5E5AB 4X23B 4AWLC 3MGRB 3B0BA 3AZED 1U35D 3VH5T 1P34B 3NQJA 3B6FB 1M19C 3W98B 5DNMB 1P3BD 4ZUXD 5B2JD 2L5AA 3MGQA 3A6NB 3REHC 3A1KA 5B1LC 4NFTA 5B1MC 5GT0A 2AROC 1P3BA 1S32B 5CPJB 5JA4A 4J8WB 4Z66C 4NE3A 3MGPD 3EPKA 5DNNC 3A1IA 5BS7A 1P3LA 3AZGC 4KHAA 4EO5B 4G92B 5B2IA 3X1TB 1F66C 2Y2PA 3AZKC 4J8XC 1P3MD 3LJAD 4Z2MH 1P3IB 4KGCD 3AZMA 2Y2JA 2FJ7D 4QLCC 2NQBA 5AVBC 4JJNA 2BYMA 4H9RA 5FUGB 3REKC 4LD9D 3X1SB 2DQNC 5B40D 3X1VA 5GXQC 5CPIC 1P3FC 5BNVA 5AV9B 3W99D 4G91C 4KUDB 3KUYA 2IO5C 1M18A 5B0YC 2BYKB 3AZEC 3WKJA 1U35C 3AL0C 5AV8B 3MGSB 3C1BA 4CSRB 2DF4C 3EPLA 3B6GB 1BH9B 2HUEB 5B32C 1AOIA 1P3BC 2ZY4A 5BO0A 5JRGB 5E5AA 4ZUXC 4X23A 3MGRA 3AV2B 1PZRA 5B2JC 1M1AB 3WAAD 5GSUB 5G49B 3VH5A 1TZYB 3B6FA 3B0DB 3KWQB 3UTAB 5B1MB 5B33D 5B24D 3LELD 4NE5A 2J8PA 4WZSB 3MGPC 4YS3B 3A6NA 5C3IB 5B31D 1ZLAB 1ID3B 5GT3D 4Z5TD 3AZID 1S32A 5CPJA 1P3MC 3LJAC 1P3OB 4J8WA 5F99B 4KGCC 3AYWB 3AN2B 2FJ7C 4E45A 3X1TA 3AV1D 3AZIA 1P3PB 2YFWA 4LD9C 4CAYB 1P3KD 5B40C 1P3IA 2Y2GA 3AZLD 1KX3B 5B0ZB 1KX4B 3W99C 3TU4B 3X1UB 2IO5B 3LZ0D 5KDMA 5FUGA 3REID 3X1SA 4R8PB 3C1CD 3AZLA 3MNND 3W96B 2HIOD 4KUDA 3AZND 5AV5D 1Q9CA 4UUZB 1P3GB 2YFVB 5B32B 3AZJD 4WU8D 2BYKA 3WAAC 2JCHA 4WV4B 4ZUXB 3MNNA 5AV8A 4J8VB 3MGSA 3WTPD 3B6GA 3WA9B 1BH9A 1P3AD 3KXBD 5B33C 3RELB 5B24C 5JRGA 3LZ1A 3LELC 3AZFB 3AV2A 1M1AA 2NZDB 5GSUA 5G49A 4H9PA 4DRAA 2F8NG 4YM6D 1TZYA 5B31C 4H9SC 3WTPA 2Y2MA 5GT3C 3KWQA 3UTAA 3O62B 4Z5TC 3AZIC 4NE6A 5BNXB 2UWXA 3W97B 4YS3A 4YM6A 3MGQD 1HQ3B 3REJB 1ZLAA 1ID3A 5CP6D 2CV5D 5GT0D 3AV1C 1P3KC 1P3OA 3AZLC 5F99A 3AYWA 3MVDB 3AN2A 5CP6A 2CV5A 4E44A 4DQYB 1P3LD 2W8SA 3LZ0C 5B2ID 1P3PA 3REIC 3KFUG 4CAYA 1EQZB 3C1CC 3UTBB 5B0ZA 1KX4A 4ZBJB 3AZMD 2HIOC 5CPKB 3TU4A 3X1UA 4DRBA 1WWSA 2Y2QA 5AV5C 4JJND 5AV6B 3R45B 3AZNC 2NQBD 3H0RC 4XUJB 3AZJC 4WU8C 4R8PA 3X1VD 5B32G 3AFAB 1KX5B 3W96A 4WU9B 1TAFB 3WTPC 3KUYD 1M18D 1P3AC 4UUZA 3KXBC 3UT9B 1P3GA 2YFVA 2PYOB 5B24B 4J8UB 3WKJD 4J8VA 5BT1D 3C1BD 3AZHD 5B31B 3WA9A 1AOID 5AVCA 3AZFA 5E5AD 4XZQB 4X23D 5AY8B 3MGRD 2ZY2A 4AWLB 1B67A 4WNNB 3MGQC 1P34D 3AZHA 1H3OB 5CP6C 2CV5C 3B6FD 3W98D 4Z2MG 5GT0C 3O62A 1M19B 3AV1B 5BNXA 3W97A 2F8NK 1P34A 4H9NB 3A6ND 1HQ3A 3REJA 5BS7C 3W98A 3REHB 1P3LC 5B1LB 1Z2CB 5DNMA 5B2IC 2JE5A 1S32D 5CPJD 2AROB 2F8NB 4J8WD 3NQUB 4Z66B 3KSYA 3AZMC 3MVDA 5DNNB 2NQBC 4JJNC 3X1TD 3AZGB 3WTPE 1F66B 1EQZA 3X1VC 3UTBA 3AZKB 1P3ID 4J8XB 5CHLB 3KUYC 1M18C 5AV6A 3R45A 1F1EA 4QLCB 5AVBB 4XUJA 3KXBB 3X1SD 3WKJC 4HGAC 3REKB 3AFAA 1KX5A 3H0LC 3EG5B 5BT1C 4WU9A 5GXQB 5AV9D 3C1BC 5CPIB 3AZHC 1P3FB 2BG1A 4KUDD 4G91B 3UT9A 1AOIC 2PYOA 5B31G 5B0YB 5E5AC 4X23C 4J8UA 3MGRC 4H9QB 3AZEB 5AV8D 1U35B 2F2AC 3MGSD 5AV9A 2Y2KA 3B6FC 3W98C 3B0CW 3B6GD 5JRGD 3LZ1D 4XZQA 3AV2D 1P3BB 2LY8A 5AY8A 1M1AD 5GSUD 4WNNA 5B2JB 3A6NC 3IP4C 4CSRA 1TZYD 1H3OA 3KWQD 3UTAD 1R4VA 1M19A 3EPHA 1S32C 5CPJC 4J8WC 3EPJA 4YS3D 4H9NA 3VH6W 3MGPB 1A7WA 1ZLAD 3REHA 1ID3D 5B1LA 3VH6T 4EO5C 4G92C 3X1TC 5B1MA 4UPKA 4H9RB 2AROA 2F8NA 1P3OD 1P3IC 3NQUA 1P3MB 3LJAB 4Z66A 1BH8B 5F99D 3AYWD 4KGCB 1JFIB 3AN2D 5DNNA 3H0MC 2FJ7B 3AZGA 1F66A 1P3PD 3X1SC 4LD9B 3AZKA 4J8XA 5B40B 1KX3D 5B0ZD 1KX4D 4KUDC 3W99B 3TU4D 3X1UD 4QLCA 1WWIA 5AVBA 4R8PD 3REKA 1KX3A 3MNNC 5AV8C 3V9RB 3W96D 3MGSC 5GXQA 5CPIA 1P3FA 3B6GC 2HUEC 1P3GD 5B0YA 5B32D 5JRGC 1W2EA 3LZ1C 3AV2C 1M1AC 3WAAB 4H9QA 5GSUC 3AZEA 1U35A 4J8VD 1HTAA 1TZYC 3B0DC 3KWQC 3UTAC 3FDDA 3WA9D 5AVCD 3RELD 5B32A 5B33B 2NZDD 3AZFD 4ZUXA 2Y2NA 4H9OB 3LELB 5B2JA 4YS3C 4YM6C 5C3IC 1ZLAC 2G5IC 1ID3C 5GT3B 3RELA 3O62D 1KU5A 2NZDA 2JSSA 4Z5TB 3AZIB 1P3OC 2YFWB 3W97D 2G5HC 2RVQD 5F99C 3AYWC 1HQ3D 3MGPA 3REJD 3AN2C 1N1JB 5DNMD 2FFFB 1P3PC 3VH6A 5KDMB 1P3KB 1P3MA 3LJAA 1KX3C 5B0ZC 3AZLB 1BH8A 1KX4C 3MVDD 1JFIA 4KGCA 3F6TA 3TU4C 3X1UC 2FJ7A 1ULYA 3LZ0B 4R8PC 1EQZD 4WJ3C 3UTBD 3REIB 4LD9A 5B40A 3C1CB 3W96C 3MNNB 2XD5A 5CPKD 2HIOB 3W99A 5AV6D 1P3GC 3AZNB 5AV5B 4XUJD 3AZJB 4WU8B 3LZ1B 2Y2IA 3AFAD 1KX5D 4J8VC 3V9RA 4WU9D 4H9PB 5CPKA 3WA9C 3WTPB 3UT9D 5AVCC 3RELC 1P3AB 2PYOD 1B6WA 2NZDC 3AZFC 4J8UD 3WAAA 2XD1A 4YM6B 1TAFA 3NQJB 2RIQA
chains in the Genus database with same CATH topology
3O62C 5B33A 5B24A 4XZQD 5AY8D 3W97C 3LELA 4H9OA 2RVQC 2ZM5A 1P34C 1HQ3C 3REJC 3MGQB 5B31A 2Y2HA 4H9SA 5DNMC 5GT3A 5CP6B 2CV5B 1M19D 5GT0B 2VQRA 3B0CT 4Z5TA 5JA4B 3P5JB 3MVDC 3REHD 2F8NH 5B1LD 1N1JA 1P3LB 5B1MD 2Y2LA 4KHAB 5B2IB 3AV1A 2AROD 1EQZC 2F8ND 3UTBC 1P3KA 2CWEA 4Z66D 4ZBJC 5CPKC 2ZY5A 3AZMB 5DNND 5AV6C 1T3UA 2NQBB 4JJNB 4XUJC 2BYMB 3LZ0A 3AZGD 1F66D 3REIA 3AZKD 3AFAC 3C1CA 4J8XD 3X1VB 1KX5C 4WU9C 2ZY3A 1BFMA 2HIOA 5BNVB 4M6BA 4QLCD 3KUYB 3UT9C 5AVBD 5AV5A 3AZNA 1M18B 2PYOC 5AVCB 4J8UC 3REKD 4WU8A 3AZJA 3WKJB 4HGAB 5AV9C 5GXQD 5CPID 1P3FD 3C1BB 3AZHB 2Y2OA 1P3AA 5B0YD 3KXBA 1AOIB 4XZQC 5AY8C 3VH5W 5BO0B 5E5AB 4X23B 4AWLC 3MGRB 3B0BA 3AZED 1U35D 3VH5T 1P34B 3NQJA 3B6FB 1M19C 3W98B 5DNMB 1P3BD 4ZUXD 5B2JD 2L5AA 3MGQA 3A6NB 3REHC 3A1KA 5B1LC 4NFTA 5B1MC 5GT0A 2AROC 1P3BA 1S32B 5CPJB 5JA4A 4J8WB 4Z66C 4NE3A 3MGPD 3EPKA 5DNNC 3A1IA 5BS7A 1P3LA 3AZGC 4KHAA 4EO5B 4G92B 5B2IA 3X1TB 1F66C 2Y2PA 3AZKC 4J8XC 1P3MD 3LJAD 4Z2MH 1P3IB 4KGCD 3AZMA 2Y2JA 2FJ7D 4QLCC 2NQBA 5AVBC 4JJNA 2BYMA 4H9RA 5FUGB 3REKC 4LD9D 3X1SB 2DQNC 5B40D 3X1VA 5GXQC 5CPIC 1P3FC 5BNVA 5AV9B 3W99D 4G91C 4KUDB 3KUYA 2IO5C 1M18A 5B0YC 2BYKB 3AZEC 3WKJA 1U35C 3AL0C 5AV8B 3MGSB 3C1BA 4CSRB 2DF4C 3EPLA 3B6GB 1BH9B 2HUEB 5B32C 1AOIA 1P3BC 2ZY4A 5BO0A 5JRGB 5E5AA 4ZUXC 4X23A 3MGRA 3AV2B 1PZRA 5B2JC 1M1AB 3WAAD 5GSUB 5G49B 3VH5A 1TZYB 3B6FA 3B0DB 3KWQB 3UTAB 5B1MB 5B33D 5B24D 3LELD 4NE5A 2J8PA 4WZSB 3MGPC 4YS3B 3A6NA 5C3IB 5B31D 1ZLAB 1ID3B 5GT3D 4Z5TD 3AZID 1S32A 5CPJA 1P3MC 3LJAC 1P3OB 4J8WA 5F99B 4KGCC 3AYWB 3AN2B 2FJ7C 4E45A 3X1TA 3AV1D 3AZIA 1P3PB 2YFWA 4LD9C 4CAYB 1P3KD 5B40C 1P3IA 2Y2GA 3AZLD 1KX3B 5B0ZB 1KX4B 3W99C 3TU4B 3X1UB 2IO5B 3LZ0D 5KDMA 5FUGA 3REID 3X1SA 4R8PB 3C1CD 3AZLA 3MNND 3W96B 2HIOD 4KUDA 3AZND 5AV5D 1Q9CA 4UUZB 1P3GB 2YFVB 5B32B 3AZJD 4WU8D 2BYKA 3WAAC 2JCHA 4WV4B 4ZUXB 3MNNA 5AV8A 4J8VB 3MGSA 3WTPD 3B6GA 3WA9B 1BH9A 1P3AD 3KXBD 5B33C 3RELB 5B24C 5JRGA 3LZ1A 3LELC 3AZFB 3AV2A 1M1AA 2NZDB 5GSUA 5G49A 4H9PA 4DRAA 2F8NG 4YM6D 1TZYA 5B31C 4H9SC 3WTPA 2Y2MA 5GT3C 3KWQA 3UTAA 3O62B 4Z5TC 3AZIC 4NE6A 5BNXB 2UWXA 3W97B 4YS3A 4YM6A 3MGQD 1HQ3B 3REJB 1ZLAA 1ID3A 5CP6D 2CV5D 5GT0D 3AV1C 1P3KC 1P3OA 3AZLC 5F99A 3AYWA 3MVDB 3AN2A 5CP6A 2CV5A 4E44A 4DQYB 1P3LD 2W8SA 3LZ0C 5B2ID 1P3PA 3REIC 3KFUG 4CAYA 1EQZB 3C1CC 3UTBB 5B0ZA 1KX4A 4ZBJB 3AZMD 2HIOC 5CPKB 3TU4A 3X1UA 4DRBA 1WWSA 2Y2QA 5AV5C 4JJND 5AV6B 3R45B 3AZNC 2NQBD 3H0RC 4XUJB 3AZJC 4WU8C 4R8PA 3X1VD 5B32G 3AFAB 1KX5B 3W96A 4WU9B 1TAFB 3WTPC 3KUYD 1M18D 1P3AC 4UUZA 3KXBC 3UT9B 1P3GA 2YFVA 2PYOB 5B24B 4J8UB 3WKJD 4J8VA 5BT1D 3C1BD 3AZHD 5B31B 3WA9A 1AOID 5AVCA 3AZFA 5E5AD 4XZQB 4X23D 5AY8B 3MGRD 2ZY2A 4AWLB 1B67A 4WNNB 3MGQC 1P34D 3AZHA 1H3OB 5CP6C 2CV5C 3B6FD 3W98D 4Z2MG 5GT0C 3O62A 1M19B 3AV1B 5BNXA 3W97A 2F8NK 1P34A 4H9NB 3A6ND 1HQ3A 3REJA 5BS7C 3W98A 3REHB 1P3LC 5B1LB 1Z2CB 5DNMA 5B2IC 2JE5A 1S32D 5CPJD 2AROB 2F8NB 4J8WD 3NQUB 4Z66B 3KSYA 3AZMC 3MVDA 5DNNB 2NQBC 4JJNC 3X1TD 3AZGB 3WTPE 1F66B 1EQZA 3X1VC 3UTBA 3AZKB 1P3ID 4J8XB 5CHLB 3KUYC 1M18C 5AV6A 3R45A 1F1EA 4QLCB 5AVBB 4XUJA 3KXBB 3X1SD 3WKJC 4HGAC 3REKB 3AFAA 1KX5A 3H0LC 3EG5B 5BT1C 4WU9A 5GXQB 5AV9D 3C1BC 5CPIB 3AZHC 1P3FB 2BG1A 4KUDD 4G91B 3UT9A 1AOIC 2PYOA 5B31G 5B0YB 5E5AC 4X23C 4J8UA 3MGRC 4H9QB 3AZEB 5AV8D 1U35B 2F2AC 3MGSD 5AV9A 2Y2KA 3B6FC 3W98C 3B0CW 3B6GD 5JRGD 3LZ1D 4XZQA 3AV2D 1P3BB 2LY8A 5AY8A 1M1AD 5GSUD 4WNNA 5B2JB 3A6NC 3IP4C 4CSRA 1TZYD 1H3OA 3KWQD 3UTAD 1R4VA 1M19A 3EPHA 1S32C 5CPJC 4J8WC 3EPJA 4YS3D 4H9NA 3VH6W 3MGPB 1A7WA 1ZLAD 3REHA 1ID3D 5B1LA 3VH6T 4EO5C 4G92C 3X1TC 5B1MA 4UPKA 4H9RB 2AROA 2F8NA 1P3OD 1P3IC 3NQUA 1P3MB 3LJAB 4Z66A 1BH8B 5F99D 3AYWD 4KGCB 1JFIB 3AN2D 5DNNA 3H0MC 2FJ7B 3AZGA 1F66A 1P3PD 3X1SC 4LD9B 3AZKA 4J8XA 5B40B 1KX3D 5B0ZD 1KX4D 4KUDC 3W99B 3TU4D 3X1UD 4QLCA 1WWIA 5AVBA 4R8PD 3REKA 1KX3A 3MNNC 5AV8C 3V9RB 3W96D 3MGSC 5GXQA 5CPIA 1P3FA 3B6GC 2HUEC 1P3GD 5B0YA 5B32D 5JRGC 1W2EA 3LZ1C 3AV2C 1M1AC 3WAAB 4H9QA 5GSUC 3AZEA 1U35A 4J8VD 1HTAA 1TZYC 3B0DC 3KWQC 3UTAC 3FDDA 3WA9D 5AVCD 3RELD 5B32A 5B33B 2NZDD 3AZFD 4ZUXA 2Y2NA 4H9OB 3LELB 5B2JA 4YS3C 4YM6C 5C3IC 1ZLAC 2G5IC 1ID3C 5GT3B 3RELA 3O62D 1KU5A 2NZDA 2JSSA 4Z5TB 3AZIB 1P3OC 2YFWB 3W97D 2G5HC 2RVQD 5F99C 3AYWC 1HQ3D 3MGPA 3REJD 3AN2C 1N1JB 5DNMD 2FFFB 1P3PC 3VH6A 5KDMB 1P3KB 1P3MA 3LJAA 1KX3C 5B0ZC 3AZLB 1BH8A 1KX4C 3MVDD 1JFIA 4KGCA 3F6TA 3TU4C 3X1UC 2FJ7A 1ULYA 3LZ0B 4R8PC 1EQZD 4WJ3C 3UTBD 3REIB 4LD9A 5B40A 3C1CB 3W96C 3MNNB 2XD5A 5CPKD 2HIOB 3W99A 5AV6D 1P3GC 3AZNB 5AV5B 4XUJD 3AZJB 4WU8B 3LZ1B 2Y2IA 3AFAD 1KX5D 4J8VC 3V9RA 4WU9D 4H9PB 5CPKA 3WA9C 3WTPB 3UT9D 5AVCC 3RELC 1P3AB 2PYOD 1B6WA 2NZDC 3AZFC 4J8UD 3WAAA 2XD1A 4YM6B 1TAFA 3NQJB 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 C;  5B33 A;  5B24 A;  4XZQ D;  5AY8 D;  3W97 C;  3LEL A;  4H9O A;  2RVQ C;  1P34 C;  1HQ3 C;  3REJ C;  3MGQ B;  5B31 A;  4H9S A;  5DNM C;  5GT3 A;  5CP6 B;  2CV5 B;  1M19 D;  5GT0 B;  3B0C T;  4Z5T A;  5JA4 B;  3MVD C;  3REH D;  2F8N H;  5B1L D;  1N1J A;  1P3L B;  5B1M D;  4KHA B;  5B2I B;  3AV1 A;  2ARO D;  1EQZ C;  2F8N D;  3UTB C;  1P3K A;  2CWE A;  4Z66 D;  4ZBJ C;  5CPK C;  3AZM B;  5DNN D;  5AV6 C;  2NQB B;  4JJN B;  4XUJ C;  2BYM B;  3LZ0 A;  3AZG D;  1F66 D;  3REI A;  3AZK D;  3AFA C;  3C1C A;  4J8X D;  3X1V B;  1KX5 C;  4WU9 C;  1BFM A;  2HIO A;  5BNV B;  4M6B A;  4QLC D;  3KUY B;  3UT9 C;  5AVB D;  5AV5 A;  3AZN A;  1M18 B;  2PYO C;  5AVC B;  4J8U C;  3REK D;  4WU8 A;  3AZJ A;  3WKJ B;  4HGA B;  5AV9 C;  5GXQ D;  5CPI D;  1P3F D;  3C1B B;  3AZH B;  1P3A A;  5B0Y D;  3KXB A;  1AOI B;  4XZQ C;  5AY8 C;  3VH5 W;  5BO0 B;  5E5A B;  4X23 B;  4AWL C;  3MGR B;  3B0B A;  3AZE D;  1U35 D;  3VH5 T;  1P34 B;  3NQJ A;  3B6F B;  1M19 C;  3W98 B;  5DNM B;  1P3B D;  4ZUX D;  5B2J D;  2L5A A;  3MGQ A;  3A6N B;  3REH C;  5B1L C;  4NFT A;  5B1M C;  5GT0 A;  2ARO C;  1P3B A;  1S32 B;  5CPJ B;  5JA4 A;  4J8W B;  4Z66 C;  4NE3 A;  3MGP D;  5DNN C;  5BS7 A;  1P3L A;  3AZG C;  4KHA A;  4EO5 B;  4G92 B;  5B2I A;  3X1T B;  1F66 C;  3AZK C;  4J8X C;  1P3M D;  3LJA D;  4Z2M H;  1P3I B;  4KGC D;  3AZM A;  2FJ7 D;  4QLC C;  2NQB A;  5AVB C;  4JJN A;  2BYM A;  4H9R A;  5FUG B;  3REK C;  4LD9 D;  3X1S B;  5B40 D;  3X1V A;  5GXQ C;  5CPI C;  1P3F C;  5BNV A;  5AV9 B;  3W99 D;  4G91 C;  4KUD B;  3KUY A;  2IO5 C;  1M18 A;  5B0Y C;  2BYK B;  3AZE C;  3WKJ A;  1U35 C;  5AV8 B;  3MGS B;  3C1B A;  4CSR B;  3B6G B;  1BH9 B;  2HUE B;  5B32 C;  1AOI A;  1P3B C;  5BO0 A;  5JRG B;  5E5A A;  4ZUX C;  4X23 A;  3MGR A;  3AV2 B;  5B2J C;  1M1A B;  3WAA D;  5GSU B;  5G49 B;  3VH5 A;  1TZY B;  3B6F A;  3B0D B;  3KWQ B;  3UTA B;  5B1M B;  5B33 D;  5B24 D;  3LEL D;  4NE5 A;  4WZS B;  3MGP C;  4YS3 B;  3A6N A;  5C3I B;  5B31 D;  1ZLA B;  1ID3 B;  5GT3 D;  4Z5T D;  3AZI D;  1S32 A;  5CPJ A;  1P3M C;  3LJA C;  1P3O B;  4J8W A;  5F99 B;  4KGC C;  3AYW B;  3AN2 B;  2FJ7 C;  4E45 A;  3X1T A;  3AV1 D;  3AZI A;  1P3P B;  2YFW A;  4LD9 C;  4CAY B;  1P3K D;  5B40 C;  1P3I A;  3AZL D;  1KX3 B;  5B0Z B;  1KX4 B;  3W99 C;  3TU4 B;  3X1U B;  2IO5 B;  3LZ0 D;  5KDM A;  5FUG A;  3REI D;  3X1S A;  4R8P B;  3C1C D;  3AZL A;  3MNN D;  3W96 B;  2HIO D;  4KUD A;  3AZN D;  5AV5 D;  1Q9C A;  4UUZ B;  1P3G B;  2YFV B;  5B32 B;  3AZJ D;  4WU8 D;  2BYK A;  3WAA C;  4WV4 B;  4ZUX B;  3MNN A;  5AV8 A;  4J8V B;  3MGS A;  3WTP D;  3B6G A;  3WA9 B;  1BH9 A;  1P3A D;  3KXB D;  5B33 C;  3REL B;  5B24 C;  5JRG A;  3LZ1 A;  3LEL C;  3AZF B;  3AV2 A;  1M1A A;  2NZD B;  5GSU A;  5G49 A;  4H9P A;  4DRA A;  2F8N G;  4YM6 D;  1TZY A;  5B31 C;  4H9S C;  3WTP A;  3KWQ A;  5GT3 C;  3UTA A;  3O62 B;  4Z5T C;  3AZI C;  4NE6 A;  5BNX B;  3W97 B;  4YS3 A;  4YM6 A;  3MGQ D;  1HQ3 B;  3REJ B;  1ZLA A;  1ID3 A;  5CP6 D;  2CV5 D;  5GT0 D;  3AV1 C;  1P3K C;  1P3O A;  3AZL C;  5F99 A;  3AYW A;  3MVD B;  3AN2 A;  5CP6 A;  2CV5 A;  4E44 A;  1P3L D;  3LZ0 C;  5B2I D;  1P3P A;  3REI C;  4CAY A;  1EQZ B;  3C1C C;  3UTB B;  5B0Z A;  1KX4 A;  4ZBJ B;  3AZM D;  2HIO C;  5CPK B;  3TU4 A;  3X1U A;  4DRB A;  1WWS A;  5AV5 C;  4JJN D;  3AZN C;  5AV6 B;  3R45 B;  2NQB D;  4XUJ B;  3AZJ C;  4WU8 C;  4R8P A;  3X1V D;  5B32 G;  3AFA B;  1KX5 B;  3W96 A;  4WU9 B;  1TAF B;  3WTP C;  3KUY D;  1M18 D;  1P3A C;  4UUZ A;  3KXB C;  3UT9 B;  1P3G A;  2YFV A;  2PYO B;  5B24 B;  4J8U B;  3WKJ D;  4J8V A;  5BT1 D;  3C1B D;  3AZH D;  5B31 B;  3WA9 A;  1AOI D;  5AVC A;  3AZF A;  5E5A D;  4XZQ B;  4X23 D;  5AY8 B;  3MGR D;  4AWL B;  1B67 A;  4WNN B;  3MGQ C;  1P34 D;  3AZH A;  1H3O B;  5CP6 C;  2CV5 C;  3B6F D;  3W98 D;  4Z2M G;  5GT0 C;  3O62 A;  1M19 B;  3AV1 B;  5BNX A;  3W97 A;  2F8N K;  1P34 A;  4H9N B;  3A6N D;  1HQ3 A;  3REJ A;  5BS7 C;  3W98 A;  3REH B;  1P3L C;  5B1L B;  5DNM A;  5B2I C;  1S32 D;  5CPJ D;  2ARO B;  2F8N B;  4J8W D;  3NQU B;  4Z66 B;  3KSY A;  3AZM C;  3MVD A;  5DNN B;  2NQB C;  4JJN C;  3X1T D;  3AZG B;  3WTP E;  1F66 B;  1EQZ A;  3X1V C;  3UTB A;  3AZK B;  1P3I D;  4J8X B;  5CHL B;  3KUY C;  1M18 C;  5AV6 A;  3R45 A;  1F1E A;  4QLC B;  5AVB B;  4XUJ A;  3KXB B;  3X1S D;  3WKJ C;  4HGA C;  3REK B;  3AFA A;  1KX5 A;  5BT1 C;  4WU9 A;  5GXQ B;  5AV9 D;  3C1B C;  5CPI B;  3AZH C;  1P3F B;  4KUD D;  4G91 B;  3UT9 A;  1AOI C;  2PYO A;  5B31 G;  5B0Y B;  5E5A C;  4X23 C;  4J8U A;  3MGR C;  4H9Q B;  3AZE B;  5AV8 D;  1U35 B;  3MGS D;  5AV9 A;  3B6F C;  3W98 C;  3B0C W;  3B6G D;  5JRG D;  3LZ1 D;  4XZQ A;  3AV2 D;  1P3B B;  2LY8 A;  5AY8 A;  1M1A D;  5GSU D;  4WNN A;  5B2J B;  3A6N C;  4CSR A;  1TZY D;  1H3O A;  3KWQ D;  3UTA D;  1R4V A;  1M19 A;  1S32 C;  5CPJ C;  4J8W C;  4YS3 D;  4H9N A;  3VH6 W;  3MGP B;  1A7W A;  1ZLA D;  3REH A;  1ID3 D;  5B1L A;  3VH6 T;  4EO5 C;  4G92 C;  3X1T C;  5B1M A;  4H9R B;  2ARO A;  2F8N A;  1P3O D;  1P3I C;  3NQU A;  1P3M B;  3LJA B;  4Z66 A;  1BH8 B;  5F99 D;  3AYW D;  4KGC B;  1JFI B;  3AN2 D;  5DNN A;  2FJ7 B;  3AZG A;  1F66 A;  1P3P D;  3X1S C;  4LD9 B;  3AZK A;  4J8X A;  5B40 B;  1KX3 D;  5B0Z D;  1KX4 D;  4KUD C;  3W99 B;  3TU4 D;  3X1U D;  4QLC A;  1WWI A;  5AVB A;  4R8P D;  3REK A;  1KX3 A;  3MNN C;  5AV8 C;  3V9R B;  3W96 D;  3MGS C;  5GXQ A;  5CPI A;  1P3F A;  3B6G C;  2HUE C;  1P3G D;  5B0Y A;  5B32 D;  5JRG C;  3LZ1 C;  3AV2 C;  1M1A C;  3WAA B;  4H9Q A;  5GSU C;  3AZE A;  1U35 A;  4J8V D;  1HTA A;  1TZY C;  3B0D C;  3KWQ C;  3UTA C;  3WA9 D;  5AVC D;  3REL D;  5B32 A;  5B33 B;  2NZD D;  3AZF D;  4ZUX A;  3LEL B;  4H9O B;  5B2J A;  4YS3 C;  4YM6 C;  5C3I C;  1ZLA C;  1ID3 C;  5GT3 B;  3REL A;  3O62 D;  1KU5 A;  2NZD A;  2JSS A;  4Z5T B;  3AZI B;  1P3O C;  2YFW B;  3W97 D;  2RVQ D;  5F99 C;  3AYW C;  1HQ3 D;  3MGP A;  3REJ D;  3AN2 C;  1N1J B;  5DNM D;  1P3P C;  3VH6 A;  5KDM B;  1P3K B;  1P3M A;  3LJA A;  1KX3 C;  5B0Z C;  3AZL B;  1BH8 A;  1KX4 C;  3MVD D;  1JFI A;  4KGC A;  3TU4 C;  3X1U C;  2FJ7 A;  1ULY A;  3LZ0 B;  4R8P C;  1EQZ D;  3UTB D;  3REI B;  4LD9 A;  5B40 A;  3C1C B;  3W96 C;  3MNN B;  5CPK D;  2HIO B;  3W99 A;  5AV6 D;  1P3G C;  3AZN B;  5AV5 B;  4XUJ D;  3AZJ B;  4WU8 B;  3LZ1 B;  3AFA D;  1KX5 D;  4J8V C;  3V9R A;  4WU9 D;  4H9P B;  5CPK A;  3WA9 C;  3WTP B;  3UT9 D;  5AVC C;  3REL C;  1P3A B;  2PYO D;  1B6W A;  2NZD C;  3AZF C;  4J8U D;  3WAA A;  4YM6 B;  1TAF A;  3NQJ B; 
#chains in the Genus database with same CATH topology
 3O62 C;  5B33 A;  5B24 A;  4XZQ D;  5AY8 D;  3W97 C;  3LEL A;  4H9O A;  2RVQ C;  2ZM5 A;  1P34 C;  1HQ3 C;  3REJ C;  3MGQ B;  5B31 A;  2Y2H A;  4H9S A;  5DNM C;  5GT3 A;  5CP6 B;  2CV5 B;  1M19 D;  5GT0 B;  2VQR A;  3B0C T;  4Z5T A;  5JA4 B;  3P5J B;  3MVD C;  3REH D;  2F8N H;  5B1L D;  1N1J A;  1P3L B;  5B1M D;  2Y2L A;  4KHA B;  5B2I B;  3AV1 A;  2ARO D;  1EQZ C;  2F8N D;  3UTB C;  1P3K A;  2CWE A;  4Z66 D;  4ZBJ C;  5CPK C;  2ZY5 A;  3AZM B;  5DNN D;  5AV6 C;  1T3U A;  2NQB B;  4JJN B;  4XUJ C;  2BYM B;  3LZ0 A;  3AZG D;  1F66 D;  3REI A;  3AZK D;  3AFA C;  3C1C A;  4J8X D;  3X1V B;  1KX5 C;  4WU9 C;  2ZY3 A;  1BFM A;  2HIO A;  5BNV B;  4M6B A;  4QLC D;  3KUY B;  3UT9 C;  5AVB D;  5AV5 A;  3AZN A;  1M18 B;  2PYO C;  5AVC B;  4J8U C;  3REK D;  4WU8 A;  3AZJ A;  3WKJ B;  4HGA B;  5AV9 C;  5GXQ D;  5CPI D;  1P3F D;  3C1B B;  3AZH B;  2Y2O A;  1P3A A;  5B0Y D;  3KXB A;  1AOI B;  4XZQ C;  5AY8 C;  3VH5 W;  5BO0 B;  5E5A B;  4X23 B;  4AWL C;  3MGR B;  3B0B A;  3AZE D;  1U35 D;  3VH5 T;  1P34 B;  3NQJ A;  3B6F B;  1M19 C;  3W98 B;  5DNM B;  1P3B D;  4ZUX D;  5B2J D;  2L5A A;  3MGQ A;  3A6N B;  3REH C;  3A1K A;  5B1L C;  4NFT A;  5B1M C;  5GT0 A;  2ARO C;  1P3B A;  1S32 B;  5CPJ B;  5JA4 A;  4J8W B;  4Z66 C;  4NE3 A;  3MGP D;  3EPK A;  5DNN C;  3A1I A;  5BS7 A;  1P3L A;  3AZG C;  4KHA A;  4EO5 B;  4G92 B;  5B2I A;  3X1T B;  1F66 C;  2Y2P A;  3AZK C;  4J8X C;  1P3M D;  3LJA D;  4Z2M H;  1P3I B;  4KGC D;  3AZM A;  2Y2J A;  2FJ7 D;  4QLC C;  2NQB A;  5AVB C;  4JJN A;  2BYM A;  4H9R A;  5FUG B;  3REK C;  4LD9 D;  3X1S B;  2DQN C;  5B40 D;  3X1V A;  5GXQ C;  5CPI C;  1P3F C;  5BNV A;  5AV9 B;  3W99 D;  4G91 C;  4KUD B;  3KUY A;  2IO5 C;  1M18 A;  5B0Y C;  2BYK B;  3AZE C;  3WKJ A;  1U35 C;  3AL0 C;  5AV8 B;  3MGS B;  3C1B A;  4CSR B;  2DF4 C;  3EPL A;  3B6G B;  1BH9 B;  2HUE B;  5B32 C;  1AOI A;  1P3B C;  2ZY4 A;  5BO0 A;  5JRG B;  5E5A A;  4ZUX C;  4X23 A;  3MGR A;  3AV2 B;  1PZR A;  5B2J C;  1M1A B;  3WAA D;  5GSU B;  5G49 B;  3VH5 A;  1TZY B;  3B6F A;  3B0D B;  3KWQ B;  3UTA B;  5B1M B;  5B33 D;  5B24 D;  3LEL D;  4NE5 A;  2J8P A;  4WZS B;  3MGP C;  4YS3 B;  3A6N A;  5C3I B;  5B31 D;  1ZLA B;  1ID3 B;  5GT3 D;  4Z5T D;  3AZI D;  1S32 A;  5CPJ A;  1P3M C;  3LJA C;  1P3O B;  4J8W A;  5F99 B;  4KGC C;  3AYW B;  3AN2 B;  2FJ7 C;  4E45 A;  3X1T A;  3AV1 D;  3AZI A;  1P3P B;  2YFW A;  4LD9 C;  4CAY B;  1P3K D;  5B40 C;  1P3I A;  2Y2G A;  3AZL D;  1KX3 B;  5B0Z B;  1KX4 B;  3W99 C;  3TU4 B;  3X1U B;  2IO5 B;  3LZ0 D;  5KDM A;  5FUG A;  3REI D;  3X1S A;  4R8P B;  3C1C D;  3AZL A;  3MNN D;  3W96 B;  2HIO D;  4KUD A;  3AZN D;  5AV5 D;  1Q9C A;  4UUZ B;  1P3G B;  2YFV B;  5B32 B;  3AZJ D;  4WU8 D;  2BYK A;  3WAA C;  2JCH A;  4WV4 B;  4ZUX B;  3MNN A;  5AV8 A;  4J8V B;  3MGS A;  3WTP D;  3B6G A;  3WA9 B;  1BH9 A;  1P3A D;  3KXB D;  5B33 C;  3REL B;  5B24 C;  5JRG A;  3LZ1 A;  3LEL C;  3AZF B;  3AV2 A;  1M1A A;  2NZD B;  5GSU A;  5G49 A;  4H9P A;  4DRA A;  2F8N G;  4YM6 D;  1TZY A;  5B31 C;  4H9S C;  3WTP A;  2Y2M A;  5GT3 C;  3KWQ A;  3UTA A;  3O62 B;  4Z5T C;  3AZI C;  4NE6 A;  5BNX B;  2UWX A;  3W97 B;  4YS3 A;  4YM6 A;  3MGQ D;  1HQ3 B;  3REJ B;  1ZLA A;  1ID3 A;  5CP6 D;  2CV5 D;  5GT0 D;  3AV1 C;  1P3K C;  1P3O A;  3AZL C;  5F99 A;  3AYW A;  3MVD B;  3AN2 A;  5CP6 A;  2CV5 A;  4E44 A;  4DQY B;  1P3L D;  2W8S A;  3LZ0 C;  5B2I D;  1P3P A;  3REI C;  3KFU G;  4CAY A;  1EQZ B;  3C1C C;  3UTB B;  5B0Z A;  1KX4 A;  4ZBJ B;  3AZM D;  2HIO C;  5CPK B;  3TU4 A;  3X1U A;  4DRB A;  1WWS A;  2Y2Q A;  5AV5 C;  4JJN D;  5AV6 B;  3R45 B;  3AZN C;  2NQB D;  3H0R C;  4XUJ B;  3AZJ C;  4WU8 C;  4R8P A;  3X1V D;  5B32 G;  3AFA B;  1KX5 B;  3W96 A;  4WU9 B;  1TAF B;  3WTP C;  3KUY D;  1M18 D;  1P3A C;  4UUZ A;  3KXB C;  3UT9 B;  1P3G A;  2YFV A;  2PYO B;  5B24 B;  4J8U B;  3WKJ D;  4J8V A;  5BT1 D;  3C1B D;  3AZH D;  5B31 B;  3WA9 A;  1AOI D;  5AVC A;  3AZF A;  5E5A D;  4XZQ B;  4X23 D;  5AY8 B;  3MGR D;  2ZY2 A;  4AWL B;  1B67 A;  4WNN B;  3MGQ C;  1P34 D;  3AZH A;  1H3O B;  5CP6 C;  2CV5 C;  3B6F D;  3W98 D;  4Z2M G;  5GT0 C;  3O62 A;  1M19 B;  3AV1 B;  5BNX A;  3W97 A;  2F8N K;  1P34 A;  4H9N B;  3A6N D;  1HQ3 A;  3REJ A;  5BS7 C;  3W98 A;  3REH B;  1P3L C;  5B1L B;  1Z2C B;  5DNM A;  5B2I C;  2JE5 A;  1S32 D;  5CPJ D;  2ARO B;  2F8N B;  4J8W D;  3NQU B;  4Z66 B;  3KSY A;  3AZM C;  3MVD A;  5DNN B;  2NQB C;  4JJN C;  3X1T D;  3AZG B;  3WTP E;  1F66 B;  1EQZ A;  3X1V C;  3UTB A;  3AZK B;  1P3I D;  4J8X B;  5CHL B;  3KUY C;  1M18 C;  5AV6 A;  3R45 A;  1F1E A;  4QLC B;  5AVB B;  4XUJ A;  3KXB B;  3X1S D;  3WKJ C;  4HGA C;  3REK B;  3AFA A;  1KX5 A;  3H0L C;  3EG5 B;  5BT1 C;  4WU9 A;  5GXQ B;  5AV9 D;  3C1B C;  5CPI B;  3AZH C;  1P3F B;  2BG1 A;  4KUD D;  4G91 B;  3UT9 A;  1AOI C;  2PYO A;  5B31 G;  5B0Y B;  5E5A C;  4X23 C;  4J8U A;  3MGR C;  4H9Q B;  3AZE B;  5AV8 D;  1U35 B;  2F2A C;  3MGS D;  5AV9 A;  2Y2K A;  3B6F C;  3W98 C;  3B0C W;  3B6G D;  5JRG D;  3LZ1 D;  4XZQ A;  3AV2 D;  1P3B B;  2LY8 A;  5AY8 A;  1M1A D;  5GSU D;  4WNN A;  5B2J B;  3A6N C;  3IP4 C;  4CSR A;  1TZY D;  1H3O A;  3KWQ D;  3UTA D;  1R4V A;  1M19 A;  3EPH A;  1S32 C;  5CPJ C;  4J8W C;  3EPJ A;  4YS3 D;  4H9N A;  3VH6 W;  3MGP B;  1A7W A;  1ZLA D;  3REH A;  1ID3 D;  5B1L A;  3VH6 T;  4EO5 C;  4G92 C;  3X1T C;  5B1M A;  4UPK A;  4H9R B;  2ARO A;  2F8N A;  1P3O D;  1P3I C;  3NQU A;  1P3M B;  3LJA B;  4Z66 A;  1BH8 B;  5F99 D;  3AYW D;  4KGC B;  1JFI B;  3AN2 D;  5DNN A;  3H0M C;  2FJ7 B;  3AZG A;  1F66 A;  1P3P D;  3X1S C;  4LD9 B;  3AZK A;  4J8X A;  5B40 B;  1KX3 D;  5B0Z D;  1KX4 D;  4KUD C;  3W99 B;  3TU4 D;  3X1U D;  4QLC A;  1WWI A;  5AVB A;  4R8P D;  3REK A;  1KX3 A;  3MNN C;  5AV8 C;  3V9R B;  3W96 D;  3MGS C;  5GXQ A;  5CPI A;  1P3F A;  3B6G C;  2HUE C;  1P3G D;  5B0Y A;  5B32 D;  5JRG C;  1W2E A;  3LZ1 C;  3AV2 C;  1M1A C;  3WAA B;  4H9Q A;  5GSU C;  3AZE A;  1U35 A;  4J8V D;  1HTA A;  1TZY C;  3B0D C;  3KWQ C;  3UTA C;  3FDD A;  3WA9 D;  5AVC D;  3REL D;  5B32 A;  5B33 B;  2NZD D;  3AZF D;  4ZUX A;  2Y2N A;  4H9O B;  3LEL B;  5B2J A;  4YS3 C;  4YM6 C;  5C3I C;  1ZLA C;  2G5I C;  1ID3 C;  5GT3 B;  3REL A;  3O62 D;  1KU5 A;  2NZD A;  2JSS A;  4Z5T B;  3AZI B;  1P3O C;  2YFW B;  3W97 D;  2G5H C;  2RVQ D;  5F99 C;  3AYW C;  1HQ3 D;  3MGP A;  3REJ D;  3AN2 C;  1N1J B;  5DNM D;  2FFF B;  1P3P C;  3VH6 A;  5KDM B;  1P3K B;  1P3M A;  3LJA A;  1KX3 C;  5B0Z C;  3AZL B;  1BH8 A;  1KX4 C;  3MVD D;  1JFI A;  4KGC A;  3F6T A;  3TU4 C;  3X1U C;  2FJ7 A;  1ULY A;  3LZ0 B;  4R8P C;  1EQZ D;  4WJ3 C;  3UTB D;  3REI B;  4LD9 A;  5B40 A;  3C1C B;  3W96 C;  3MNN B;  2XD5 A;  5CPK D;  2HIO B;  3W99 A;  5AV6 D;  1P3G C;  3AZN B;  5AV5 B;  4XUJ D;  3AZJ B;  4WU8 B;  3LZ1 B;  2Y2I A;  3AFA D;  1KX5 D;  4J8V C;  3V9R A;  4WU9 D;  4H9P B;  5CPK A;  3WA9 C;  3WTP B;  3UT9 D;  5AVC C;  3REL C;  1P3A B;  2PYO D;  1B6W A;  2NZD C;  3AZF C;  4J8U D;  3WAA A;  2XD1 A;  4YM6 B;  1TAF A;  3NQJ B;  2RIQ A; 
#chains in the Genus database with same CATH homology
 3O62 C;  5B33 A;  5B24 A;  4XZQ D;  5AY8 D;  3W97 C;  3LEL A;  4H9O A;  2RVQ C;  2ZM5 A;  1P34 C;  1HQ3 C;  3REJ C;  3MGQ B;  5B31 A;  2Y2H A;  4H9S A;  5DNM C;  5GT3 A;  5CP6 B;  2CV5 B;  1M19 D;  5GT0 B;  2VQR A;  3B0C T;  4Z5T A;  5JA4 B;  3P5J B;  3MVD C;  3REH D;  2F8N H;  5B1L D;  1N1J A;  1P3L B;  5B1M D;  2Y2L A;  4KHA B;  5B2I B;  3AV1 A;  2ARO D;  1EQZ C;  2F8N D;  3UTB C;  1P3K A;  2CWE A;  4Z66 D;  4ZBJ C;  5CPK C;  2ZY5 A;  3AZM B;  5DNN D;  5AV6 C;  1T3U A;  2NQB B;  4JJN B;  4XUJ C;  2BYM B;  3LZ0 A;  3AZG D;  1F66 D;  3REI A;  3AZK D;  3AFA C;  3C1C A;  4J8X D;  3X1V B;  1KX5 C;  4WU9 C;  2ZY3 A;  1BFM A;  2HIO A;  5BNV B;  4M6B A;  4QLC D;  3KUY B;  3UT9 C;  5AVB D;  5AV5 A;  3AZN A;  1M18 B;  2PYO C;  5AVC B;  4J8U C;  3REK D;  4WU8 A;  3AZJ A;  3WKJ B;  4HGA B;  5AV9 C;  5GXQ D;  5CPI D;  1P3F D;  3C1B B;  3AZH B;  2Y2O A;  1P3A A;  5B0Y D;  3KXB A;  1AOI B;  4XZQ C;  5AY8 C;  3VH5 W;  5BO0 B;  5E5A B;  4X23 B;  4AWL C;  3MGR B;  3B0B A;  3AZE D;  1U35 D;  3VH5 T;  1P34 B;  3NQJ A;  3B6F B;  1M19 C;  3W98 B;  5DNM B;  1P3B D;  4ZUX D;  5B2J D;  2L5A A;  3MGQ A;  3A6N B;  3REH C;  3A1K A;  5B1L C;  4NFT A;  5B1M C;  5GT0 A;  2ARO C;  1P3B A;  1S32 B;  5CPJ B;  5JA4 A;  4J8W B;  4Z66 C;  4NE3 A;  3MGP D;  3EPK A;  5DNN C;  3A1I A;  5BS7 A;  1P3L A;  3AZG C;  4KHA A;  4EO5 B;  4G92 B;  5B2I A;  3X1T B;  1F66 C;  2Y2P A;  3AZK C;  4J8X C;  1P3M D;  3LJA D;  4Z2M H;  1P3I B;  4KGC D;  3AZM A;  2Y2J A;  2FJ7 D;  4QLC C;  2NQB A;  5AVB C;  4JJN A;  2BYM A;  4H9R A;  5FUG B;  3REK C;  4LD9 D;  3X1S B;  2DQN C;  5B40 D;  3X1V A;  5GXQ C;  5CPI C;  1P3F C;  5BNV A;  5AV9 B;  3W99 D;  4G91 C;  4KUD B;  3KUY A;  2IO5 C;  1M18 A;  5B0Y C;  2BYK B;  3AZE C;  3WKJ A;  1U35 C;  3AL0 C;  5AV8 B;  3MGS B;  3C1B A;  4CSR B;  2DF4 C;  3EPL A;  3B6G B;  1BH9 B;  2HUE B;  5B32 C;  1AOI A;  1P3B C;  2ZY4 A;  5BO0 A;  5JRG B;  5E5A A;  4ZUX C;  4X23 A;  3MGR A;  3AV2 B;  1PZR A;  5B2J C;  1M1A B;  3WAA D;  5GSU B;  5G49 B;  3VH5 A;  1TZY B;  3B6F A;  3B0D B;  3KWQ B;  3UTA B;  5B1M B;  5B33 D;  5B24 D;  3LEL D;  4NE5 A;  2J8P A;  4WZS B;  3MGP C;  4YS3 B;  3A6N A;  5C3I B;  5B31 D;  1ZLA B;  1ID3 B;  5GT3 D;  4Z5T D;  3AZI D;  1S32 A;  5CPJ A;  1P3M C;  3LJA C;  1P3O B;  4J8W A;  5F99 B;  4KGC C;  3AYW B;  3AN2 B;  2FJ7 C;  4E45 A;  3X1T A;  3AV1 D;  3AZI A;  1P3P B;  2YFW A;  4LD9 C;  4CAY B;  1P3K D;  5B40 C;  1P3I A;  2Y2G A;  3AZL D;  1KX3 B;  5B0Z B;  1KX4 B;  3W99 C;  3TU4 B;  3X1U B;  2IO5 B;  3LZ0 D;  5KDM A;  5FUG A;  3REI D;  3X1S A;  4R8P B;  3C1C D;  3AZL A;  3MNN D;  3W96 B;  2HIO D;  4KUD A;  3AZN D;  5AV5 D;  1Q9C A;  4UUZ B;  1P3G B;  2YFV B;  5B32 B;  3AZJ D;  4WU8 D;  2BYK A;  3WAA C;  2JCH A;  4WV4 B;  4ZUX B;  3MNN A;  5AV8 A;  4J8V B;  3MGS A;  3WTP D;  3B6G A;  3WA9 B;  1BH9 A;  1P3A D;  3KXB D;  5B33 C;  3REL B;  5B24 C;  5JRG A;  3LZ1 A;  3LEL C;  3AZF B;  3AV2 A;  1M1A A;  2NZD B;  5GSU A;  5G49 A;  4H9P A;  4DRA A;  2F8N G;  4YM6 D;  1TZY A;  5B31 C;  4H9S C;  3WTP A;  2Y2M A;  5GT3 C;  3KWQ A;  3UTA A;  3O62 B;  4Z5T C;  3AZI C;  4NE6 A;  5BNX B;  2UWX A;  3W97 B;  4YS3 A;  4YM6 A;  3MGQ D;  1HQ3 B;  3REJ B;  1ZLA A;  1ID3 A;  5CP6 D;  2CV5 D;  5GT0 D;  3AV1 C;  1P3K C;  1P3O A;  3AZL C;  5F99 A;  3AYW A;  3MVD B;  3AN2 A;  5CP6 A;  2CV5 A;  4E44 A;  4DQY B;  1P3L D;  2W8S A;  3LZ0 C;  5B2I D;  1P3P A;  3REI C;  3KFU G;  4CAY A;  1EQZ B;  3C1C C;  3UTB B;  5B0Z A;  1KX4 A;  4ZBJ B;  3AZM D;  2HIO C;  5CPK B;  3TU4 A;  3X1U A;  4DRB A;  1WWS A;  2Y2Q A;  5AV5 C;  4JJN D;  5AV6 B;  3R45 B;  3AZN C;  2NQB D;  3H0R C;  4XUJ B;  3AZJ C;  4WU8 C;  4R8P A;  3X1V D;  5B32 G;  3AFA B;  1KX5 B;  3W96 A;  4WU9 B;  1TAF B;  3WTP C;  3KUY D;  1M18 D;  1P3A C;  4UUZ A;  3KXB C;  3UT9 B;  1P3G A;  2YFV A;  2PYO B;  5B24 B;  4J8U B;  3WKJ D;  4J8V A;  5BT1 D;  3C1B D;  3AZH D;  5B31 B;  3WA9 A;  1AOI D;  5AVC A;  3AZF A;  5E5A D;  4XZQ B;  4X23 D;  5AY8 B;  3MGR D;  2ZY2 A;  4AWL B;  1B67 A;  4WNN B;  3MGQ C;  1P34 D;  3AZH A;  1H3O B;  5CP6 C;  2CV5 C;  3B6F D;  3W98 D;  4Z2M G;  5GT0 C;  3O62 A;  1M19 B;  3AV1 B;  5BNX A;  3W97 A;  2F8N K;  1P34 A;  4H9N B;  3A6N D;  1HQ3 A;  3REJ A;  5BS7 C;  3W98 A;  3REH B;  1P3L C;  5B1L B;  1Z2C B;  5DNM A;  5B2I C;  2JE5 A;  1S32 D;  5CPJ D;  2ARO B;  2F8N B;  4J8W D;  3NQU B;  4Z66 B;  3KSY A;  3AZM C;  3MVD A;  5DNN B;  2NQB C;  4JJN C;  3X1T D;  3AZG B;  3WTP E;  1F66 B;  1EQZ A;  3X1V C;  3UTB A;  3AZK B;  1P3I D;  4J8X B;  5CHL B;  3KUY C;  1M18 C;  5AV6 A;  3R45 A;  1F1E A;  4QLC B;  5AVB B;  4XUJ A;  3KXB B;  3X1S D;  3WKJ C;  4HGA C;  3REK B;  3AFA A;  1KX5 A;  3H0L C;  3EG5 B;  5BT1 C;  4WU9 A;  5GXQ B;  5AV9 D;  3C1B C;  5CPI B;  3AZH C;  1P3F B;  2BG1 A;  4KUD D;  4G91 B;  3UT9 A;  1AOI C;  2PYO A;  5B31 G;  5B0Y B;  5E5A C;  4X23 C;  4J8U A;  3MGR C;  4H9Q B;  3AZE B;  5AV8 D;  1U35 B;  2F2A C;  3MGS D;  5AV9 A;  2Y2K A;  3B6F C;  3W98 C;  3B0C W;  3B6G D;  5JRG D;  3LZ1 D;  4XZQ A;  3AV2 D;  1P3B B;  2LY8 A;  5AY8 A;  1M1A D;  5GSU D;  4WNN A;  5B2J B;  3A6N C;  3IP4 C;  4CSR A;  1TZY D;  1H3O A;  3KWQ D;  3UTA D;  1R4V A;  1M19 A;  3EPH A;  1S32 C;  5CPJ C;  4J8W C;  3EPJ A;  4YS3 D;  4H9N A;  3VH6 W;  3MGP B;  1A7W A;  1ZLA D;  3REH A;  1ID3 D;  5B1L A;  3VH6 T;  4EO5 C;  4G92 C;  3X1T C;  5B1M A;  4UPK A;  4H9R B;  2ARO A;  2F8N A;  1P3O D;  1P3I C;  3NQU A;  1P3M B;  3LJA B;  4Z66 A;  1BH8 B;  5F99 D;  3AYW D;  4KGC B;  1JFI B;  3AN2 D;  5DNN A;  3H0M C;  2FJ7 B;  3AZG A;  1F66 A;  1P3P D;  3X1S C;  4LD9 B;  3AZK A;  4J8X A;  5B40 B;  1KX3 D;  5B0Z D;  1KX4 D;  4KUD C;  3W99 B;  3TU4 D;  3X1U D;  4QLC A;  1WWI A;  5AVB A;  4R8P D;  3REK A;  1KX3 A;  3MNN C;  5AV8 C;  3V9R B;  3W96 D;  3MGS C;  5GXQ A;  5CPI A;  1P3F A;  3B6G C;  2HUE C;  1P3G D;  5B0Y A;  5B32 D;  5JRG C;  1W2E A;  3LZ1 C;  3AV2 C;  1M1A C;  3WAA B;  4H9Q A;  5GSU C;  3AZE A;  1U35 A;  4J8V D;  1HTA A;  1TZY C;  3B0D C;  3KWQ C;  3UTA C;  3FDD A;  3WA9 D;  5AVC D;  3REL D;  5B32 A;  5B33 B;  2NZD D;  3AZF D;  4ZUX A;  2Y2N A;  4H9O B;  3LEL B;  5B2J A;  4YS3 C;  4YM6 C;  5C3I C;  1ZLA C;  2G5I C;  1ID3 C;  5GT3 B;  3REL A;  3O62 D;  1KU5 A;  2NZD A;  2JSS A;  4Z5T B;  3AZI B;  1P3O C;  2YFW B;  3W97 D;  2G5H C;  2RVQ D;  5F99 C;  3AYW C;  1HQ3 D;  3MGP A;  3REJ D;  3AN2 C;  1N1J B;  5DNM D;  2FFF B;  1P3P C;  3VH6 A;  5KDM B;  1P3K B;  1P3M A;  3LJA A;  1KX3 C;  5B0Z C;  3AZL B;  1BH8 A;  1KX4 C;  3MVD D;  1JFI A;  4KGC A;  3F6T A;  3TU4 C;  3X1U C;  2FJ7 A;  1ULY A;  3LZ0 B;  4R8P C;  1EQZ D;  4WJ3 C;  3UTB D;  3REI B;  4LD9 A;  5B40 A;  3C1C B;  3W96 C;  3MNN B;  2XD5 A;  5CPK D;  2HIO B;  3W99 A;  5AV6 D;  1P3G C;  3AZN B;  5AV5 B;  4XUJ D;  3AZJ B;  4WU8 B;  3LZ1 B;  2Y2I A;  3AFA D;  1KX5 D;  4J8V C;  3V9R A;  4WU9 D;  4H9P B;  5CPK A;  3WA9 C;  3WTP B;  3UT9 D;  5AVC C;  3REL C;  1P3A B;  2PYO D;  1B6W A;  2NZD C;  3AZF C;  4J8U D;  3WAA A;  2XD1 A;  4YM6 B;  1TAF A;  3NQJ B;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...