5B0ZA

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zA00
1BH9A 5GT0A 5AV5B 3VH6W 4R8PB 2F8ND 4JJNA 5B31G 4X23A 4XUJC 2PYOB 3WTPA 1AOIC 3O62A 3LELD 3AFAD 5CPIA 1KX3D 1ZLAD 3W96B 5JRGA 5GT3C 4KUDD 3UTBD 4CAYB 3NQUB 4KHAB 1P3FC 4YM6B 5B40C 3AZHC 2CV5C 2BYMA 1M1AD 5B33D 1KX5C 3X1UD 4DRBA 3WTPD 3O62D 5CPJC 3REKC 4ZUXA 3AZGA 5JRGD 1TZYB 3TU4C 5DNNA 4UUZB 4KGCC 3REIC 4Z5TA 1P3LC 3KXBD 5BNVA 5AV8A 3A6NA 4WU8C 3W99A 1HQ3A 3VH6A 5GT3B 3LZ0C 3W98D 1BFMA 5B32A 2NQBB 1P3FB 5GXQA 4ZUXD 3X1SA 5AVBB 1P3BD 5CPKA 3AV2C 3AZIB 1P3IB 4Z5TD 5B1LA 3C1CA 5CP6B 3MGRB 3A6ND 3W99D 1HQ3D 4HGAC 5BT1C 5B1MD 3TU4B 3REJA 1P3MC 1TAFA 4NE6A 1P3GA 3AZLB 3REIB 5GXQD 3AZMA 3REHC 3X1SD 1BH9B 4CSRA 5GT0B 5B0ZC 2AROA 1KU5A 1BH8A 3X1VA 5B31B 5CPKD 3AZNA 5B2JD 4JJNB 1ULYA 3KWQA 1U35C 3MNNA 4X23B 5B1LD 5GSUA 3VH5T 3RELA 4Z66B 1P3OC 3AV1A 3AV2B 3LZ1D 3B6GC 2AROD 3AYWD 4WU9C 5B2IC 5AV9B 4R8PA 3MVDC 5BS7A 4ZBJC 2BYMB 5KDMA 3KWQD 3MNND 1A7WA 3B6FC 3LJAC 3REHB 3UTAB 4M6BA 3W96A 5JA4A 3AZGB 1B6WA 3AV1D 4KHAA 1N1JB 5AV5D 2F8NK 4R8PD 5AV8B 1H3OB 3C1BC 2PYOD 3B6GB 1P3AC 3AZKC 5B32B 4WU9B 5B0YC 3W96D 3AZFC 3MVDB 1TZYA 2FJ7C 4G91C 5DNMB 4XUJA 4J8XC 3AN2C 1B67A 4YM6D 4LD9B 3B0DC 3C1CB 5GT3A 3UT9C 3REJB 3R45B 2NQBA 1P3FA 1P3GB 3B0CW 3AZMB 1TZYD 4H9PA 4CSRB 5B40A 3AZHA 2CV5A 5C3IC 3X1VB 1BH8B 1M18C 1M19C 3AZEC 1KX5A 4G92C 1P3AB 1P3IA 3AZKB 5F99C 5CPJA 2RVQC 1KX4D 5B0YB 3V9RA 3REKA 3AZFB 1P34B 5GT3D 3TU4A 3RELB 4QLCB 4KGCA 2NQBD 3REIA 1P3FD 1P3LA 1EQZB 5AVBD 3KUYC 5B31A 1F66B 3AZID 1P3ID 4E45A 4NFTA 5KDMB 5CP6D 3MGRD 4J8UC 4H9NA 3TU4D 5JA4B 4Z66A 3AV2A 4DRAA 3MGPC 3X1TC 3AZLD 4H9QA 5GT0D 3AZJC 5B24C 3WKJC 5AV9A 5B31D 4AWLB 1P3MA 4JJND 4X23D 4XZQB 3REHA 3UTAA 3VH6T 5CPID 4J8VC 4Z66D 3AV2D 4WZSB 1P3PC 1N1JA 3WAAC 1S32C 3WA9C 4XUJB 1AOIB 5BT1D 5AV9D 4EO5C 1P3OA 1H3OA 1JFIA 3B6GA 3MGPB 3REHD 3UTAD 4WU9A 3WKJB 3MVDA 3AZGD 4H9PB 5B40B 3AZHB 5DNND 2CV5B 5DNMA 1KX5B 3B6FA 4LD9A 3LJAA 5CPJB 4WV4B 5AV8D 1KX3C 3AFAC 2BYKB 3V9RB 4J8VB 3REKB 1ZLAC 2NZDC 4KUDC 3R45A 3UTBC 3B6GD 4KGCB 5B32D 1P3LB 3MVDD 4WU8B 3C1BA 5DNMD 1M1AC 4J8WC 1P3AA 3LZ0B 5B33C 3AZKA 3X1UC 4LD9D 3O62C 3C1CD 5B0YA 3AZFA 2FJ7A 1P34A 4H9NB 5JRGC 4Z2MG 3REJD 4QLCA 3AN2A 1P3GD 4H9QB 3AZMD 3KXBC 1EQZA 3X1VD 2NZDB 4HGAB 3UT9A 1F66A 4KUDB 3AZND 3MGQC 1P3AD 4NE3A 1P3MB 3AZKD 3W98C 5AV6C 5GSUD 5B0YD 3AZFD 1P34D 5B0ZB 2IO5C 3RELD 1M18A 4QLCD 1P3BC 3NQJB 1M19A 4J8WB 2LY8A 5F99A 1U35B 1EQZD 3A6NC 1R4VA 1HQ3C 3W99C 1F66D 5B1MC 1P3OB 1JFIB 4XZQA 5GXQC 4Z2MH 3X1SC 3KUYA 5B2IB 5AY8C 3MGQB 4ZBJB 5B2JC 5AV6B 5BO0B 1AOIA 3B6FB 3LJAB 2IO5B 1WWIA 3MGPA 3X1TA 3LZ1C 4XZQD 3AZJA 3WKJA 2AROC 3AYWC 1P3KC 3W97C 5B1MB 1HTAA 3C1BB 2YFVB 2YFWA 3B0BA 4XUJD 3KWQC 1AOID 3MGSC 4J8VA 2BYKA 2FJ7B 5AY8B 1ID3C 3AV1C 1P3PA 4G91B 3WAAA 1S32A 3WA9A 4J8XB 3AN2B 3WKJD 3B0DB 5AV5C 4WU8A 2HIOC 5B40D 3AZHD 2CV5D 5BS7C 3UT9B 3LZ0A 3LZ1B 1KX5D 2PYOC 3B0CT 5G49A 5CPJD 5AVCC 4J8VD 2HUEC 3REKD 3AYWB 1P3KB 3W97B 2F8NA 5C3IB 1M18B 2F8NG 1M19B 3AZEB 4G92B 4KGCD 3MGSB 3REID 5F99B 4YM6C 1P3LD 4WU8D 3AFAA 2NZDA 4KUDA 3UTBA 1ID3B 3LZ0D 5B0ZA 2HIOB 1TZYC 3KUYB 3NQJA 1M1AA 4J8WA 5B33A 3X1UA 1U35A 4WNNB 5AVCB 5E5AC 4YS3C 2HUEB 1KX4C 4J8UB 2NZDD 1P3MD 3X1TB 2NQBC 5B0ZD 3KXBA 3AZJB 5BNXA 2F8NH 5AVBC 5B2IA 5B24B 4J8WD 3MGQA 3AZIC 1WWSA 3W98A 5AV6A 1P3IC 1U35D 2YFWB 5BO0A 5CP6C 3MGRC 4H9SC 3LELC 1P3BA 1P3OD 1P3PB 3AZLC 3WAAB 1S32B 3WA9B 5E5AB 4YS3B 5GT0C 4E44A 4WU9D 1KX4B 5B2ID 5B1MA 5B31C 3MGQD 4EO5B 4JJNC 5AV6D 2YFVA 4X23C 3B6FD 3WTPC 3LJAD 5B32G 5G49B 5CPIC 3VH5W 4Z66C 5AY8A 2F8NB 5B2JA 4J8XA 4H9OA 5AV9C 1Q9CA 3LELB 3AFAB 4H9RB 1KX3B 1ZLAB 3C1BD 3KSYA 3LZ1A 3UTBB 5FUGA 5CHLB 3UTAC 3AYWA 1P3KA 3W97A 2FJ7D 4ZUXC 5AY8D 3AZGC 5DNNC 1M1AB 3AZEA 4J8XD 3AN2D 5B33B 3MGSA 3X1UB 3WTPB 4NE5A 4Z5TC 3O62B 5AV8C 5CPIB 5JRGB 1ID3A 3UT9D 2L5AA 5B32C 1P3KD 5AV5A 3W97D 2HIOA 3KXBB 5BNXB 3VH5A 1M18D 5DNMC 3AZED 5CPKC 1M19D 2PYOA 3MGSD 3W98B 5F99D 4WNNA 2RVQD 5AVCA 4LD9C 5B1LC 3C1CC 4J8UA 4ZUXB 1ID3D 4CAYA 3NQUA 5DNNB 3REJC 1P3BB 4YM6A 1P3GC 4Z5TB 2HIOD 3AZMC 5BNVB 3A6NB 5B24A 3KUYD 3X1VC 1HQ3B 3W99B 3AZNC 5AVCD 3MNNC 5GSUC 4J8UD 5GXQB 1P34C 3X1SB 3RELC 4UUZA 4QLCC 5CPKB 3X1TD 3MGPD 5B2JB 5E5AA 5B1LB 3AZJD 4YS3A 1KX4A 1EQZC 5B24D 3WTPE 4H9OB 4R8PC 1F66C 1TAFB 5FUGB 1F1EA 2CWEA 5AVBA 2AROB 3W96C 3AZNB 3AZIA 1P3PD 2JSSA 3WAAD 1S32D 3WA9D 3KWQB 5CP6A 5E5AD 5GSUB 4YS3D 3MNNB 3MGRA 4H9SA 3LELA 4AWLC 4H9RA 1KX3A 1ZLAA 3AV1B 3AZLA 4XZQC
chains in the Genus database with same CATH superfamily
1BH9A 5GT0A 4WJ3C 5AV5B 3VH6W 4R8PB 2F8ND 4JJNA 5B31G 4X23A 2XD5A 4XUJC 2PYOB 3WTPA 1AOIC 3AL0C 3O62A 2ZY2A 3LELD 3AFAD 5CPIA 1KX3D 1ZLAD 3W96B 5JRGA 5GT3C 4KUDD 3UTBD 4CAYB 3NQUB 4KHAB 2FFFB 1P3FC 4YM6B 5B40C 3AZHC 2CV5C 2BYMA 1M1AD 5B33D 1KX5C 3X1UD 4DRBA 3WTPD 3O62D 5CPJC 3REKC 2Y2JA 4ZUXA 3AZGA 5JRGD 1TZYB 3TU4C 5DNNA 4UUZB 4KGCC 3REIC 3H0LC 4Z5TA 1P3LC 3KXBD 5BNVA 5AV8A 3A6NA 4WU8C 3W99A 1HQ3A 3VH6A 5GT3B 3LZ0C 3W98D 1BFMA 5B32A 2NQBB 1P3FB 5GXQA 4ZUXD 3X1SA 5AVBB 1P3BD 5CPKA 3AV2C 3AZIB 1P3IB 4Z5TD 5B1LA 3C1CA 5CP6B 3MGRB 3A6ND 3W99D 1HQ3D 4HGAC 5BT1C 5B1MD 3TU4B 3REJA 1P3MC 1TAFA 4NE6A 2F2AC 1P3GA 3AZLB 3REIB 5GXQD 3AZMA 3REHC 1BH9B 4CSRA 5GT0B 5B0ZC 3X1SD 2AROA 1KU5A 1BH8A 3X1VA 5B31B 5CPKD 3AZNA 5B2JD 4JJNB 1ULYA 3KWQA 2G5IC 3MNNA 4X23B 5B1LD 5GSUA 1U35C 3VH5T 3RELA 2DQNC 4Z66B 1P3OC 2ZM5A 3AV1A 3AV2B 3LZ1D 3B6GC 4UPKA 2AROD 3AYWD 4WU9C 5B2IC 1PZRA 5AV9B 4R8PA 3MVDC 3IP4C 5BS7A 4ZBJC 2BYMB 5KDMA 3KWQD 3MNND 1A7WA 3B6FC 3LJAC 3REHB 3UTAB 4M6BA 3W96A 5JA4A 2Y2NA 1B6WA 3AZGB 3AV1D 4KHAA 1N1JB 5AV5D 2F8NK 4R8PD 5AV8B 1H3OB 3C1BC 2PYOD 3B6GB 2DF4C 1P3AC 3AZKC 5B32B 4WU9B 5B0YC 3W96D 3AZFC 3MVDB 1TZYA 2FJ7C 4G91C 5DNMB 4XUJA 4J8XC 3AN2C 1B67A 4YM6D 4LD9B 3B0DC 3C1CB 2Y2KA 5GT3A 3UT9C 3REJB 3R45B 2Y2PA 2NQBA 1P3FA 1P3GB 3B0CW 3AZMB 1TZYD 4H9PA 4CSRB 5B40A 3AZHA 2CV5A 5C3IC 3X1VB 1BH8B 2Y2MA 1M18C 1M19C 3AZEC 1KX5A 4G92C 1P3AB 1P3IA 3AZKB 5F99C 5CPJA 2ZY4A 2RVQC 1KX4D 5B0YB 3V9RA 3REKA 2J8PA 3AZFB 1P34B 5GT3D 3TU4A 3RELB 4QLCB 4KGCA 3EG5B 2NQBD 3REIA 1P3FD 1P3LA 1EQZB 5AVBD 3KUYC 5B31A 1F66B 3AZID 1P3ID 4E45A 4NFTA 5KDMB 5CP6D 3MGRD 2JE5A 4H9NA 4J8UC 3TU4D 5JA4B 4Z66A 3AV2A 4DRAA 3MGPC 3X1TC 3AZLD 4H9QA 5GT0D 3AZJC 5B24C 3WKJC 5AV9A 5B31D 4AWLB 1P3MA 4JJND 4X23D 4XZQB 3A1KA 3REHA 3UTAA 3VH6T 5CPID 4J8VC 4Z66D 3AV2D 4WZSB 1P3PC 1N1JA 3WAAC 1S32C 3WA9C 4XUJB 1AOIB 5BT1D 5AV9D 4EO5C 1P3OA 1H3OA 1JFIA 3B6GA 3MGPB 3REHD 3F6TA 3UTAD 4WU9A 2Y2HA 3WKJB 3A1IA 3MVDA 3AZGD 4H9PB 5B40B 3AZHB 5DNND 2CV5B 5DNMA 1KX5B 3B6FA 4LD9A 3LJAA 5CPJB 4WV4B 5AV8D 1KX3C 3AFAC 2BYKB 3V9RB 4J8VB 3REKB 1ZLAC 2NZDC 4KUDC 2BG1A 3R45A 1W2EA 3UTBC 3B6GD 4KGCB 5B32D 1P3LB 3MVDD 4WU8B 3EPKA 3C1BA 5DNMD 1M1AC 4J8WC 1P3AA 3LZ0B 5B33C 3AZKA 3X1UC 4LD9D 3O62C 3C1CD 5B0YA 3AZFA 2FJ7A 1P34A 4H9NB 2G5HC 5JRGC 4Z2MG 3REJD 4QLCA 3AN2A 1P3GD 4H9QB 3AZMD 3KXBC 1EQZA 3X1VD 2NZDB 4HGAB 3UT9A 1F66A 4KUDB 3AZND 3MGQC 1P3AD 4NE3A 1P3MB 3FDDA 3AZKD 3W98C 5AV6C 5GSUD 5B0YD 3AZFD 1P34D 5B0ZB 2IO5C 3RELD 1M18A 4QLCD 1P3BC 3NQJB 1M19A 4J8WB 2LY8A 5F99A 1U35B 3EPJA 1EQZD 3A6NC 1R4VA 1HQ3C 3W99C 1F66D 5B1MC 1P3OB 1JFIB 4XZQA 5GXQC 4Z2MH 3X1SC 3KUYA 5B2IB 5AY8C 3MGQB 4ZBJB 5B2JC 5AV6B 5BO0B 1AOIA 3B6FB 3LJAB 2IO5B 1WWIA 3MGPA 3X1TA 3LZ1C 4XZQD 3AZJA 3WKJA 2AROC 3AYWC 1P3KC 3W97C 5B1MB 1HTAA 3C1BB 2YFVB 2YFWA 3B0BA 4XUJD 3KWQC 1AOID 3MGSC 4J8VA 2BYKA 2FJ7B 1Z2CB 5AY8B 1ID3C 3AV1C 1P3PA 4G91B 3WAAA 1S32A 3WA9A 4J8XB 3AN2B 3WKJD 3B0DB 2Y2GA 5AV5C 4WU8A 2HIOC 5B40D 3AZHD 2CV5D 5BS7C 3UT9B 3LZ0A 3LZ1B 1KX5D 2PYOC 3B0CT 5G49A 5CPJD 5AVCC 4J8VD 2HUEC 3REKD 3AYWB 1P3KB 3W97B 2F8NA 5C3IB 1M18B 2F8NG 3H0MC 1M19B 3AZEB 4G92B 4KGCD 2Y2OA 3MGSB 3REID 5F99B 4YM6C 1P3LD 4WU8D 3AFAA 2NZDA 4KUDA 3UTBA 1ID3B 3LZ0D 2W8SA 4DQYB 5B0ZA 2HIOB 1TZYC 3KUYB 3NQJA 1M1AA 4J8WA 5B33A 3X1UA 1U35A 4WNNB 5AVCB 5E5AC 4YS3C 2HUEB 1KX4C 4J8UB 2NZDD 1P3MD 2XD1A 3X1TB 2NQBC 1T3UA 5B0ZD 3KXBA 3AZJB 5BNXA 2F8NH 5AVBC 5B2IA 5B24B 4J8WD 3MGQA 2Y2LA 3AZIC 1WWSA 3W98A 5AV6A 1P3IC 1U35D 2YFWB 5BO0A 5CP6C 3MGRC 4H9SC 3LELC 1P3BA 1P3OD 1P3PB 3AZLC 2RIQA 1S32B 3WA9B 3WAAB 5E5AB 4YS3B 2Y2QA 4E44A 5GT0C 4WU9D 1KX4B 5B2ID 2ZY3A 5B1MA 5B31C 3MGQD 4EO5B 4JJNC 5AV6D 2YFVA 4X23C 3B6FD 3WTPC 3LJAD 5B32G 5G49B 5CPIC 3VH5W 3EPHA 4Z66C 5AY8A 2F8NB 5B2JA 4J8XA 2ZY5A 4H9OA 5AV9C 1Q9CA 3LELB 3AFAB 4H9RB 1KX3B 1ZLAB 3EPLA 3C1BD 3KSYA 3LZ1A 3UTBB 5FUGA 5CHLB 3UTAC 3AYWA 1P3KA 3W97A 2FJ7D 4ZUXC 5AY8D 3AZGC 3P5JB 3H0RC 5DNNC 1M1AB 3AZEA 4J8XD 3AN2D 5B33B 3MGSA 3X1UB 3WTPB 4NE5A 4Z5TC 3O62B 5AV8C 5CPIB 5JRGB 1ID3A 3UT9D 2L5AA 5B32C 1P3KD 5AV5A 3W97D 2HIOA 3KXBB 5BNXB 3VH5A 1M18D 5DNMC 3AZED 5CPKC 1M19D 2PYOA 3MGSD 3W98B 5F99D 4WNNA 2RVQD 5AVCA 4LD9C 5B1LC 3C1CC 4J8UA 4ZUXB 1ID3D 4CAYA 3NQUA 5DNNB 3REJC 1P3BB 4YM6A 1P3GC 4Z5TB 2HIOD 3AZMC 5BNVB 3A6NB 5B24A 3KUYD 3X1VC 1HQ3B 3W99B 3AZNC 5AVCD 3MNNC 5GSUC 2Y2IA 2VQRA 5GXQB 4J8UD 1P34C 3X1SB 3RELC 4UUZA 2UWXA 4QLCC 5CPKB 3X1TD 3MGPD 5B2JB 5E5AA 5B1LB 3AZJD 4YS3A 1KX4A 3KFUG 1EQZC 5B24D 3WTPE 4H9OB 4R8PC 1F66C 1TAFB 5FUGB 1F1EA 2CWEA 5AVBA 2AROB 3W96C 2JCHA 3AZNB 3AZIA 1P3PD 2JSSA 3WAAD 1S32D 3WA9D 3KWQB 5CP6A 5E5AD 5GSUB 4YS3D 3MNNB 3MGRA 4H9SA 3LELA 4AWLC 4H9RA 1KX3A 1ZLAA 3AV1B 3AZLA 4XZQC
chains in the Genus database with same CATH topology
1BH9A 5GT0A 4WJ3C 5AV5B 3VH6W 4R8PB 2F8ND 4JJNA 5B31G 4X23A 2XD5A 4XUJC 2PYOB 3WTPA 1AOIC 3AL0C 3O62A 2ZY2A 3LELD 3AFAD 5CPIA 1KX3D 1ZLAD 3W96B 5JRGA 5GT3C 4KUDD 3UTBD 4CAYB 3NQUB 4KHAB 2FFFB 1P3FC 4YM6B 5B40C 3AZHC 2CV5C 2BYMA 1M1AD 5B33D 1KX5C 3X1UD 4DRBA 3WTPD 3O62D 5CPJC 3REKC 2Y2JA 4ZUXA 3AZGA 5JRGD 1TZYB 3TU4C 5DNNA 4UUZB 4KGCC 3REIC 3H0LC 4Z5TA 1P3LC 3KXBD 5BNVA 5AV8A 3A6NA 4WU8C 3W99A 1HQ3A 3VH6A 5GT3B 3LZ0C 3W98D 1BFMA 5B32A 2NQBB 1P3FB 5GXQA 4ZUXD 3X1SA 5AVBB 1P3BD 5CPKA 3AV2C 3AZIB 1P3IB 4Z5TD 5B1LA 3C1CA 5CP6B 3MGRB 3A6ND 3W99D 1HQ3D 4HGAC 5BT1C 5B1MD 3TU4B 3REJA 1P3MC 1TAFA 4NE6A 2F2AC 1P3GA 3AZLB 3REIB 5GXQD 3AZMA 3REHC 1BH9B 4CSRA 5GT0B 5B0ZC 3X1SD 2AROA 1KU5A 1BH8A 3X1VA 5B31B 5CPKD 3AZNA 5B2JD 4JJNB 1ULYA 3KWQA 2G5IC 3MNNA 4X23B 5B1LD 5GSUA 1U35C 3VH5T 3RELA 2DQNC 4Z66B 1P3OC 2ZM5A 3AV1A 3AV2B 3LZ1D 3B6GC 4UPKA 2AROD 3AYWD 4WU9C 5B2IC 1PZRA 5AV9B 4R8PA 3MVDC 3IP4C 5BS7A 4ZBJC 2BYMB 5KDMA 3KWQD 3MNND 1A7WA 3B6FC 3LJAC 3REHB 3UTAB 4M6BA 3W96A 5JA4A 2Y2NA 1B6WA 3AZGB 3AV1D 4KHAA 1N1JB 5AV5D 2F8NK 4R8PD 5AV8B 1H3OB 3C1BC 2PYOD 3B6GB 2DF4C 1P3AC 3AZKC 5B32B 4WU9B 5B0YC 3W96D 3AZFC 3MVDB 1TZYA 2FJ7C 4G91C 5DNMB 4XUJA 4J8XC 3AN2C 1B67A 4YM6D 4LD9B 3B0DC 3C1CB 2Y2KA 5GT3A 3UT9C 3REJB 3R45B 2Y2PA 2NQBA 1P3FA 1P3GB 3B0CW 3AZMB 1TZYD 4H9PA 4CSRB 5B40A 3AZHA 2CV5A 5C3IC 3X1VB 1BH8B 2Y2MA 1M18C 1M19C 3AZEC 1KX5A 4G92C 1P3AB 1P3IA 3AZKB 5F99C 5CPJA 2ZY4A 2RVQC 1KX4D 5B0YB 3V9RA 3REKA 2J8PA 3AZFB 1P34B 5GT3D 3TU4A 3RELB 4QLCB 4KGCA 3EG5B 2NQBD 3REIA 1P3FD 1P3LA 1EQZB 5AVBD 3KUYC 5B31A 1F66B 3AZID 1P3ID 4E45A 4NFTA 5KDMB 5CP6D 3MGRD 2JE5A 4H9NA 4J8UC 3TU4D 5JA4B 4Z66A 3AV2A 4DRAA 3MGPC 3X1TC 3AZLD 4H9QA 5GT0D 3AZJC 5B24C 3WKJC 5AV9A 5B31D 4AWLB 1P3MA 4JJND 4X23D 4XZQB 3A1KA 3REHA 3UTAA 3VH6T 5CPID 4J8VC 4Z66D 3AV2D 4WZSB 1P3PC 1N1JA 3WAAC 1S32C 3WA9C 4XUJB 1AOIB 5BT1D 5AV9D 4EO5C 1P3OA 1H3OA 1JFIA 3B6GA 3MGPB 3REHD 3F6TA 3UTAD 4WU9A 2Y2HA 3WKJB 3A1IA 3MVDA 3AZGD 4H9PB 5B40B 3AZHB 5DNND 2CV5B 5DNMA 1KX5B 3B6FA 4LD9A 3LJAA 5CPJB 4WV4B 5AV8D 1KX3C 3AFAC 2BYKB 3V9RB 4J8VB 3REKB 1ZLAC 2NZDC 4KUDC 2BG1A 3R45A 1W2EA 3UTBC 3B6GD 4KGCB 5B32D 1P3LB 3MVDD 4WU8B 3EPKA 3C1BA 5DNMD 1M1AC 4J8WC 1P3AA 3LZ0B 5B33C 3AZKA 3X1UC 4LD9D 3O62C 3C1CD 5B0YA 3AZFA 2FJ7A 1P34A 4H9NB 2G5HC 5JRGC 4Z2MG 3REJD 4QLCA 3AN2A 1P3GD 4H9QB 3AZMD 3KXBC 1EQZA 3X1VD 2NZDB 4HGAB 3UT9A 1F66A 4KUDB 3AZND 3MGQC 1P3AD 4NE3A 1P3MB 3FDDA 3AZKD 3W98C 5AV6C 5GSUD 5B0YD 3AZFD 1P34D 5B0ZB 2IO5C 3RELD 1M18A 4QLCD 1P3BC 3NQJB 1M19A 4J8WB 2LY8A 5F99A 1U35B 3EPJA 1EQZD 3A6NC 1R4VA 1HQ3C 3W99C 1F66D 5B1MC 1P3OB 1JFIB 4XZQA 5GXQC 4Z2MH 3X1SC 3KUYA 5B2IB 5AY8C 3MGQB 4ZBJB 5B2JC 5AV6B 5BO0B 1AOIA 3B6FB 3LJAB 2IO5B 1WWIA 3MGPA 3X1TA 3LZ1C 4XZQD 3AZJA 3WKJA 2AROC 3AYWC 1P3KC 3W97C 5B1MB 1HTAA 3C1BB 2YFVB 2YFWA 3B0BA 4XUJD 3KWQC 1AOID 3MGSC 4J8VA 2BYKA 2FJ7B 1Z2CB 5AY8B 1ID3C 3AV1C 1P3PA 4G91B 3WAAA 1S32A 3WA9A 4J8XB 3AN2B 3WKJD 3B0DB 2Y2GA 5AV5C 4WU8A 2HIOC 5B40D 3AZHD 2CV5D 5BS7C 3UT9B 3LZ0A 3LZ1B 1KX5D 2PYOC 3B0CT 5G49A 5CPJD 5AVCC 4J8VD 2HUEC 3REKD 3AYWB 1P3KB 3W97B 2F8NA 5C3IB 1M18B 2F8NG 3H0MC 1M19B 3AZEB 4G92B 4KGCD 2Y2OA 3MGSB 3REID 5F99B 4YM6C 1P3LD 4WU8D 3AFAA 2NZDA 4KUDA 3UTBA 1ID3B 3LZ0D 2W8SA 4DQYB 5B0ZA 2HIOB 1TZYC 3KUYB 3NQJA 1M1AA 4J8WA 5B33A 3X1UA 1U35A 4WNNB 5AVCB 5E5AC 4YS3C 2HUEB 1KX4C 4J8UB 2NZDD 1P3MD 2XD1A 3X1TB 2NQBC 1T3UA 5B0ZD 3KXBA 3AZJB 5BNXA 2F8NH 5AVBC 5B2IA 5B24B 4J8WD 3MGQA 2Y2LA 3AZIC 1WWSA 3W98A 5AV6A 1P3IC 1U35D 2YFWB 5BO0A 5CP6C 3MGRC 4H9SC 3LELC 1P3BA 1P3OD 1P3PB 3AZLC 2RIQA 1S32B 3WA9B 3WAAB 5E5AB 4YS3B 2Y2QA 4E44A 5GT0C 4WU9D 1KX4B 5B2ID 2ZY3A 5B1MA 5B31C 3MGQD 4EO5B 4JJNC 5AV6D 2YFVA 4X23C 3B6FD 3WTPC 3LJAD 5B32G 5G49B 5CPIC 3VH5W 3EPHA 4Z66C 5AY8A 2F8NB 5B2JA 4J8XA 2ZY5A 4H9OA 5AV9C 1Q9CA 3LELB 3AFAB 4H9RB 1KX3B 1ZLAB 3EPLA 3C1BD 3KSYA 3LZ1A 3UTBB 5FUGA 5CHLB 3UTAC 3AYWA 1P3KA 3W97A 2FJ7D 4ZUXC 5AY8D 3AZGC 3P5JB 3H0RC 5DNNC 1M1AB 3AZEA 4J8XD 3AN2D 5B33B 3MGSA 3X1UB 3WTPB 4NE5A 4Z5TC 3O62B 5AV8C 5CPIB 5JRGB 1ID3A 3UT9D 2L5AA 5B32C 1P3KD 5AV5A 3W97D 2HIOA 3KXBB 5BNXB 3VH5A 1M18D 5DNMC 3AZED 5CPKC 1M19D 2PYOA 3MGSD 3W98B 5F99D 4WNNA 2RVQD 5AVCA 4LD9C 5B1LC 3C1CC 4J8UA 4ZUXB 1ID3D 4CAYA 3NQUA 5DNNB 3REJC 1P3BB 4YM6A 1P3GC 4Z5TB 2HIOD 3AZMC 5BNVB 3A6NB 5B24A 3KUYD 3X1VC 1HQ3B 3W99B 3AZNC 5AVCD 3MNNC 5GSUC 2Y2IA 2VQRA 5GXQB 4J8UD 1P34C 3X1SB 3RELC 4UUZA 2UWXA 4QLCC 5CPKB 3X1TD 3MGPD 5B2JB 5E5AA 5B1LB 3AZJD 4YS3A 1KX4A 3KFUG 1EQZC 5B24D 3WTPE 4H9OB 4R8PC 1F66C 1TAFB 5FUGB 1F1EA 2CWEA 5AVBA 2AROB 3W96C 2JCHA 3AZNB 3AZIA 1P3PD 2JSSA 3WAAD 1S32D 3WA9D 3KWQB 5CP6A 5E5AD 5GSUB 4YS3D 3MNNB 3MGRA 4H9SA 3LELA 4AWLC 4H9RA 1KX3A 1ZLAA 3AV1B 3AZLA 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH9 A;  5GT0 A;  5AV5 B;  3VH6 W;  4R8P B;  2F8N D;  4JJN A;  5B31 G;  4X23 A;  4XUJ C;  2PYO B;  3WTP A;  1AOI C;  3O62 A;  3LEL D;  3AFA D;  5CPI A;  1KX3 D;  1ZLA D;  3W96 B;  5JRG A;  5GT3 C;  4KUD D;  3UTB D;  4CAY B;  3NQU B;  4KHA B;  1P3F C;  4YM6 B;  5B40 C;  3AZH C;  2CV5 C;  2BYM A;  1M1A D;  5B33 D;  1KX5 C;  3X1U D;  4DRB A;  3WTP D;  3O62 D;  5CPJ C;  3REK C;  4ZUX A;  3AZG A;  5JRG D;  1TZY B;  3TU4 C;  5DNN A;  4UUZ B;  4KGC C;  3REI C;  4Z5T A;  1P3L C;  3KXB D;  5BNV A;  5AV8 A;  3A6N A;  4WU8 C;  3W99 A;  1HQ3 A;  3VH6 A;  5GT3 B;  3LZ0 C;  3W98 D;  1BFM A;  5B32 A;  2NQB B;  1P3F B;  5GXQ A;  4ZUX D;  3X1S A;  5AVB B;  1P3B D;  5CPK A;  3AV2 C;  3AZI B;  1P3I B;  4Z5T D;  5B1L A;  3C1C A;  5CP6 B;  3MGR B;  3A6N D;  3W99 D;  1HQ3 D;  4HGA C;  5BT1 C;  5B1M D;  3TU4 B;  3REJ A;  1P3M C;  1TAF A;  4NE6 A;  1P3G A;  3AZL B;  3REI B;  5GXQ D;  3AZM A;  3REH C;  3X1S D;  1BH9 B;  4CSR A;  5GT0 B;  5B0Z C;  2ARO A;  1KU5 A;  1BH8 A;  3X1V A;  5B31 B;  5CPK D;  3AZN A;  5B2J D;  4JJN B;  1ULY A;  3KWQ A;  1U35 C;  3MNN A;  4X23 B;  5B1L D;  5GSU A;  3VH5 T;  3REL A;  4Z66 B;  1P3O C;  3AV1 A;  3AV2 B;  3LZ1 D;  3B6G C;  2ARO D;  3AYW D;  4WU9 C;  5B2I C;  5AV9 B;  4R8P A;  3MVD C;  5BS7 A;  4ZBJ C;  2BYM B;  5KDM A;  3KWQ D;  3MNN D;  1A7W A;  3B6F C;  3LJA C;  3REH B;  3UTA B;  4M6B A;  3W96 A;  5JA4 A;  3AZG B;  1B6W A;  3AV1 D;  4KHA A;  1N1J B;  5AV5 D;  2F8N K;  4R8P D;  5AV8 B;  1H3O B;  3C1B C;  2PYO D;  3B6G B;  1P3A C;  3AZK C;  5B32 B;  4WU9 B;  5B0Y C;  3W96 D;  3AZF C;  3MVD B;  1TZY A;  2FJ7 C;  4G91 C;  5DNM B;  4XUJ A;  4J8X C;  3AN2 C;  1B67 A;  4YM6 D;  4LD9 B;  3B0D C;  3C1C B;  5GT3 A;  3UT9 C;  3REJ B;  3R45 B;  2NQB A;  1P3F A;  1P3G B;  3B0C W;  3AZM B;  1TZY D;  4H9P A;  4CSR B;  5B40 A;  3AZH A;  2CV5 A;  5C3I C;  3X1V B;  1BH8 B;  1M18 C;  1M19 C;  3AZE C;  1KX5 A;  4G92 C;  1P3A B;  1P3I A;  3AZK B;  5F99 C;  5CPJ A;  2RVQ C;  1KX4 D;  5B0Y B;  3V9R A;  3REK A;  3AZF B;  1P34 B;  5GT3 D;  3TU4 A;  3REL B;  4QLC B;  4KGC A;  2NQB D;  3REI A;  1P3F D;  1P3L A;  1EQZ B;  5AVB D;  3KUY C;  5B31 A;  1F66 B;  3AZI D;  1P3I D;  4E45 A;  4NFT A;  5KDM B;  5CP6 D;  3MGR D;  4J8U C;  4H9N A;  3TU4 D;  5JA4 B;  4Z66 A;  3AV2 A;  4DRA A;  3MGP C;  3X1T C;  3AZL D;  4H9Q A;  5GT0 D;  3AZJ C;  5B24 C;  3WKJ C;  5AV9 A;  5B31 D;  4AWL B;  1P3M A;  4JJN D;  4X23 D;  4XZQ B;  3REH A;  3UTA A;  3VH6 T;  5CPI D;  4J8V C;  4Z66 D;  3AV2 D;  4WZS B;  1P3P C;  1N1J A;  3WAA C;  1S32 C;  3WA9 C;  4XUJ B;  1AOI B;  5BT1 D;  5AV9 D;  4EO5 C;  1P3O A;  1H3O A;  1JFI A;  3B6G A;  3MGP B;  3REH D;  3UTA D;  4WU9 A;  3WKJ B;  3MVD A;  3AZG D;  4H9P B;  5B40 B;  3AZH B;  5DNN D;  2CV5 B;  5DNM A;  1KX5 B;  3B6F A;  4LD9 A;  3LJA A;  5CPJ B;  4WV4 B;  5AV8 D;  1KX3 C;  3AFA C;  2BYK B;  3V9R B;  4J8V B;  3REK B;  1ZLA C;  2NZD C;  4KUD C;  3R45 A;  3UTB C;  3B6G D;  4KGC B;  5B32 D;  1P3L B;  3MVD D;  4WU8 B;  3C1B A;  5DNM D;  1M1A C;  4J8W C;  1P3A A;  3LZ0 B;  5B33 C;  3AZK A;  3X1U C;  4LD9 D;  3O62 C;  3C1C D;  5B0Y A;  3AZF A;  2FJ7 A;  1P34 A;  4H9N B;  5JRG C;  4Z2M G;  3REJ D;  4QLC A;  3AN2 A;  1P3G D;  4H9Q B;  3AZM D;  3KXB C;  1EQZ A;  3X1V D;  2NZD B;  4HGA B;  3UT9 A;  1F66 A;  4KUD B;  3AZN D;  3MGQ C;  1P3A D;  4NE3 A;  1P3M B;  3AZK D;  3W98 C;  5AV6 C;  5GSU D;  5B0Y D;  3AZF D;  1P34 D;  5B0Z B;  2IO5 C;  3REL D;  1M18 A;  4QLC D;  1P3B C;  3NQJ B;  1M19 A;  4J8W B;  2LY8 A;  5F99 A;  1U35 B;  1EQZ D;  3A6N C;  1R4V A;  1HQ3 C;  3W99 C;  1F66 D;  5B1M C;  1P3O B;  1JFI B;  4XZQ A;  5GXQ C;  4Z2M H;  3X1S C;  3KUY A;  5B2I B;  5AY8 C;  3MGQ B;  4ZBJ B;  5B2J C;  5AV6 B;  5BO0 B;  1AOI A;  3B6F B;  3LJA B;  2IO5 B;  1WWI A;  3MGP A;  3X1T A;  3LZ1 C;  4XZQ D;  3AZJ A;  3WKJ A;  2ARO C;  3AYW C;  1P3K C;  3W97 C;  5B1M B;  1HTA A;  3C1B B;  2YFV B;  2YFW A;  3B0B A;  4XUJ D;  3KWQ C;  1AOI D;  3MGS C;  4J8V A;  2BYK A;  2FJ7 B;  5AY8 B;  1ID3 C;  3AV1 C;  1P3P A;  4G91 B;  3WAA A;  1S32 A;  3WA9 A;  4J8X B;  3AN2 B;  3WKJ D;  3B0D B;  5AV5 C;  4WU8 A;  2HIO C;  5B40 D;  3AZH D;  2CV5 D;  5BS7 C;  3UT9 B;  3LZ0 A;  3LZ1 B;  1KX5 D;  2PYO C;  3B0C T;  5G49 A;  5CPJ D;  5AVC C;  4J8V D;  2HUE C;  3REK D;  3AYW B;  1P3K B;  3W97 B;  2F8N A;  5C3I B;  1M18 B;  2F8N G;  1M19 B;  3AZE B;  4G92 B;  4KGC D;  3MGS B;  3REI D;  5F99 B;  4YM6 C;  1P3L D;  4WU8 D;  3AFA A;  2NZD A;  4KUD A;  3UTB A;  1ID3 B;  3LZ0 D;  5B0Z A;  2HIO B;  1TZY C;  3KUY B;  3NQJ A;  1M1A A;  4J8W A;  5B33 A;  3X1U A;  1U35 A;  4WNN B;  5AVC B;  5E5A C;  4YS3 C;  2HUE B;  1KX4 C;  4J8U B;  2NZD D;  1P3M D;  3X1T B;  2NQB C;  5B0Z D;  3KXB A;  3AZJ B;  5BNX A;  2F8N H;  5AVB C;  5B2I A;  5B24 B;  4J8W D;  3MGQ A;  3AZI C;  1WWS A;  3W98 A;  5AV6 A;  1P3I C;  1U35 D;  2YFW B;  5BO0 A;  5CP6 C;  3MGR C;  4H9S C;  3LEL C;  1P3B A;  1P3O D;  1P3P B;  3AZL C;  3WAA B;  1S32 B;  3WA9 B;  5E5A B;  4YS3 B;  5GT0 C;  4E44 A;  4WU9 D;  1KX4 B;  5B2I D;  5B1M A;  5B31 C;  3MGQ D;  4EO5 B;  4JJN C;  5AV6 D;  2YFV A;  4X23 C;  3B6F D;  3WTP C;  3LJA D;  5B32 G;  5G49 B;  5CPI C;  3VH5 W;  4Z66 C;  5AY8 A;  2F8N B;  5B2J A;  4J8X A;  4H9O A;  5AV9 C;  1Q9C A;  3LEL B;  3AFA B;  4H9R B;  1KX3 B;  1ZLA B;  3C1B D;  3KSY A;  3LZ1 A;  3UTB B;  5FUG A;  5CHL B;  3UTA C;  3AYW A;  1P3K A;  3W97 A;  2FJ7 D;  4ZUX C;  5AY8 D;  3AZG C;  5DNN C;  1M1A B;  3AZE A;  4J8X D;  3AN2 D;  5B33 B;  3MGS A;  3X1U B;  3WTP B;  4NE5 A;  4Z5T C;  3O62 B;  5AV8 C;  5CPI B;  5JRG B;  1ID3 A;  3UT9 D;  2L5A A;  5B32 C;  1P3K D;  5AV5 A;  3W97 D;  2HIO A;  3KXB B;  5BNX B;  3VH5 A;  1M18 D;  5DNM C;  3AZE D;  5CPK C;  1M19 D;  2PYO A;  3MGS D;  3W98 B;  5F99 D;  4WNN A;  2RVQ D;  5AVC A;  4LD9 C;  5B1L C;  3C1C C;  4J8U A;  4ZUX B;  1ID3 D;  4CAY A;  3NQU A;  5DNN B;  3REJ C;  1P3B B;  4YM6 A;  1P3G C;  4Z5T B;  2HIO D;  3AZM C;  5BNV B;  3A6N B;  5B24 A;  3KUY D;  3X1V C;  1HQ3 B;  3W99 B;  3AZN C;  5AVC D;  3MNN C;  5GSU C;  4J8U D;  5GXQ B;  1P34 C;  3X1S B;  3REL C;  4UUZ A;  4QLC C;  5CPK B;  3X1T D;  3MGP D;  5B2J B;  5E5A A;  5B1L B;  3AZJ D;  4YS3 A;  1KX4 A;  1EQZ C;  5B24 D;  3WTP E;  4H9O B;  4R8P C;  1F66 C;  1TAF B;  5FUG B;  1F1E A;  2CWE A;  5AVB A;  2ARO B;  3W96 C;  3AZN B;  3AZI A;  1P3P D;  2JSS A;  3WAA D;  1S32 D;  3WA9 D;  3KWQ B;  5CP6 A;  5E5A D;  5GSU B;  4YS3 D;  3MNN B;  3MGR A;  4H9S A;  3LEL A;  4AWL C;  4H9R A;  1KX3 A;  1ZLA A;  3AV1 B;  3AZL A;  4XZQ C; 
#chains in the Genus database with same CATH topology
 1BH9 A;  5GT0 A;  4WJ3 C;  5AV5 B;  3VH6 W;  4R8P B;  2F8N D;  4JJN A;  5B31 G;  4X23 A;  2XD5 A;  4XUJ C;  2PYO B;  3WTP A;  1AOI C;  3AL0 C;  3O62 A;  2ZY2 A;  3LEL D;  3AFA D;  5CPI A;  1KX3 D;  1ZLA D;  3W96 B;  5JRG A;  5GT3 C;  4KUD D;  3UTB D;  4CAY B;  3NQU B;  4KHA B;  2FFF B;  1P3F C;  4YM6 B;  5B40 C;  3AZH C;  2CV5 C;  2BYM A;  1M1A D;  5B33 D;  1KX5 C;  3X1U D;  4DRB A;  3WTP D;  3O62 D;  5CPJ C;  3REK C;  2Y2J A;  4ZUX A;  3AZG A;  5JRG D;  1TZY B;  3TU4 C;  5DNN A;  4UUZ B;  4KGC C;  3REI C;  3H0L C;  4Z5T A;  1P3L C;  3KXB D;  5BNV A;  5AV8 A;  3A6N A;  4WU8 C;  3W99 A;  1HQ3 A;  3VH6 A;  5GT3 B;  3LZ0 C;  3W98 D;  1BFM A;  5B32 A;  2NQB B;  1P3F B;  5GXQ A;  4ZUX D;  3X1S A;  5AVB B;  1P3B D;  5CPK A;  3AV2 C;  3AZI B;  1P3I B;  4Z5T D;  5B1L A;  3C1C A;  5CP6 B;  3MGR B;  3A6N D;  3W99 D;  1HQ3 D;  4HGA C;  5BT1 C;  5B1M D;  3TU4 B;  3REJ A;  1P3M C;  1TAF A;  4NE6 A;  2F2A C;  1P3G A;  3AZL B;  3REI B;  5GXQ D;  3AZM A;  3REH C;  1BH9 B;  4CSR A;  5GT0 B;  5B0Z C;  3X1S D;  2ARO A;  1KU5 A;  1BH8 A;  3X1V A;  5B31 B;  5CPK D;  3AZN A;  5B2J D;  4JJN B;  1ULY A;  3KWQ A;  2G5I C;  3MNN A;  4X23 B;  5B1L D;  5GSU A;  1U35 C;  3VH5 T;  3REL A;  2DQN C;  4Z66 B;  1P3O C;  2ZM5 A;  3AV1 A;  3AV2 B;  3LZ1 D;  3B6G C;  4UPK A;  2ARO D;  3AYW D;  4WU9 C;  5B2I C;  1PZR A;  5AV9 B;  4R8P A;  3MVD C;  3IP4 C;  5BS7 A;  4ZBJ C;  2BYM B;  5KDM A;  3KWQ D;  3MNN D;  1A7W A;  3B6F C;  3LJA C;  3REH B;  3UTA B;  4M6B A;  3W96 A;  5JA4 A;  2Y2N A;  1B6W A;  3AZG B;  3AV1 D;  4KHA A;  1N1J B;  5AV5 D;  2F8N K;  4R8P D;  5AV8 B;  1H3O B;  3C1B C;  2PYO D;  3B6G B;  2DF4 C;  1P3A C;  3AZK C;  5B32 B;  4WU9 B;  5B0Y C;  3W96 D;  3AZF C;  3MVD B;  1TZY A;  2FJ7 C;  4G91 C;  5DNM B;  4XUJ A;  4J8X C;  3AN2 C;  1B67 A;  4YM6 D;  4LD9 B;  3B0D C;  3C1C B;  2Y2K A;  5GT3 A;  3UT9 C;  3REJ B;  3R45 B;  2Y2P A;  2NQB A;  1P3F A;  1P3G B;  3B0C W;  3AZM B;  1TZY D;  4H9P A;  4CSR B;  5B40 A;  3AZH A;  2CV5 A;  5C3I C;  3X1V B;  1BH8 B;  2Y2M A;  1M18 C;  1M19 C;  3AZE C;  1KX5 A;  4G92 C;  1P3A B;  1P3I A;  3AZK B;  5F99 C;  5CPJ A;  2ZY4 A;  2RVQ C;  1KX4 D;  5B0Y B;  3V9R A;  3REK A;  2J8P A;  3AZF B;  1P34 B;  5GT3 D;  3TU4 A;  3REL B;  4QLC B;  4KGC A;  3EG5 B;  2NQB D;  3REI A;  1P3F D;  1P3L A;  1EQZ B;  5AVB D;  3KUY C;  5B31 A;  1F66 B;  3AZI D;  1P3I D;  4E45 A;  4NFT A;  5KDM B;  5CP6 D;  3MGR D;  2JE5 A;  4H9N A;  4J8U C;  3TU4 D;  5JA4 B;  4Z66 A;  3AV2 A;  4DRA A;  3MGP C;  3X1T C;  3AZL D;  4H9Q A;  5GT0 D;  3AZJ C;  5B24 C;  3WKJ C;  5AV9 A;  5B31 D;  4AWL B;  1P3M A;  4JJN D;  4X23 D;  4XZQ B;  3A1K A;  3REH A;  3UTA A;  3VH6 T;  5CPI D;  4J8V C;  4Z66 D;  3AV2 D;  4WZS B;  1P3P C;  1N1J A;  3WAA C;  1S32 C;  3WA9 C;  4XUJ B;  1AOI B;  5BT1 D;  5AV9 D;  4EO5 C;  1P3O A;  1H3O A;  1JFI A;  3B6G A;  3MGP B;  3REH D;  3F6T A;  3UTA D;  4WU9 A;  2Y2H A;  3WKJ B;  3A1I A;  3MVD A;  3AZG D;  4H9P B;  5B40 B;  3AZH B;  5DNN D;  2CV5 B;  5DNM A;  1KX5 B;  3B6F A;  4LD9 A;  3LJA A;  5CPJ B;  4WV4 B;  5AV8 D;  1KX3 C;  3AFA C;  2BYK B;  3V9R B;  4J8V B;  3REK B;  1ZLA C;  2NZD C;  4KUD C;  2BG1 A;  3R45 A;  1W2E A;  3UTB C;  3B6G D;  4KGC B;  5B32 D;  1P3L B;  3MVD D;  4WU8 B;  3EPK A;  3C1B A;  5DNM D;  1M1A C;  4J8W C;  1P3A A;  3LZ0 B;  5B33 C;  3AZK A;  3X1U C;  4LD9 D;  3O62 C;  3C1C D;  5B0Y A;  3AZF A;  2FJ7 A;  1P34 A;  4H9N B;  2G5H C;  5JRG C;  4Z2M G;  3REJ D;  4QLC A;  3AN2 A;  1P3G D;  4H9Q B;  3AZM D;  3KXB C;  1EQZ A;  3X1V D;  2NZD B;  4HGA B;  3UT9 A;  1F66 A;  4KUD B;  3AZN D;  3MGQ C;  1P3A D;  4NE3 A;  1P3M B;  3FDD A;  3AZK D;  3W98 C;  5AV6 C;  5GSU D;  5B0Y D;  3AZF D;  1P34 D;  5B0Z B;  2IO5 C;  3REL D;  1M18 A;  4QLC D;  1P3B C;  3NQJ B;  1M19 A;  4J8W B;  2LY8 A;  5F99 A;  1U35 B;  3EPJ A;  1EQZ D;  3A6N C;  1R4V A;  1HQ3 C;  3W99 C;  1F66 D;  5B1M C;  1P3O B;  1JFI B;  4XZQ A;  5GXQ C;  4Z2M H;  3X1S C;  3KUY A;  5B2I B;  5AY8 C;  3MGQ B;  4ZBJ B;  5B2J C;  5AV6 B;  5BO0 B;  1AOI A;  3B6F B;  3LJA B;  2IO5 B;  1WWI A;  3MGP A;  3X1T A;  3LZ1 C;  4XZQ D;  3AZJ A;  3WKJ A;  2ARO C;  3AYW C;  1P3K C;  3W97 C;  5B1M B;  1HTA A;  3C1B B;  2YFV B;  2YFW A;  3B0B A;  4XUJ D;  3KWQ C;  1AOI D;  3MGS C;  4J8V A;  2BYK A;  2FJ7 B;  1Z2C B;  5AY8 B;  1ID3 C;  3AV1 C;  1P3P A;  4G91 B;  3WAA A;  1S32 A;  3WA9 A;  4J8X B;  3AN2 B;  3WKJ D;  3B0D B;  2Y2G A;  5AV5 C;  4WU8 A;  2HIO C;  5B40 D;  3AZH D;  2CV5 D;  5BS7 C;  3UT9 B;  3LZ0 A;  3LZ1 B;  1KX5 D;  2PYO C;  3B0C T;  5G49 A;  5CPJ D;  5AVC C;  4J8V D;  2HUE C;  3REK D;  3AYW B;  1P3K B;  3W97 B;  2F8N A;  5C3I B;  1M18 B;  2F8N G;  3H0M C;  1M19 B;  3AZE B;  4G92 B;  4KGC D;  2Y2O A;  3MGS B;  3REI D;  5F99 B;  4YM6 C;  1P3L D;  4WU8 D;  3AFA A;  2NZD A;  4KUD A;  3UTB A;  1ID3 B;  3LZ0 D;  2W8S A;  4DQY B;  5B0Z A;  2HIO B;  1TZY C;  3KUY B;  3NQJ A;  1M1A A;  4J8W A;  5B33 A;  3X1U A;  1U35 A;  4WNN B;  5AVC B;  5E5A C;  4YS3 C;  2HUE B;  1KX4 C;  4J8U B;  2NZD D;  1P3M D;  2XD1 A;  3X1T B;  2NQB C;  1T3U A;  5B0Z D;  3KXB A;  3AZJ B;  5BNX A;  2F8N H;  5AVB C;  5B2I A;  5B24 B;  4J8W D;  3MGQ A;  2Y2L A;  3AZI C;  1WWS A;  3W98 A;  5AV6 A;  1P3I C;  1U35 D;  2YFW B;  5BO0 A;  5CP6 C;  3MGR C;  4H9S C;  3LEL C;  1P3B A;  1P3O D;  1P3P B;  3AZL C;  2RIQ A;  1S32 B;  3WA9 B;  3WAA B;  5E5A B;  4YS3 B;  2Y2Q A;  4E44 A;  5GT0 C;  4WU9 D;  1KX4 B;  5B2I D;  2ZY3 A;  5B1M A;  5B31 C;  3MGQ D;  4EO5 B;  4JJN C;  5AV6 D;  2YFV A;  4X23 C;  3B6F D;  3WTP C;  3LJA D;  5B32 G;  5G49 B;  5CPI C;  3VH5 W;  3EPH A;  4Z66 C;  5AY8 A;  2F8N B;  5B2J A;  4J8X A;  2ZY5 A;  4H9O A;  5AV9 C;  1Q9C A;  3LEL B;  3AFA B;  4H9R B;  1KX3 B;  1ZLA B;  3EPL A;  3C1B D;  3KSY A;  3LZ1 A;  3UTB B;  5FUG A;  5CHL B;  3UTA C;  3AYW A;  1P3K A;  3W97 A;  2FJ7 D;  4ZUX C;  5AY8 D;  3AZG C;  3P5J B;  3H0R C;  5DNN C;  1M1A B;  3AZE A;  4J8X D;  3AN2 D;  5B33 B;  3MGS A;  3X1U B;  3WTP B;  4NE5 A;  4Z5T C;  3O62 B;  5AV8 C;  5CPI B;  5JRG B;  1ID3 A;  3UT9 D;  2L5A A;  5B32 C;  1P3K D;  5AV5 A;  3W97 D;  2HIO A;  3KXB B;  5BNX B;  3VH5 A;  1M18 D;  5DNM C;  3AZE D;  5CPK C;  1M19 D;  2PYO A;  3MGS D;  3W98 B;  5F99 D;  4WNN A;  2RVQ D;  5AVC A;  4LD9 C;  5B1L C;  3C1C C;  4J8U A;  4ZUX B;  1ID3 D;  4CAY A;  3NQU A;  5DNN B;  3REJ C;  1P3B B;  4YM6 A;  1P3G C;  4Z5T B;  2HIO D;  3AZM C;  5BNV B;  3A6N B;  5B24 A;  3KUY D;  3X1V C;  1HQ3 B;  3W99 B;  3AZN C;  5AVC D;  3MNN C;  5GSU C;  2Y2I A;  2VQR A;  5GXQ B;  4J8U D;  1P34 C;  3X1S B;  3REL C;  4UUZ A;  2UWX A;  4QLC C;  5CPK B;  3X1T D;  3MGP D;  5B2J B;  5E5A A;  5B1L B;  3AZJ D;  4YS3 A;  1KX4 A;  3KFU G;  1EQZ C;  5B24 D;  3WTP E;  4H9O B;  4R8P C;  1F66 C;  1TAF B;  5FUG B;  1F1E A;  2CWE A;  5AVB A;  2ARO B;  3W96 C;  2JCH A;  3AZN B;  3AZI A;  1P3P D;  2JSS A;  3WAA D;  1S32 D;  3WA9 D;  3KWQ B;  5CP6 A;  5E5A D;  5GSU B;  4YS3 D;  3MNN B;  3MGR A;  4H9S A;  3LEL A;  4AWL C;  4H9R A;  1KX3 A;  1ZLA A;  3AV1 B;  3AZL A;  4XZQ C; 
#chains in the Genus database with same CATH homology
 1BH9 A;  5GT0 A;  4WJ3 C;  5AV5 B;  3VH6 W;  4R8P B;  2F8N D;  4JJN A;  5B31 G;  4X23 A;  2XD5 A;  4XUJ C;  2PYO B;  3WTP A;  1AOI C;  3AL0 C;  3O62 A;  2ZY2 A;  3LEL D;  3AFA D;  5CPI A;  1KX3 D;  1ZLA D;  3W96 B;  5JRG A;  5GT3 C;  4KUD D;  3UTB D;  4CAY B;  3NQU B;  4KHA B;  2FFF B;  1P3F C;  4YM6 B;  5B40 C;  3AZH C;  2CV5 C;  2BYM A;  1M1A D;  5B33 D;  1KX5 C;  3X1U D;  4DRB A;  3WTP D;  3O62 D;  5CPJ C;  3REK C;  2Y2J A;  4ZUX A;  3AZG A;  5JRG D;  1TZY B;  3TU4 C;  5DNN A;  4UUZ B;  4KGC C;  3REI C;  3H0L C;  4Z5T A;  1P3L C;  3KXB D;  5BNV A;  5AV8 A;  3A6N A;  4WU8 C;  3W99 A;  1HQ3 A;  3VH6 A;  5GT3 B;  3LZ0 C;  3W98 D;  1BFM A;  5B32 A;  2NQB B;  1P3F B;  5GXQ A;  4ZUX D;  3X1S A;  5AVB B;  1P3B D;  5CPK A;  3AV2 C;  3AZI B;  1P3I B;  4Z5T D;  5B1L A;  3C1C A;  5CP6 B;  3MGR B;  3A6N D;  3W99 D;  1HQ3 D;  4HGA C;  5BT1 C;  5B1M D;  3TU4 B;  3REJ A;  1P3M C;  1TAF A;  4NE6 A;  2F2A C;  1P3G A;  3AZL B;  3REI B;  5GXQ D;  3AZM A;  3REH C;  1BH9 B;  4CSR A;  5GT0 B;  5B0Z C;  3X1S D;  2ARO A;  1KU5 A;  1BH8 A;  3X1V A;  5B31 B;  5CPK D;  3AZN A;  5B2J D;  4JJN B;  1ULY A;  3KWQ A;  2G5I C;  3MNN A;  4X23 B;  5B1L D;  5GSU A;  1U35 C;  3VH5 T;  3REL A;  2DQN C;  4Z66 B;  1P3O C;  2ZM5 A;  3AV1 A;  3AV2 B;  3LZ1 D;  3B6G C;  4UPK A;  2ARO D;  3AYW D;  4WU9 C;  5B2I C;  1PZR A;  5AV9 B;  4R8P A;  3MVD C;  3IP4 C;  5BS7 A;  4ZBJ C;  2BYM B;  5KDM A;  3KWQ D;  3MNN D;  1A7W A;  3B6F C;  3LJA C;  3REH B;  3UTA B;  4M6B A;  3W96 A;  5JA4 A;  2Y2N A;  1B6W A;  3AZG B;  3AV1 D;  4KHA A;  1N1J B;  5AV5 D;  2F8N K;  4R8P D;  5AV8 B;  1H3O B;  3C1B C;  2PYO D;  3B6G B;  2DF4 C;  1P3A C;  3AZK C;  5B32 B;  4WU9 B;  5B0Y C;  3W96 D;  3AZF C;  3MVD B;  1TZY A;  2FJ7 C;  4G91 C;  5DNM B;  4XUJ A;  4J8X C;  3AN2 C;  1B67 A;  4YM6 D;  4LD9 B;  3B0D C;  3C1C B;  2Y2K A;  5GT3 A;  3UT9 C;  3REJ B;  3R45 B;  2Y2P A;  2NQB A;  1P3F A;  1P3G B;  3B0C W;  3AZM B;  1TZY D;  4H9P A;  4CSR B;  5B40 A;  3AZH A;  2CV5 A;  5C3I C;  3X1V B;  1BH8 B;  2Y2M A;  1M18 C;  1M19 C;  3AZE C;  1KX5 A;  4G92 C;  1P3A B;  1P3I A;  3AZK B;  5F99 C;  5CPJ A;  2ZY4 A;  2RVQ C;  1KX4 D;  5B0Y B;  3V9R A;  3REK A;  2J8P A;  3AZF B;  1P34 B;  5GT3 D;  3TU4 A;  3REL B;  4QLC B;  4KGC A;  3EG5 B;  2NQB D;  3REI A;  1P3F D;  1P3L A;  1EQZ B;  5AVB D;  3KUY C;  5B31 A;  1F66 B;  3AZI D;  1P3I D;  4E45 A;  4NFT A;  5KDM B;  5CP6 D;  3MGR D;  2JE5 A;  4H9N A;  4J8U C;  3TU4 D;  5JA4 B;  4Z66 A;  3AV2 A;  4DRA A;  3MGP C;  3X1T C;  3AZL D;  4H9Q A;  5GT0 D;  3AZJ C;  5B24 C;  3WKJ C;  5AV9 A;  5B31 D;  4AWL B;  1P3M A;  4JJN D;  4X23 D;  4XZQ B;  3A1K A;  3REH A;  3UTA A;  3VH6 T;  5CPI D;  4J8V C;  4Z66 D;  3AV2 D;  4WZS B;  1P3P C;  1N1J A;  3WAA C;  1S32 C;  3WA9 C;  4XUJ B;  1AOI B;  5BT1 D;  5AV9 D;  4EO5 C;  1P3O A;  1H3O A;  1JFI A;  3B6G A;  3MGP B;  3REH D;  3F6T A;  3UTA D;  4WU9 A;  2Y2H A;  3WKJ B;  3A1I A;  3MVD A;  3AZG D;  4H9P B;  5B40 B;  3AZH B;  5DNN D;  2CV5 B;  5DNM A;  1KX5 B;  3B6F A;  4LD9 A;  3LJA A;  5CPJ B;  4WV4 B;  5AV8 D;  1KX3 C;  3AFA C;  2BYK B;  3V9R B;  4J8V B;  3REK B;  1ZLA C;  2NZD C;  4KUD C;  2BG1 A;  3R45 A;  1W2E A;  3UTB C;  3B6G D;  4KGC B;  5B32 D;  1P3L B;  3MVD D;  4WU8 B;  3EPK A;  3C1B A;  5DNM D;  1M1A C;  4J8W C;  1P3A A;  3LZ0 B;  5B33 C;  3AZK A;  3X1U C;  4LD9 D;  3O62 C;  3C1C D;  5B0Y A;  3AZF A;  2FJ7 A;  1P34 A;  4H9N B;  2G5H C;  5JRG C;  4Z2M G;  3REJ D;  4QLC A;  3AN2 A;  1P3G D;  4H9Q B;  3AZM D;  3KXB C;  1EQZ A;  3X1V D;  2NZD B;  4HGA B;  3UT9 A;  1F66 A;  4KUD B;  3AZN D;  3MGQ C;  1P3A D;  4NE3 A;  1P3M B;  3FDD A;  3AZK D;  3W98 C;  5AV6 C;  5GSU D;  5B0Y D;  3AZF D;  1P34 D;  5B0Z B;  2IO5 C;  3REL D;  1M18 A;  4QLC D;  1P3B C;  3NQJ B;  1M19 A;  4J8W B;  2LY8 A;  5F99 A;  1U35 B;  3EPJ A;  1EQZ D;  3A6N C;  1R4V A;  1HQ3 C;  3W99 C;  1F66 D;  5B1M C;  1P3O B;  1JFI B;  4XZQ A;  5GXQ C;  4Z2M H;  3X1S C;  3KUY A;  5B2I B;  5AY8 C;  3MGQ B;  4ZBJ B;  5B2J C;  5AV6 B;  5BO0 B;  1AOI A;  3B6F B;  3LJA B;  2IO5 B;  1WWI A;  3MGP A;  3X1T A;  3LZ1 C;  4XZQ D;  3AZJ A;  3WKJ A;  2ARO C;  3AYW C;  1P3K C;  3W97 C;  5B1M B;  1HTA A;  3C1B B;  2YFV B;  2YFW A;  3B0B A;  4XUJ D;  3KWQ C;  1AOI D;  3MGS C;  4J8V A;  2BYK A;  2FJ7 B;  1Z2C B;  5AY8 B;  1ID3 C;  3AV1 C;  1P3P A;  4G91 B;  3WAA A;  1S32 A;  3WA9 A;  4J8X B;  3AN2 B;  3WKJ D;  3B0D B;  2Y2G A;  5AV5 C;  4WU8 A;  2HIO C;  5B40 D;  3AZH D;  2CV5 D;  5BS7 C;  3UT9 B;  3LZ0 A;  3LZ1 B;  1KX5 D;  2PYO C;  3B0C T;  5G49 A;  5CPJ D;  5AVC C;  4J8V D;  2HUE C;  3REK D;  3AYW B;  1P3K B;  3W97 B;  2F8N A;  5C3I B;  1M18 B;  2F8N G;  3H0M C;  1M19 B;  3AZE B;  4G92 B;  4KGC D;  2Y2O A;  3MGS B;  3REI D;  5F99 B;  4YM6 C;  1P3L D;  4WU8 D;  3AFA A;  2NZD A;  4KUD A;  3UTB A;  1ID3 B;  3LZ0 D;  2W8S A;  4DQY B;  5B0Z A;  2HIO B;  1TZY C;  3KUY B;  3NQJ A;  1M1A A;  4J8W A;  5B33 A;  3X1U A;  1U35 A;  4WNN B;  5AVC B;  5E5A C;  4YS3 C;  2HUE B;  1KX4 C;  4J8U B;  2NZD D;  1P3M D;  2XD1 A;  3X1T B;  2NQB C;  1T3U A;  5B0Z D;  3KXB A;  3AZJ B;  5BNX A;  2F8N H;  5AVB C;  5B2I A;  5B24 B;  4J8W D;  3MGQ A;  2Y2L A;  3AZI C;  1WWS A;  3W98 A;  5AV6 A;  1P3I C;  1U35 D;  2YFW B;  5BO0 A;  5CP6 C;  3MGR C;  4H9S C;  3LEL C;  1P3B A;  1P3O D;  1P3P B;  3AZL C;  2RIQ A;  1S32 B;  3WA9 B;  3WAA B;  5E5A B;  4YS3 B;  2Y2Q A;  4E44 A;  5GT0 C;  4WU9 D;  1KX4 B;  5B2I D;  2ZY3 A;  5B1M A;  5B31 C;  3MGQ D;  4EO5 B;  4JJN C;  5AV6 D;  2YFV A;  4X23 C;  3B6F D;  3WTP C;  3LJA D;  5B32 G;  5G49 B;  5CPI C;  3VH5 W;  3EPH A;  4Z66 C;  5AY8 A;  2F8N B;  5B2J A;  4J8X A;  2ZY5 A;  4H9O A;  5AV9 C;  1Q9C A;  3LEL B;  3AFA B;  4H9R B;  1KX3 B;  1ZLA B;  3EPL A;  3C1B D;  3KSY A;  3LZ1 A;  3UTB B;  5FUG A;  5CHL B;  3UTA C;  3AYW A;  1P3K A;  3W97 A;  2FJ7 D;  4ZUX C;  5AY8 D;  3AZG C;  3P5J B;  3H0R C;  5DNN C;  1M1A B;  3AZE A;  4J8X D;  3AN2 D;  5B33 B;  3MGS A;  3X1U B;  3WTP B;  4NE5 A;  4Z5T C;  3O62 B;  5AV8 C;  5CPI B;  5JRG B;  1ID3 A;  3UT9 D;  2L5A A;  5B32 C;  1P3K D;  5AV5 A;  3W97 D;  2HIO A;  3KXB B;  5BNX B;  3VH5 A;  1M18 D;  5DNM C;  3AZE D;  5CPK C;  1M19 D;  2PYO A;  3MGS D;  3W98 B;  5F99 D;  4WNN A;  2RVQ D;  5AVC A;  4LD9 C;  5B1L C;  3C1C C;  4J8U A;  4ZUX B;  1ID3 D;  4CAY A;  3NQU A;  5DNN B;  3REJ C;  1P3B B;  4YM6 A;  1P3G C;  4Z5T B;  2HIO D;  3AZM C;  5BNV B;  3A6N B;  5B24 A;  3KUY D;  3X1V C;  1HQ3 B;  3W99 B;  3AZN C;  5AVC D;  3MNN C;  5GSU C;  2Y2I A;  2VQR A;  5GXQ B;  4J8U D;  1P34 C;  3X1S B;  3REL C;  4UUZ A;  2UWX A;  4QLC C;  5CPK B;  3X1T D;  3MGP D;  5B2J B;  5E5A A;  5B1L B;  3AZJ D;  4YS3 A;  1KX4 A;  3KFU G;  1EQZ C;  5B24 D;  3WTP E;  4H9O B;  4R8P C;  1F66 C;  1TAF B;  5FUG B;  1F1E A;  2CWE A;  5AVB A;  2ARO B;  3W96 C;  2JCH A;  3AZN B;  3AZI A;  1P3P D;  2JSS A;  3WAA D;  1S32 D;  3WA9 D;  3KWQ B;  5CP6 A;  5E5A D;  5GSU B;  4YS3 D;  3MNN B;  3MGR A;  4H9S A;  3LEL A;  4AWL C;  4H9R A;  1KX3 A;  1ZLA A;  3AV1 B;  3AZL A;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...