5B0ZA

The crystal structure of the nucleosome containing h3.2, at 1.98 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0zA00
5B1MC 4J8XB 3AZFA 2CV5A 2F8NG 3VH6A 3C1BA 5AV6B 1ID3B 3MNNC 1P3GD 1AOID 4J8WB 5CPIB 2PYOC 1M1AA 5AV9D 3LJAC 3UT9B 3AV1D 2IO5C 5B32C 4JJND 5F99D 4EO5C 5CP6B 4R8PA 5B33B 3KUYC 5BNVA 4YM6B 3AZJA 2FJ7D 5AV5C 4H9RB 3AZKD 5AVBD 5E5AD 5B2IB 1P3FA 3WTPA 3WAAA 3MVDA 4XZQC 4KHAA 1U35A 1P3OB 5AY8B 4KUDB 3O62C 5B24B 1M18D 1P3MB 5B1MB 4J8UA 4UUZA 3UTBA 4H9NA 3MNNB 3UTAD 4WU8A 1S32D 1P3GC 1P3IC 2PYOB 3KWQA 3LJAB 3AZHA 5JRGA 2IO5B 3W98A 3W99A 4EO5B 5FUGB 1N1JA 3REIA 1BH9A 3AZGA 1WWSA 3LZ0C 3LZ1A 5AV5B 3AFAA 3B6FC 5BNXB 4XZQB 5B1LC 4WU9D 1M19D 5B40B 3A6NA 3O62B 3VH6T 2F8NK 3VH5A 4Z5TA 4QLCD 3MGRB 4ZBJC 1M18C 2NZDC 1H3OB 1P3BD 3AV2A 1P3GB 1P3IB 5CPJA 5BO0B 5CPKD 2F8NB 1P3AC 3X1TD 4J8VA 3WKJD 3NQJA 5GT3C 3AZLC 4Z66C 4LD9C 3LZ0B 2HUEC 4CAYB 5B2JA 1P3KD 1F66A 3LELA 3B6FB 3X1UD 3REJD 4H9OA 3B6GD 3REHD 1KX3D 1ZLAC 5B1LB 3KSYA 5GXQD 5AVCB 1P34D 1P3LA 3MGQA 1JFIB 4J8XD 4ZBJB 1ID3D 3AYWC 2NZDB 2BYKB 4J8WD 4WNNB 5CPID 3UT9D 5B31C 5CPKC 1P3AB 3R45A 5DNMC 4HGAC 5CP6D 5B33D 1A7WA 3WKJC 5GT3B 4Z2MH 4Z66B 3AZLB 4LD9B 4YM6D 2HUEB 5DNNC 4YS3C 3AN2A 1EQZA 3WA9C 1BFMA 3REJC 3B6GC 1ZLAB 3VH5T 3REHC 1KX3C 2YFWB 5AY8D 3V9RB 1P3OD 4KGCC 4KUDD 3AZMC 3AZIC 5B24D 2HIOA 4ZUXC 1P3MD 2NQBA 3AZEC 5B1MD 4NE3A 5GSUC 1KX4B 3AYWB 4WV4B 3MNND 5GT0C 5AV6A 1KU5A 5B0ZC 2PYOD 3LJAD 2YFVB 3MGPA 5B31B 3RELC 5DNMB 1TZYA 4HGAB 4DRAA 3W96A 3REKA 3X1VC 5DNNB 5AV5D 4YS3B 3KXBB 3WA9B 4YM6A 3REJB 3X1SA 5B40D 4KGCB 5B2IA 3O62D 1P3OC 3TU4D 3AZMB 3AZIB 4ZUXB 3MGRD 3C1CA 3AZEB 1P3PA 5GSUB 2BYMB 4XUJA 4E44A 5BS7C 5GT0B 1P3ID 5B0ZB 2F8ND 3W97D 4H9PA 3RELB 4G91C 5B0YA 5C3IC 3LZ0D 5B32A 4AWLC 1HQ3C 3X1VB 3NQUA 3KUYA 3B6FD 4NFTA 1ULYA 3AZFC 2CV5C 3C1BC 5B1LD 3B0DC 5AV5A 5AVCD 5BNXA 5B40C 3TU4C 4XZQA 2AROB 3MGRC 3MGSB 5AV8A 2NZDD 3AZNA 3AZJC 1P3AD 3W97C 1AOIA 1P3GA 1P3FC 3WTPC 3WAAC 4X23B 3MVDC 5GT3D 3AZLD 5G49A 4G91B 5KDMB 4Z66D 4LD9D 5AV9A 1U35C 5C3IB 3AV1A 4AWLB 1HQ3B 4JJNA 5F99A 1B6WA 3AZFB 2CV5B 3LZ0A 1ZLAD 3C1BB 3B0DB 3UTBC 2FJ7A 5AVCC 3AZKA 5AVBA 5E5AA 4WU8C 3TU4B 3KWQC 1M1AB 3AZHC 1KX4D 3AYWD 3W98C 5BT1C 1M18A 3AZGC 5BNVB 5B31D 3AZJB 3W97B 5DNMD 3AFAC 3UTAA 1S32A 1P3FB 3WTPB 3WAAB 1WWIA 3MVDB 1TAFA 4KHAB 1U35B 3A6NC 5DNND 4YS3D 3KXBD 3WA9D 4UUZB 4KGCD 1BH8A 3UTBB 3AZMD 4H9NB 3AZID 3AV2C 4WU8B 5JA4A 4ZUXD 3AZED 3WTPE 4WU9A 3KWQB 5GSUD 1M19A 3AZHB 4J8VC 5JRGB 1KX4C 3W98B 3W99B 5GT0D 4QLCA 1N1JB 3REIB 1BH9B 3AZGB 1KX5D 5B0ZD 4M6BA 3LZ1B 5B2JC 3RELD 1P3BA 3AFAB 5B31A 5CPKA 2F8NH 5DNMA 3A6NB 3X1TA 3X1VD 1P3LC 3WKJA 4Z5TB 3KXBC 4H9QA 1P3KA 2RVQD 3X1UA 3REJA 3AV2B 3B6GA 3B0CW 2AROD 3REHA 3MGSD 1KX3A 5GXQA 1P34A 4J8VB 2JSSA 4CSRB 3NQJB 4J8XA 5GSUA 1KX5C 1ID3A 4H9SA 3AN2C 5B2JB 1F66B 3LELB 4X23D 1R4VA 4J8WA 4H9OB 5CPIA 3UT9A 1HQ3D 1P3LB 5CP6A 5B33A 3AZFD 2CV5D 3C1BD 4H9RA 2RVQC 5B32G 1M1AD 2AROC 3MGPC 3MGSC 5AY8A 5CHLB 1P3OA 4KUDA 3R45B 5B24A 1TZYC 4R8PD 1P3MA 5B1MA 3REKC 1KX5B 3AZJD 3AN2B 3MNNA 1EQZB 3B0BA 1P3FD 3WTPD 3WAAD 4X23C 3MVDD 2PYOA 1U35D 3LJAA 5FUGA 1P3PC 2NQBB 3UTBD 4XUJC 4WU8D 4Z2MG 3KWQD 5B40A 3AZHD 3MGPB 1M1AC 5JRGD 3O62A 3TU4A 3W98D 5BT1D 3W99D 4G92C 1TZYB 4R8PC 3MGRA 3REID 5B0YC 3AZGD 3W96B 3REKB 3LZ1D 1H3OA 3AFAD 4DRBA 1P3IA 5BO0A 2F8NA 3W97A 3X1SB 3A6ND 3VH6W 4Z5TD 1P3PB 3C1CB 5AV8C 4J8UC 4CAYA 3AZNC 4XUJB 3B6FA 3AV2D 5CPJD 5B1LA 5AVCA 4J8VD 1AOIC 4H9PB 5JRGC 1JFIA 4G92B 3W99C 4R8PB 2LY8A 5B0YB 5AV9C 3REIC 5B32B 3AV1C 5B2JD 4JJNC 5F99C 3NQUB 3LZ1C 1F66D 3LELD 2NZDA 3KUYB 2BYKA 4WNNA 2FJ7C 1P3AA 1P3LD 3AZKC 5AVBC 5E5AC 3MGQD 5GT3A 4Z5TC 4Z66A 3AZLA 4LD9A 1Q9CA 5AV8B 4J8UB 4E45A 3AZNB 5B31G 5CPJC 1ZLAA 2YFWA 3V9RA 1AOIB 3UTAC 1S32C 5G49B 5AV9B 1KX4A 3AV1B 4CSRA 3AYWA 3AN2D 4JJNB 5F99B 1EQZD 1F66C 2L5AA 3LELC 3VH5W 2YFVA 2FJ7B 4WZSB 3AZKB 2HIOD 5E5AB 5AVBB 3MGQC 2NQBD 1F1EA 4WU9C 1M19C 5DNNA 4YS3A 3KXBA 4QLCC 3WA9A 1M18B 5AV6D 5CPJB 4KGCA 3MGPD 4NE6A 3AZMA 1P3BC 3AZIA 3UTAB 1TZYD 1S32B 4ZUXA 3AZEA 3W96D 4NE5A 1TAFB 3REKD 3X1TC 2BYMA 1B67A 5GT0A 1EQZC 1KX5A 5B0ZA 3X1SD 1BH8B 5B2ID 1P3KC 3RELA 3X1UC 2HIOC 5JA4B 3MGQB 3C1CD 1P3PD 2NQBC 4WU9B 5GXQC 1M19B 3X1VA 1P34C 4XUJD 2CWEA 4QLCB 4J8XC 5AV6C 1ID3C 4H9SC 1P3BB 4J8WC 5CPIC 2AROA 3B0CT 5B0YD 3W96C 3MGSA 3UT9C 5CPKB 5B32D 3X1TB 5CP6C 3KUYD 5BS7A 5B33C 3WKJB 4YM6C 1HTAA 4H9QB 3X1SC 1P3KB 5B2IC 4X23A 3X1UB 4XZQD 2HIOB 3B6GB 5KDMA 3C1CC 3REHB 1KX3B 5AV8D 4KUDC 5AY8C 5GXQB 4J8UD 1HQ3A 1P34B 3AZND 5B24C 1P3MC
chains in the Genus database with same CATH superfamily
5B1MC 4J8XB 3AZFA 2CV5A 2F8NG 3VH6A 3C1BA 5AV6B 1ID3B 3MNNC 1P3GD 1AOID 4J8WB 5CPIB 2PYOC 1M1AA 5AV9D 3EPJA 3LJAC 3UT9B 3AV1D 2IO5C 5B32C 4JJND 5F99D 4EO5C 5CP6B 4R8PA 5B33B 3KUYC 5BNVA 4YM6B 3AZJA 2FJ7D 5AV5C 4H9RB 3AZKD 2Y2IA 5AVBD 5E5AD 5B2IB 1P3FA 3WTPA 3WAAA 3MVDA 4XZQC 4KHAA 1U35A 1P3OB 5AY8B 4KUDB 3O62C 2Y2HA 2F2AC 5B24B 1M18D 1P3MB 5B1MB 4J8UA 4UUZA 3UTBA 4H9NA 3MNNB 3UTAD 4WU8A 1S32D 1P3GC 1P3IC 2PYOB 3KWQA 3H0RC 3LJAB 3AZHA 5JRGA 2IO5B 3W98A 3W99A 4EO5B 5FUGB 1N1JA 3REIA 1BH9A 3AZGA 1WWSA 3LZ0C 3LZ1A 5AV5B 3AFAA 3B6FC 5BNXB 4XZQB 5B1LC 4WU9D 1M19D 5B40B 3A6NA 3O62B 3VH6T 2F8NK 3H0LC 3VH5A 4Z5TA 4QLCD 3MGRB 4ZBJC 1M18C 2G5HC 2NZDC 1H3OB 1P3BD 3AV2A 1P3GB 1P3IB 5CPJA 5BO0B 5CPKD 2F8NB 1P3AC 3X1TD 4J8VA 3WKJD 3NQJA 5GT3C 3AZLC 4Z66C 4LD9C 3LZ0B 2HUEC 4CAYB 5B2JA 1P3KD 1F66A 3LELA 3FDDA 3B6FB 3X1UD 3REJD 4H9OA 3B6GD 2JE5A 3REHD 1KX3D 1ZLAC 5B1LB 2FFFB 3KSYA 5GXQD 5AVCB 1P34D 1P3LA 3MGQA 1JFIB 4J8XD 4ZBJB 1ID3D 3AYWC 2NZDB 2BYKB 4J8WD 4WNNB 5CPID 3UT9D 5B31C 5CPKC 1P3AB 3R45A 5DNMC 4HGAC 5CP6D 5B33D 1A7WA 3WKJC 5GT3B 4Z2MH 4Z66B 3AZLB 4LD9B 4YM6D 2HUEB 5DNNC 4YS3C 3AN2A 1EQZA 2W8SA 3WA9C 1BFMA 3REJC 3B6GC 1ZLAB 3VH5T 3REHC 1KX3C 2YFWB 5AY8D 3V9RB 1P3OD 4KGCC 4KUDD 3AZMC 3AZIC 2HIOA 5B24D 4ZUXC 1P3MD 2NQBA 3AZEC 5B1MD 4NE3A 5GSUC 1KX4B 3AYWB 4WV4B 3MNND 3H0MC 5GT0C 5AV6A 1KU5A 5B0ZC 2PYOD 3LJAD 2YFVB 3MGPA 5B31B 3RELC 5DNMB 1TZYA 4HGAB 4DRAA 3W96A 3REKA 3IP4C 3X1VC 5DNNB 5AV5D 4YS3B 3KXBB 3WA9B 1PZRA 4YM6A 3P5JB 3REJB 3X1SA 5B40D 4KGCB 5B2IA 3O62D 1P3OC 3TU4D 3AZMB 3AZIB 4ZUXB 3MGRD 3C1CA 3AZEB 1P3PA 5GSUB 2BYMB 4XUJA 4E44A 2DF4C 5BS7C 5GT0B 1P3ID 5B0ZB 2F8ND 3W97D 2ZY2A 4H9PA 3RELB 4G91C 5B0YA 5C3IC 3LZ0D 5B32A 4AWLC 1HQ3C 3X1VB 3NQUA 3KUYA 3B6FD 4NFTA 3A1KA 1ULYA 3AZFC 2CV5C 3C1BC 5B1LD 3B0DC 5AV5A 5AVCD 5BNXA 5B40C 3TU4C 4XZQA 2AROB 3MGRC 3MGSB 5AV8A 2NZDD 3AZNA 3AZJC 1P3AD 3W97C 1AOIA 1P3GA 1P3FC 2UWXA 3WTPC 3WAAC 4X23B 3MVDC 5GT3D 3AZLD 5G49A 4G91B 5KDMB 4Z66D 4LD9D 5AV9A 1U35C 5C3IB 3AV1A 4AWLB 1HQ3B 4JJNA 5F99A 1B6WA 3AZFB 2CV5B 3LZ0A 1ZLAD 3C1BB 3B0DB 3UTBC 2FJ7A 5AVCC 3AZKA 5AVBA 5E5AA 4WU8C 3EPLA 3TU4B 3KWQC 1M1AB 3AZHC 1KX4D 3AYWD 2Y2OA 3W98C 5BT1C 2ZM5A 1M18A 1T3UA 3AZGC 5BNVB 5B31D 3AZJB 3W97B 5DNMD 3AFAC 1Z2CB 3UTAA 1S32A 1P3FB 3WTPB 3WAAB 1WWIA 2Y2PA 3MVDB 1TAFA 4KHAB 1U35B 3A6NC 3F6TA 5DNND 4YS3D 3KXBD 3WA9D 3EPHA 4UUZB 4KGCD 1BH8A 3UTBB 3AZMD 4H9NB 3AZID 3KFUG 3AV2C 4WU8B 5JA4A 4ZUXD 3AZED 3WTPE 4WU9A 3KWQB 5GSUD 1M19A 3AZHB 4J8VC 5JRGB 1KX4C 3W98B 3W99B 5GT0D 3AL0C 4QLCA 1N1JB 3REIB 1BH9B 3AZGB 1KX5D 5B0ZD 4M6BA 3LZ1B 5B2JC 3RELD 1P3BA 3AFAB 2Y2LA 2XD1A 5B31A 5CPKA 2F8NH 5DNMA 3A6NB 3X1TA 3X1VD 1P3LC 3WKJA 4Z5TB 3KXBC 4H9QA 1P3KA 2RVQD 3X1UA 3REJA 3AV2B 3B6GA 3B0CW 2AROD 3REHA 3MGSD 1KX3A 5GXQA 1P34A 4J8VB 2Y2MA 2JSSA 4CSRB 3NQJB 4J8XA 5GSUA 1KX5C 1ID3A 4H9SA 3AN2C 5B2JB 1F66B 3LELB 4X23D 1R4VA 4J8WA 2XD5A 4H9OB 5CPIA 2J8PA 3UT9A 1W2EA 1HQ3D 1P3LB 5CP6A 5B33A 3AZFD 2CV5D 3C1BD 4H9RA 2RVQC 5B32G 1M1AD 2AROC 3MGPC 3MGSC 5AY8A 5CHLB 1P3OA 4KUDA 3R45B 5B24A 1TZYC 4R8PD 2VQRA 1P3MA 5B1MA 3REKC 1KX5B 3AZJD 3AN2B 3MNNA 1EQZB 3B0BA 1P3FD 3WTPD 3WAAD 2JCHA 4X23C 3MVDD 2PYOA 1U35D 3LJAA 5FUGA 1P3PC 2NQBB 3UTBD 4XUJC 4WU8D 4Z2MG 3KWQD 5B40A 3AZHD 3MGPB 1M1AC 5JRGD 3O62A 3TU4A 3W98D 5BT1D 3W99D 4G92C 1TZYB 4R8PC 3MGRA 3REID 5B0YC 3AZGD 3W96B 2Y2JA 3REKB 3LZ1D 2Y2KA 1H3OA 3AFAD 4DRBA 1P3IA 5BO0A 2F8NA 3W97A 3X1SB 3A6ND 3VH6W 3A1IA 4Z5TD 1P3PB 3C1CB 5AV8C 4J8UC 4CAYA 3AZNC 4XUJB 3B6FA 3AV2D 5CPJD 5B1LA 5AVCA 4J8VD 1AOIC 4H9PB 5JRGC 1JFIA 4G92B 3W99C 4R8PB 2LY8A 5B0YB 5AV9C 3REIC 5B32B 3AV1C 5B2JD 4JJNC 5F99C 3NQUB 3LZ1C 1F66D 2ZY5A 3LELD 2NZDA 3KUYB 2BYKA 4WNNA 2FJ7C 1P3AA 1P3LD 3AZKC 5AVBC 5E5AC 3MGQD 5GT3A 4Z5TC 4Z66A 3AZLA 4LD9A 1Q9CA 5AV8B 4J8UB 4E45A 3AZNB 2Y2GA 5B31G 5CPJC 1ZLAA 2YFWA 3V9RA 1AOIB 3UTAC 1S32C 3EG5B 5G49B 5AV9B 2G5IC 1KX4A 3AV1B 4CSRA 3AYWA 3AN2D 4JJNB 5F99B 1EQZD 1F66C 2L5AA 4DQYB 3LELC 3VH5W 2YFVA 4UPKA 2BG1A 2FJ7B 4WZSB 3AZKB 5AVBB 2HIOD 5E5AB 3MGQC 2NQBD 2RIQA 1F1EA 4WU9C 1M19C 5DNNA 4YS3A 3KXBA 4QLCC 3WA9A 2ZY3A 1M18B 2Y2QA 5AV6D 5CPJB 4KGCA 3MGPD 4NE6A 3AZMA 1P3BC 3AZIA 3UTAB 1TZYD 1S32B 4ZUXA 3AZEA 2Y2NA 3W96D 4NE5A 1TAFB 3REKD 3X1TC 2BYMA 1B67A 5GT0A 3EPKA 1EQZC 1KX5A 4WJ3C 5B0ZA 3X1SD 1BH8B 5B2ID 1P3KC 3RELA 3X1UC 2HIOC 5JA4B 3MGQB 3C1CD 1P3PD 2NQBC 4WU9B 5GXQC 1M19B 3X1VA 1P34C 4XUJD 2ZY4A 2CWEA 4QLCB 4J8XC 5AV6C 1ID3C 4H9SC 1P3BB 4J8WC 5CPIC 2AROA 3B0CT 5B0YD 3W96C 3MGSA 3UT9C 5CPKB 5B32D 3X1TB 5CP6C 3KUYD 5BS7A 5B33C 3WKJB 4YM6C 1HTAA 4H9QB 3X1SC 1P3KB 5B2IC 4X23A 3X1UB 4XZQD 2HIOB 3B6GB 5KDMA 2DQNC 3C1CC 3REHB 1KX3B 5AV8D 4KUDC 5AY8C 5GXQB 4J8UD 1HQ3A 1P34B 3AZND 5B24C 1P3MC
chains in the Genus database with same CATH topology
5B1MC 4J8XB 3AZFA 2CV5A 2F8NG 3VH6A 3C1BA 5AV6B 1ID3B 3MNNC 1P3GD 1AOID 4J8WB 5CPIB 2PYOC 1M1AA 5AV9D 3EPJA 3LJAC 3UT9B 3AV1D 2IO5C 5B32C 4JJND 5F99D 4EO5C 5CP6B 4R8PA 5B33B 3KUYC 5BNVA 4YM6B 3AZJA 2FJ7D 5AV5C 4H9RB 3AZKD 2Y2IA 5AVBD 5E5AD 5B2IB 1P3FA 3WTPA 3WAAA 3MVDA 4XZQC 4KHAA 1U35A 1P3OB 5AY8B 4KUDB 3O62C 2Y2HA 2F2AC 5B24B 1M18D 1P3MB 5B1MB 4J8UA 4UUZA 3UTBA 4H9NA 3MNNB 3UTAD 4WU8A 1S32D 1P3GC 1P3IC 2PYOB 3KWQA 3H0RC 3LJAB 3AZHA 5JRGA 2IO5B 3W98A 3W99A 4EO5B 5FUGB 1N1JA 3REIA 1BH9A 3AZGA 1WWSA 3LZ0C 3LZ1A 5AV5B 3AFAA 3B6FC 5BNXB 4XZQB 5B1LC 4WU9D 1M19D 5B40B 3A6NA 3O62B 3VH6T 2F8NK 3H0LC 3VH5A 4Z5TA 4QLCD 3MGRB 4ZBJC 1M18C 2G5HC 2NZDC 1H3OB 1P3BD 3AV2A 1P3GB 1P3IB 5CPJA 5BO0B 5CPKD 2F8NB 1P3AC 3X1TD 4J8VA 3WKJD 3NQJA 5GT3C 3AZLC 4Z66C 4LD9C 3LZ0B 2HUEC 4CAYB 5B2JA 1P3KD 1F66A 3LELA 3FDDA 3B6FB 3X1UD 3REJD 4H9OA 3B6GD 2JE5A 3REHD 1KX3D 1ZLAC 5B1LB 2FFFB 3KSYA 5GXQD 5AVCB 1P34D 1P3LA 3MGQA 1JFIB 4J8XD 4ZBJB 1ID3D 3AYWC 2NZDB 2BYKB 4J8WD 4WNNB 5CPID 3UT9D 5B31C 5CPKC 1P3AB 3R45A 5DNMC 4HGAC 5CP6D 5B33D 1A7WA 3WKJC 5GT3B 4Z2MH 4Z66B 3AZLB 4LD9B 4YM6D 2HUEB 5DNNC 4YS3C 3AN2A 1EQZA 2W8SA 3WA9C 1BFMA 3REJC 3B6GC 1ZLAB 3VH5T 3REHC 1KX3C 2YFWB 5AY8D 3V9RB 1P3OD 4KGCC 4KUDD 3AZMC 3AZIC 2HIOA 5B24D 4ZUXC 1P3MD 2NQBA 3AZEC 5B1MD 4NE3A 5GSUC 1KX4B 3AYWB 4WV4B 3MNND 3H0MC 5GT0C 5AV6A 1KU5A 5B0ZC 2PYOD 3LJAD 2YFVB 3MGPA 5B31B 3RELC 5DNMB 1TZYA 4HGAB 4DRAA 3W96A 3REKA 3IP4C 3X1VC 5DNNB 5AV5D 4YS3B 3KXBB 3WA9B 1PZRA 4YM6A 3P5JB 3REJB 3X1SA 5B40D 4KGCB 5B2IA 3O62D 1P3OC 3TU4D 3AZMB 3AZIB 4ZUXB 3MGRD 3C1CA 3AZEB 1P3PA 5GSUB 2BYMB 4XUJA 4E44A 2DF4C 5BS7C 5GT0B 1P3ID 5B0ZB 2F8ND 3W97D 2ZY2A 4H9PA 3RELB 4G91C 5B0YA 5C3IC 3LZ0D 5B32A 4AWLC 1HQ3C 3X1VB 3NQUA 3KUYA 3B6FD 4NFTA 3A1KA 1ULYA 3AZFC 2CV5C 3C1BC 5B1LD 3B0DC 5AV5A 5AVCD 5BNXA 5B40C 3TU4C 4XZQA 2AROB 3MGRC 3MGSB 5AV8A 2NZDD 3AZNA 3AZJC 1P3AD 3W97C 1AOIA 1P3GA 1P3FC 2UWXA 3WTPC 3WAAC 4X23B 3MVDC 5GT3D 3AZLD 5G49A 4G91B 5KDMB 4Z66D 4LD9D 5AV9A 1U35C 5C3IB 3AV1A 4AWLB 1HQ3B 4JJNA 5F99A 1B6WA 3AZFB 2CV5B 3LZ0A 1ZLAD 3C1BB 3B0DB 3UTBC 2FJ7A 5AVCC 3AZKA 5AVBA 5E5AA 4WU8C 3EPLA 3TU4B 3KWQC 1M1AB 3AZHC 1KX4D 3AYWD 2Y2OA 3W98C 5BT1C 2ZM5A 1M18A 1T3UA 3AZGC 5BNVB 5B31D 3AZJB 3W97B 5DNMD 3AFAC 1Z2CB 3UTAA 1S32A 1P3FB 3WTPB 3WAAB 1WWIA 2Y2PA 3MVDB 1TAFA 4KHAB 1U35B 3A6NC 3F6TA 5DNND 4YS3D 3KXBD 3WA9D 3EPHA 4UUZB 4KGCD 1BH8A 3UTBB 3AZMD 4H9NB 3AZID 3KFUG 3AV2C 4WU8B 5JA4A 4ZUXD 3AZED 3WTPE 4WU9A 3KWQB 5GSUD 1M19A 3AZHB 4J8VC 5JRGB 1KX4C 3W98B 3W99B 5GT0D 3AL0C 4QLCA 1N1JB 3REIB 1BH9B 3AZGB 1KX5D 5B0ZD 4M6BA 3LZ1B 5B2JC 3RELD 1P3BA 3AFAB 2Y2LA 2XD1A 5B31A 5CPKA 2F8NH 5DNMA 3A6NB 3X1TA 3X1VD 1P3LC 3WKJA 4Z5TB 3KXBC 4H9QA 1P3KA 2RVQD 3X1UA 3REJA 3AV2B 3B6GA 3B0CW 2AROD 3REHA 3MGSD 1KX3A 5GXQA 1P34A 4J8VB 2Y2MA 2JSSA 4CSRB 3NQJB 4J8XA 5GSUA 1KX5C 1ID3A 4H9SA 3AN2C 5B2JB 1F66B 3LELB 4X23D 1R4VA 4J8WA 2XD5A 4H9OB 5CPIA 2J8PA 3UT9A 1W2EA 1HQ3D 1P3LB 5CP6A 5B33A 3AZFD 2CV5D 3C1BD 4H9RA 2RVQC 5B32G 1M1AD 2AROC 3MGPC 3MGSC 5AY8A 5CHLB 1P3OA 4KUDA 3R45B 5B24A 1TZYC 4R8PD 2VQRA 1P3MA 5B1MA 3REKC 1KX5B 3AZJD 3AN2B 3MNNA 1EQZB 3B0BA 1P3FD 3WTPD 3WAAD 2JCHA 4X23C 3MVDD 2PYOA 1U35D 3LJAA 5FUGA 1P3PC 2NQBB 3UTBD 4XUJC 4WU8D 4Z2MG 3KWQD 5B40A 3AZHD 3MGPB 1M1AC 5JRGD 3O62A 3TU4A 3W98D 5BT1D 3W99D 4G92C 1TZYB 4R8PC 3MGRA 3REID 5B0YC 3AZGD 3W96B 2Y2JA 3REKB 3LZ1D 2Y2KA 1H3OA 3AFAD 4DRBA 1P3IA 5BO0A 2F8NA 3W97A 3X1SB 3A6ND 3VH6W 3A1IA 4Z5TD 1P3PB 3C1CB 5AV8C 4J8UC 4CAYA 3AZNC 4XUJB 3B6FA 3AV2D 5CPJD 5B1LA 5AVCA 4J8VD 1AOIC 4H9PB 5JRGC 1JFIA 4G92B 3W99C 4R8PB 2LY8A 5B0YB 5AV9C 3REIC 5B32B 3AV1C 5B2JD 4JJNC 5F99C 3NQUB 3LZ1C 1F66D 2ZY5A 3LELD 2NZDA 3KUYB 2BYKA 4WNNA 2FJ7C 1P3AA 1P3LD 3AZKC 5AVBC 5E5AC 3MGQD 5GT3A 4Z5TC 4Z66A 3AZLA 4LD9A 1Q9CA 5AV8B 4J8UB 4E45A 3AZNB 2Y2GA 5B31G 5CPJC 1ZLAA 2YFWA 3V9RA 1AOIB 3UTAC 1S32C 3EG5B 5G49B 5AV9B 2G5IC 1KX4A 3AV1B 4CSRA 3AYWA 3AN2D 4JJNB 5F99B 1EQZD 1F66C 2L5AA 4DQYB 3LELC 3VH5W 2YFVA 4UPKA 2BG1A 2FJ7B 4WZSB 3AZKB 5AVBB 2HIOD 5E5AB 3MGQC 2NQBD 2RIQA 1F1EA 4WU9C 1M19C 5DNNA 4YS3A 3KXBA 4QLCC 3WA9A 2ZY3A 1M18B 2Y2QA 5AV6D 5CPJB 4KGCA 3MGPD 4NE6A 3AZMA 1P3BC 3AZIA 3UTAB 1TZYD 1S32B 4ZUXA 3AZEA 2Y2NA 3W96D 4NE5A 1TAFB 3REKD 3X1TC 2BYMA 1B67A 5GT0A 3EPKA 1EQZC 1KX5A 4WJ3C 5B0ZA 3X1SD 1BH8B 5B2ID 1P3KC 3RELA 3X1UC 2HIOC 5JA4B 3MGQB 3C1CD 1P3PD 2NQBC 4WU9B 5GXQC 1M19B 3X1VA 1P34C 4XUJD 2ZY4A 2CWEA 4QLCB 4J8XC 5AV6C 1ID3C 4H9SC 1P3BB 4J8WC 5CPIC 2AROA 3B0CT 5B0YD 3W96C 3MGSA 3UT9C 5CPKB 5B32D 3X1TB 5CP6C 3KUYD 5BS7A 5B33C 3WKJB 4YM6C 1HTAA 4H9QB 3X1SC 1P3KB 5B2IC 4X23A 3X1UB 4XZQD 2HIOB 3B6GB 5KDMA 2DQNC 3C1CC 3REHB 1KX3B 5AV8D 4KUDC 5AY8C 5GXQB 4J8UD 1HQ3A 1P34B 3AZND 5B24C 1P3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M C;  4J8X B;  3AZF A;  2CV5 A;  2F8N G;  3VH6 A;  3C1B A;  5AV6 B;  1ID3 B;  3MNN C;  1P3G D;  1AOI D;  4J8W B;  5CPI B;  2PYO C;  1M1A A;  5AV9 D;  3LJA C;  3UT9 B;  3AV1 D;  2IO5 C;  5B32 C;  4JJN D;  5F99 D;  4EO5 C;  5CP6 B;  4R8P A;  5B33 B;  3KUY C;  5BNV A;  4YM6 B;  3AZJ A;  2FJ7 D;  5AV5 C;  4H9R B;  3AZK D;  5AVB D;  5E5A D;  5B2I B;  1P3F A;  3WTP A;  3WAA A;  3MVD A;  4XZQ C;  4KHA A;  1U35 A;  1P3O B;  5AY8 B;  4KUD B;  3O62 C;  5B24 B;  1M18 D;  1P3M B;  5B1M B;  4J8U A;  4UUZ A;  3UTB A;  4H9N A;  3MNN B;  3UTA D;  4WU8 A;  1S32 D;  1P3G C;  1P3I C;  2PYO B;  3KWQ A;  3LJA B;  3AZH A;  5JRG A;  2IO5 B;  3W98 A;  3W99 A;  4EO5 B;  5FUG B;  1N1J A;  3REI A;  1BH9 A;  3AZG A;  1WWS A;  3LZ0 C;  3LZ1 A;  5AV5 B;  3AFA A;  3B6F C;  5BNX B;  4XZQ B;  5B1L C;  4WU9 D;  1M19 D;  5B40 B;  3A6N A;  3O62 B;  3VH6 T;  2F8N K;  3VH5 A;  4Z5T A;  4QLC D;  3MGR B;  4ZBJ C;  1M18 C;  2NZD C;  1H3O B;  1P3B D;  3AV2 A;  1P3G B;  1P3I B;  5CPJ A;  5BO0 B;  5CPK D;  2F8N B;  1P3A C;  3X1T D;  4J8V A;  3WKJ D;  3NQJ A;  5GT3 C;  3AZL C;  4Z66 C;  4LD9 C;  3LZ0 B;  2HUE C;  4CAY B;  5B2J A;  1P3K D;  1F66 A;  3LEL A;  3B6F B;  3X1U D;  3REJ D;  4H9O A;  3B6G D;  3REH D;  1KX3 D;  1ZLA C;  5B1L B;  3KSY A;  5GXQ D;  5AVC B;  1P34 D;  1P3L A;  3MGQ A;  1JFI B;  4J8X D;  4ZBJ B;  1ID3 D;  3AYW C;  2NZD B;  2BYK B;  4J8W D;  4WNN B;  5CPI D;  3UT9 D;  5B31 C;  5CPK C;  1P3A B;  3R45 A;  5DNM C;  4HGA C;  5CP6 D;  5B33 D;  1A7W A;  3WKJ C;  5GT3 B;  4Z2M H;  4Z66 B;  3AZL B;  4LD9 B;  4YM6 D;  2HUE B;  5DNN C;  4YS3 C;  3AN2 A;  1EQZ A;  3WA9 C;  1BFM A;  3REJ C;  3B6G C;  1ZLA B;  3VH5 T;  3REH C;  1KX3 C;  2YFW B;  5AY8 D;  3V9R B;  1P3O D;  4KGC C;  4KUD D;  3AZM C;  3AZI C;  5B24 D;  2HIO A;  4ZUX C;  1P3M D;  2NQB A;  3AZE C;  5B1M D;  4NE3 A;  5GSU C;  1KX4 B;  3AYW B;  4WV4 B;  3MNN D;  5GT0 C;  5AV6 A;  1KU5 A;  5B0Z C;  2PYO D;  3LJA D;  2YFV B;  3MGP A;  5B31 B;  3REL C;  5DNM B;  1TZY A;  4HGA B;  4DRA A;  3W96 A;  3REK A;  3X1V C;  5DNN B;  5AV5 D;  4YS3 B;  3KXB B;  3WA9 B;  4YM6 A;  3REJ B;  3X1S A;  5B40 D;  4KGC B;  5B2I A;  3O62 D;  1P3O C;  3TU4 D;  3AZM B;  3AZI B;  4ZUX B;  3MGR D;  3C1C A;  3AZE B;  1P3P A;  5GSU B;  2BYM B;  4XUJ A;  4E44 A;  5BS7 C;  5GT0 B;  1P3I D;  5B0Z B;  2F8N D;  3W97 D;  4H9P A;  3REL B;  4G91 C;  5B0Y A;  5C3I C;  3LZ0 D;  5B32 A;  4AWL C;  1HQ3 C;  3X1V B;  3NQU A;  3KUY A;  3B6F D;  4NFT A;  1ULY A;  3AZF C;  2CV5 C;  3C1B C;  5B1L D;  3B0D C;  5AV5 A;  5AVC D;  5BNX A;  5B40 C;  3TU4 C;  4XZQ A;  2ARO B;  3MGR C;  3MGS B;  5AV8 A;  2NZD D;  3AZN A;  3AZJ C;  1P3A D;  3W97 C;  1AOI A;  1P3G A;  1P3F C;  3WTP C;  3WAA C;  4X23 B;  3MVD C;  5GT3 D;  3AZL D;  5G49 A;  4G91 B;  5KDM B;  4Z66 D;  4LD9 D;  5AV9 A;  1U35 C;  5C3I B;  3AV1 A;  4AWL B;  1HQ3 B;  4JJN A;  5F99 A;  1B6W A;  3AZF B;  2CV5 B;  3LZ0 A;  1ZLA D;  3C1B B;  3B0D B;  3UTB C;  2FJ7 A;  5AVC C;  3AZK A;  5AVB A;  5E5A A;  4WU8 C;  3TU4 B;  3KWQ C;  1M1A B;  3AZH C;  1KX4 D;  3AYW D;  3W98 C;  5BT1 C;  1M18 A;  3AZG C;  5BNV B;  5B31 D;  3AZJ B;  3W97 B;  5DNM D;  3AFA C;  3UTA A;  1S32 A;  1P3F B;  3WTP B;  3WAA B;  1WWI A;  3MVD B;  1TAF A;  4KHA B;  1U35 B;  3A6N C;  5DNN D;  4YS3 D;  3KXB D;  3WA9 D;  4UUZ B;  4KGC D;  1BH8 A;  3UTB B;  3AZM D;  4H9N B;  3AZI D;  3AV2 C;  4WU8 B;  5JA4 A;  4ZUX D;  3AZE D;  3WTP E;  4WU9 A;  3KWQ B;  5GSU D;  1M19 A;  3AZH B;  4J8V C;  5JRG B;  1KX4 C;  3W98 B;  3W99 B;  5GT0 D;  4QLC A;  1N1J B;  3REI B;  1BH9 B;  3AZG B;  1KX5 D;  5B0Z D;  4M6B A;  3LZ1 B;  5B2J C;  3REL D;  1P3B A;  3AFA B;  5B31 A;  5CPK A;  2F8N H;  5DNM A;  3A6N B;  3X1T A;  3X1V D;  1P3L C;  3WKJ A;  4Z5T B;  3KXB C;  4H9Q A;  1P3K A;  2RVQ D;  3X1U A;  3REJ A;  3AV2 B;  3B6G A;  3B0C W;  2ARO D;  3REH A;  3MGS D;  1KX3 A;  5GXQ A;  1P34 A;  4J8V B;  2JSS A;  4CSR B;  3NQJ B;  4J8X A;  5GSU A;  1KX5 C;  1ID3 A;  4H9S A;  3AN2 C;  5B2J B;  1F66 B;  3LEL B;  4X23 D;  1R4V A;  4J8W A;  4H9O B;  5CPI A;  3UT9 A;  1HQ3 D;  1P3L B;  5CP6 A;  5B33 A;  3AZF D;  2CV5 D;  3C1B D;  4H9R A;  2RVQ C;  5B32 G;  1M1A D;  2ARO C;  3MGP C;  3MGS C;  5AY8 A;  5CHL B;  1P3O A;  4KUD A;  3R45 B;  5B24 A;  1TZY C;  4R8P D;  1P3M A;  5B1M A;  3REK C;  1KX5 B;  3AZJ D;  3AN2 B;  3MNN A;  1EQZ B;  3B0B A;  1P3F D;  3WTP D;  3WAA D;  4X23 C;  3MVD D;  2PYO A;  1U35 D;  3LJA A;  5FUG A;  1P3P C;  2NQB B;  3UTB D;  4XUJ C;  4WU8 D;  4Z2M G;  3KWQ D;  5B40 A;  3AZH D;  3MGP B;  1M1A C;  5JRG D;  3O62 A;  3TU4 A;  3W98 D;  5BT1 D;  3W99 D;  4G92 C;  1TZY B;  4R8P C;  3MGR A;  3REI D;  5B0Y C;  3AZG D;  3W96 B;  3REK B;  3LZ1 D;  1H3O A;  3AFA D;  4DRB A;  1P3I A;  5BO0 A;  2F8N A;  3W97 A;  3X1S B;  3A6N D;  3VH6 W;  4Z5T D;  1P3P B;  3C1C B;  5AV8 C;  4J8U C;  4CAY A;  3AZN C;  4XUJ B;  3B6F A;  3AV2 D;  5CPJ D;  5B1L A;  5AVC A;  4J8V D;  1AOI C;  4H9P B;  5JRG C;  1JFI A;  4G92 B;  3W99 C;  4R8P B;  2LY8 A;  5B0Y B;  5AV9 C;  3REI C;  5B32 B;  3AV1 C;  5B2J D;  4JJN C;  5F99 C;  3NQU B;  3LZ1 C;  1F66 D;  3LEL D;  2NZD A;  3KUY B;  2BYK A;  4WNN A;  2FJ7 C;  1P3A A;  1P3L D;  3AZK C;  5AVB C;  5E5A C;  3MGQ D;  5GT3 A;  4Z5T C;  4Z66 A;  3AZL A;  4LD9 A;  1Q9C A;  5AV8 B;  4J8U B;  4E45 A;  3AZN B;  5B31 G;  5CPJ C;  1ZLA A;  2YFW A;  3V9R A;  1AOI B;  3UTA C;  1S32 C;  5G49 B;  5AV9 B;  1KX4 A;  3AV1 B;  4CSR A;  3AYW A;  3AN2 D;  4JJN B;  5F99 B;  1EQZ D;  1F66 C;  2L5A A;  3LEL C;  3VH5 W;  2YFV A;  2FJ7 B;  4WZS B;  3AZK B;  2HIO D;  5E5A B;  5AVB B;  3MGQ C;  2NQB D;  1F1E A;  4WU9 C;  1M19 C;  5DNN A;  4YS3 A;  3KXB A;  4QLC C;  3WA9 A;  1M18 B;  5AV6 D;  5CPJ B;  4KGC A;  3MGP D;  4NE6 A;  3AZM A;  1P3B C;  3AZI A;  3UTA B;  1TZY D;  1S32 B;  4ZUX A;  3AZE A;  3W96 D;  4NE5 A;  1TAF B;  3REK D;  3X1T C;  2BYM A;  1B67 A;  5GT0 A;  1EQZ C;  1KX5 A;  5B0Z A;  3X1S D;  1BH8 B;  5B2I D;  1P3K C;  3REL A;  3X1U C;  2HIO C;  5JA4 B;  3MGQ B;  3C1C D;  1P3P D;  2NQB C;  4WU9 B;  5GXQ C;  1M19 B;  3X1V A;  1P34 C;  4XUJ D;  2CWE A;  4QLC B;  4J8X C;  5AV6 C;  1ID3 C;  4H9S C;  1P3B B;  4J8W C;  5CPI C;  2ARO A;  3B0C T;  5B0Y D;  3W96 C;  3MGS A;  3UT9 C;  5CPK B;  5B32 D;  3X1T B;  5CP6 C;  3KUY D;  5BS7 A;  5B33 C;  3WKJ B;  4YM6 C;  1HTA A;  4H9Q B;  3X1S C;  1P3K B;  5B2I C;  4X23 A;  3X1U B;  4XZQ D;  2HIO B;  3B6G B;  5KDM A;  3C1C C;  3REH B;  1KX3 B;  5AV8 D;  4KUD C;  5AY8 C;  5GXQ B;  4J8U D;  1HQ3 A;  1P34 B;  3AZN D;  5B24 C;  1P3M C; 
#chains in the Genus database with same CATH topology
 5B1M C;  4J8X B;  3AZF A;  2CV5 A;  2F8N G;  3VH6 A;  3C1B A;  5AV6 B;  1ID3 B;  3MNN C;  1P3G D;  1AOI D;  4J8W B;  5CPI B;  2PYO C;  1M1A A;  5AV9 D;  3EPJ A;  3LJA C;  3UT9 B;  3AV1 D;  2IO5 C;  5B32 C;  4JJN D;  5F99 D;  4EO5 C;  5CP6 B;  4R8P A;  5B33 B;  3KUY C;  5BNV A;  4YM6 B;  3AZJ A;  2FJ7 D;  5AV5 C;  4H9R B;  3AZK D;  2Y2I A;  5AVB D;  5E5A D;  5B2I B;  1P3F A;  3WTP A;  3WAA A;  3MVD A;  4XZQ C;  4KHA A;  1U35 A;  1P3O B;  5AY8 B;  4KUD B;  3O62 C;  2Y2H A;  2F2A C;  5B24 B;  1M18 D;  1P3M B;  5B1M B;  4J8U A;  4UUZ A;  3UTB A;  4H9N A;  3MNN B;  3UTA D;  4WU8 A;  1S32 D;  1P3G C;  1P3I C;  2PYO B;  3KWQ A;  3H0R C;  3LJA B;  3AZH A;  5JRG A;  2IO5 B;  3W98 A;  3W99 A;  4EO5 B;  5FUG B;  1N1J A;  3REI A;  1BH9 A;  3AZG A;  1WWS A;  3LZ0 C;  3LZ1 A;  5AV5 B;  3AFA A;  3B6F C;  5BNX B;  4XZQ B;  5B1L C;  4WU9 D;  1M19 D;  5B40 B;  3A6N A;  3O62 B;  3VH6 T;  2F8N K;  3H0L C;  3VH5 A;  4Z5T A;  4QLC D;  3MGR B;  4ZBJ C;  1M18 C;  2G5H C;  2NZD C;  1H3O B;  1P3B D;  3AV2 A;  1P3G B;  1P3I B;  5CPJ A;  5BO0 B;  5CPK D;  2F8N B;  1P3A C;  3X1T D;  4J8V A;  3WKJ D;  3NQJ A;  5GT3 C;  3AZL C;  4Z66 C;  4LD9 C;  3LZ0 B;  2HUE C;  4CAY B;  5B2J A;  1P3K D;  1F66 A;  3LEL A;  3FDD A;  3B6F B;  3X1U D;  3REJ D;  4H9O A;  3B6G D;  2JE5 A;  3REH D;  1KX3 D;  1ZLA C;  5B1L B;  2FFF B;  3KSY A;  5GXQ D;  5AVC B;  1P34 D;  1P3L A;  3MGQ A;  1JFI B;  4J8X D;  4ZBJ B;  1ID3 D;  3AYW C;  2NZD B;  2BYK B;  4J8W D;  4WNN B;  5CPI D;  3UT9 D;  5B31 C;  5CPK C;  1P3A B;  3R45 A;  5DNM C;  4HGA C;  5CP6 D;  5B33 D;  1A7W A;  3WKJ C;  5GT3 B;  4Z2M H;  4Z66 B;  3AZL B;  4LD9 B;  4YM6 D;  2HUE B;  5DNN C;  4YS3 C;  3AN2 A;  1EQZ A;  2W8S A;  3WA9 C;  1BFM A;  3REJ C;  3B6G C;  1ZLA B;  3VH5 T;  3REH C;  1KX3 C;  2YFW B;  5AY8 D;  3V9R B;  1P3O D;  4KGC C;  4KUD D;  3AZM C;  3AZI C;  2HIO A;  5B24 D;  4ZUX C;  1P3M D;  2NQB A;  3AZE C;  5B1M D;  4NE3 A;  5GSU C;  1KX4 B;  3AYW B;  4WV4 B;  3MNN D;  3H0M C;  5GT0 C;  5AV6 A;  1KU5 A;  5B0Z C;  2PYO D;  3LJA D;  2YFV B;  3MGP A;  5B31 B;  3REL C;  5DNM B;  1TZY A;  4HGA B;  4DRA A;  3W96 A;  3REK A;  3IP4 C;  3X1V C;  5DNN B;  5AV5 D;  4YS3 B;  3KXB B;  3WA9 B;  1PZR A;  4YM6 A;  3P5J B;  3REJ B;  3X1S A;  5B40 D;  4KGC B;  5B2I A;  3O62 D;  1P3O C;  3TU4 D;  3AZM B;  3AZI B;  4ZUX B;  3MGR D;  3C1C A;  3AZE B;  1P3P A;  5GSU B;  2BYM B;  4XUJ A;  4E44 A;  2DF4 C;  5BS7 C;  5GT0 B;  1P3I D;  5B0Z B;  2F8N D;  3W97 D;  2ZY2 A;  4H9P A;  3REL B;  4G91 C;  5B0Y A;  5C3I C;  3LZ0 D;  5B32 A;  4AWL C;  1HQ3 C;  3X1V B;  3NQU A;  3KUY A;  3B6F D;  4NFT A;  3A1K A;  1ULY A;  3AZF C;  2CV5 C;  3C1B C;  5B1L D;  3B0D C;  5AV5 A;  5AVC D;  5BNX A;  5B40 C;  3TU4 C;  4XZQ A;  2ARO B;  3MGR C;  3MGS B;  5AV8 A;  2NZD D;  3AZN A;  3AZJ C;  1P3A D;  3W97 C;  1AOI A;  1P3G A;  1P3F C;  2UWX A;  3WTP C;  3WAA C;  4X23 B;  3MVD C;  5GT3 D;  3AZL D;  5G49 A;  4G91 B;  5KDM B;  4Z66 D;  4LD9 D;  5AV9 A;  1U35 C;  5C3I B;  3AV1 A;  4AWL B;  1HQ3 B;  4JJN A;  5F99 A;  1B6W A;  3AZF B;  2CV5 B;  3LZ0 A;  1ZLA D;  3C1B B;  3B0D B;  3UTB C;  2FJ7 A;  5AVC C;  3AZK A;  5AVB A;  5E5A A;  4WU8 C;  3EPL A;  3TU4 B;  3KWQ C;  1M1A B;  3AZH C;  1KX4 D;  3AYW D;  2Y2O A;  3W98 C;  5BT1 C;  2ZM5 A;  1M18 A;  1T3U A;  3AZG C;  5BNV B;  5B31 D;  3AZJ B;  3W97 B;  5DNM D;  3AFA C;  1Z2C B;  3UTA A;  1S32 A;  1P3F B;  3WTP B;  3WAA B;  1WWI A;  2Y2P A;  3MVD B;  1TAF A;  4KHA B;  1U35 B;  3A6N C;  3F6T A;  5DNN D;  4YS3 D;  3KXB D;  3WA9 D;  3EPH A;  4UUZ B;  4KGC D;  1BH8 A;  3UTB B;  3AZM D;  4H9N B;  3AZI D;  3KFU G;  3AV2 C;  4WU8 B;  5JA4 A;  4ZUX D;  3AZE D;  3WTP E;  4WU9 A;  3KWQ B;  5GSU D;  1M19 A;  3AZH B;  4J8V C;  5JRG B;  1KX4 C;  3W98 B;  3W99 B;  5GT0 D;  3AL0 C;  4QLC A;  1N1J B;  3REI B;  1BH9 B;  3AZG B;  1KX5 D;  5B0Z D;  4M6B A;  3LZ1 B;  5B2J C;  3REL D;  1P3B A;  3AFA B;  2Y2L A;  2XD1 A;  5B31 A;  5CPK A;  2F8N H;  5DNM A;  3A6N B;  3X1T A;  3X1V D;  1P3L C;  3WKJ A;  4Z5T B;  3KXB C;  4H9Q A;  1P3K A;  2RVQ D;  3X1U A;  3REJ A;  3AV2 B;  3B6G A;  3B0C W;  2ARO D;  3REH A;  3MGS D;  1KX3 A;  5GXQ A;  1P34 A;  4J8V B;  2Y2M A;  2JSS A;  4CSR B;  3NQJ B;  4J8X A;  5GSU A;  1KX5 C;  1ID3 A;  4H9S A;  3AN2 C;  5B2J B;  1F66 B;  3LEL B;  4X23 D;  1R4V A;  4J8W A;  2XD5 A;  4H9O B;  5CPI A;  2J8P A;  3UT9 A;  1W2E A;  1HQ3 D;  1P3L B;  5CP6 A;  5B33 A;  3AZF D;  2CV5 D;  3C1B D;  4H9R A;  2RVQ C;  5B32 G;  1M1A D;  2ARO C;  3MGP C;  3MGS C;  5AY8 A;  5CHL B;  1P3O A;  4KUD A;  3R45 B;  5B24 A;  1TZY C;  4R8P D;  2VQR A;  1P3M A;  5B1M A;  3REK C;  1KX5 B;  3AZJ D;  3AN2 B;  3MNN A;  1EQZ B;  3B0B A;  1P3F D;  3WTP D;  3WAA D;  2JCH A;  4X23 C;  3MVD D;  2PYO A;  1U35 D;  3LJA A;  5FUG A;  1P3P C;  2NQB B;  3UTB D;  4XUJ C;  4WU8 D;  4Z2M G;  3KWQ D;  5B40 A;  3AZH D;  3MGP B;  1M1A C;  5JRG D;  3O62 A;  3TU4 A;  3W98 D;  5BT1 D;  3W99 D;  4G92 C;  1TZY B;  4R8P C;  3MGR A;  3REI D;  5B0Y C;  3AZG D;  3W96 B;  2Y2J A;  3REK B;  3LZ1 D;  2Y2K A;  1H3O A;  3AFA D;  4DRB A;  1P3I A;  5BO0 A;  2F8N A;  3W97 A;  3X1S B;  3A6N D;  3VH6 W;  3A1I A;  4Z5T D;  1P3P B;  3C1C B;  5AV8 C;  4J8U C;  4CAY A;  3AZN C;  4XUJ B;  3B6F A;  3AV2 D;  5CPJ D;  5B1L A;  5AVC A;  4J8V D;  1AOI C;  4H9P B;  5JRG C;  1JFI A;  4G92 B;  3W99 C;  4R8P B;  2LY8 A;  5B0Y B;  5AV9 C;  3REI C;  5B32 B;  3AV1 C;  5B2J D;  4JJN C;  5F99 C;  3NQU B;  3LZ1 C;  1F66 D;  2ZY5 A;  3LEL D;  2NZD A;  3KUY B;  2BYK A;  4WNN A;  2FJ7 C;  1P3A A;  1P3L D;  3AZK C;  5AVB C;  5E5A C;  3MGQ D;  5GT3 A;  4Z5T C;  4Z66 A;  3AZL A;  4LD9 A;  1Q9C A;  5AV8 B;  4J8U B;  4E45 A;  3AZN B;  2Y2G A;  5B31 G;  5CPJ C;  1ZLA A;  2YFW A;  3V9R A;  1AOI B;  3UTA C;  1S32 C;  3EG5 B;  5G49 B;  5AV9 B;  2G5I C;  1KX4 A;  3AV1 B;  4CSR A;  3AYW A;  3AN2 D;  4JJN B;  5F99 B;  1EQZ D;  1F66 C;  2L5A A;  4DQY B;  3LEL C;  3VH5 W;  2YFV A;  4UPK A;  2BG1 A;  2FJ7 B;  4WZS B;  3AZK B;  5AVB B;  2HIO D;  5E5A B;  3MGQ C;  2NQB D;  2RIQ A;  1F1E A;  4WU9 C;  1M19 C;  5DNN A;  4YS3 A;  3KXB A;  4QLC C;  3WA9 A;  2ZY3 A;  1M18 B;  2Y2Q A;  5AV6 D;  5CPJ B;  4KGC A;  3MGP D;  4NE6 A;  3AZM A;  1P3B C;  3AZI A;  3UTA B;  1TZY D;  1S32 B;  4ZUX A;  3AZE A;  2Y2N A;  3W96 D;  4NE5 A;  1TAF B;  3REK D;  3X1T C;  2BYM A;  1B67 A;  5GT0 A;  3EPK A;  1EQZ C;  1KX5 A;  4WJ3 C;  5B0Z A;  3X1S D;  1BH8 B;  5B2I D;  1P3K C;  3REL A;  3X1U C;  2HIO C;  5JA4 B;  3MGQ B;  3C1C D;  1P3P D;  2NQB C;  4WU9 B;  5GXQ C;  1M19 B;  3X1V A;  1P34 C;  4XUJ D;  2ZY4 A;  2CWE A;  4QLC B;  4J8X C;  5AV6 C;  1ID3 C;  4H9S C;  1P3B B;  4J8W C;  5CPI C;  2ARO A;  3B0C T;  5B0Y D;  3W96 C;  3MGS A;  3UT9 C;  5CPK B;  5B32 D;  3X1T B;  5CP6 C;  3KUY D;  5BS7 A;  5B33 C;  3WKJ B;  4YM6 C;  1HTA A;  4H9Q B;  3X1S C;  1P3K B;  5B2I C;  4X23 A;  3X1U B;  4XZQ D;  2HIO B;  3B6G B;  5KDM A;  2DQN C;  3C1C C;  3REH B;  1KX3 B;  5AV8 D;  4KUD C;  5AY8 C;  5GXQ B;  4J8U D;  1HQ3 A;  1P34 B;  3AZN D;  5B24 C;  1P3M C; 
#chains in the Genus database with same CATH homology
 5B1M C;  4J8X B;  3AZF A;  2CV5 A;  2F8N G;  3VH6 A;  3C1B A;  5AV6 B;  1ID3 B;  3MNN C;  1P3G D;  1AOI D;  4J8W B;  5CPI B;  2PYO C;  1M1A A;  5AV9 D;  3EPJ A;  3LJA C;  3UT9 B;  3AV1 D;  2IO5 C;  5B32 C;  4JJN D;  5F99 D;  4EO5 C;  5CP6 B;  4R8P A;  5B33 B;  3KUY C;  5BNV A;  4YM6 B;  3AZJ A;  2FJ7 D;  5AV5 C;  4H9R B;  3AZK D;  2Y2I A;  5AVB D;  5E5A D;  5B2I B;  1P3F A;  3WTP A;  3WAA A;  3MVD A;  4XZQ C;  4KHA A;  1U35 A;  1P3O B;  5AY8 B;  4KUD B;  3O62 C;  2Y2H A;  2F2A C;  5B24 B;  1M18 D;  1P3M B;  5B1M B;  4J8U A;  4UUZ A;  3UTB A;  4H9N A;  3MNN B;  3UTA D;  4WU8 A;  1S32 D;  1P3G C;  1P3I C;  2PYO B;  3KWQ A;  3H0R C;  3LJA B;  3AZH A;  5JRG A;  2IO5 B;  3W98 A;  3W99 A;  4EO5 B;  5FUG B;  1N1J A;  3REI A;  1BH9 A;  3AZG A;  1WWS A;  3LZ0 C;  3LZ1 A;  5AV5 B;  3AFA A;  3B6F C;  5BNX B;  4XZQ B;  5B1L C;  4WU9 D;  1M19 D;  5B40 B;  3A6N A;  3O62 B;  3VH6 T;  2F8N K;  3H0L C;  3VH5 A;  4Z5T A;  4QLC D;  3MGR B;  4ZBJ C;  1M18 C;  2G5H C;  2NZD C;  1H3O B;  1P3B D;  3AV2 A;  1P3G B;  1P3I B;  5CPJ A;  5BO0 B;  5CPK D;  2F8N B;  1P3A C;  3X1T D;  4J8V A;  3WKJ D;  3NQJ A;  5GT3 C;  3AZL C;  4Z66 C;  4LD9 C;  3LZ0 B;  2HUE C;  4CAY B;  5B2J A;  1P3K D;  1F66 A;  3LEL A;  3FDD A;  3B6F B;  3X1U D;  3REJ D;  4H9O A;  3B6G D;  2JE5 A;  3REH D;  1KX3 D;  1ZLA C;  5B1L B;  2FFF B;  3KSY A;  5GXQ D;  5AVC B;  1P34 D;  1P3L A;  3MGQ A;  1JFI B;  4J8X D;  4ZBJ B;  1ID3 D;  3AYW C;  2NZD B;  2BYK B;  4J8W D;  4WNN B;  5CPI D;  3UT9 D;  5B31 C;  5CPK C;  1P3A B;  3R45 A;  5DNM C;  4HGA C;  5CP6 D;  5B33 D;  1A7W A;  3WKJ C;  5GT3 B;  4Z2M H;  4Z66 B;  3AZL B;  4LD9 B;  4YM6 D;  2HUE B;  5DNN C;  4YS3 C;  3AN2 A;  1EQZ A;  2W8S A;  3WA9 C;  1BFM A;  3REJ C;  3B6G C;  1ZLA B;  3VH5 T;  3REH C;  1KX3 C;  2YFW B;  5AY8 D;  3V9R B;  1P3O D;  4KGC C;  4KUD D;  3AZM C;  3AZI C;  2HIO A;  5B24 D;  4ZUX C;  1P3M D;  2NQB A;  3AZE C;  5B1M D;  4NE3 A;  5GSU C;  1KX4 B;  3AYW B;  4WV4 B;  3MNN D;  3H0M C;  5GT0 C;  5AV6 A;  1KU5 A;  5B0Z C;  2PYO D;  3LJA D;  2YFV B;  3MGP A;  5B31 B;  3REL C;  5DNM B;  1TZY A;  4HGA B;  4DRA A;  3W96 A;  3REK A;  3IP4 C;  3X1V C;  5DNN B;  5AV5 D;  4YS3 B;  3KXB B;  3WA9 B;  1PZR A;  4YM6 A;  3P5J B;  3REJ B;  3X1S A;  5B40 D;  4KGC B;  5B2I A;  3O62 D;  1P3O C;  3TU4 D;  3AZM B;  3AZI B;  4ZUX B;  3MGR D;  3C1C A;  3AZE B;  1P3P A;  5GSU B;  2BYM B;  4XUJ A;  4E44 A;  2DF4 C;  5BS7 C;  5GT0 B;  1P3I D;  5B0Z B;  2F8N D;  3W97 D;  2ZY2 A;  4H9P A;  3REL B;  4G91 C;  5B0Y A;  5C3I C;  3LZ0 D;  5B32 A;  4AWL C;  1HQ3 C;  3X1V B;  3NQU A;  3KUY A;  3B6F D;  4NFT A;  3A1K A;  1ULY A;  3AZF C;  2CV5 C;  3C1B C;  5B1L D;  3B0D C;  5AV5 A;  5AVC D;  5BNX A;  5B40 C;  3TU4 C;  4XZQ A;  2ARO B;  3MGR C;  3MGS B;  5AV8 A;  2NZD D;  3AZN A;  3AZJ C;  1P3A D;  3W97 C;  1AOI A;  1P3G A;  1P3F C;  2UWX A;  3WTP C;  3WAA C;  4X23 B;  3MVD C;  5GT3 D;  3AZL D;  5G49 A;  4G91 B;  5KDM B;  4Z66 D;  4LD9 D;  5AV9 A;  1U35 C;  5C3I B;  3AV1 A;  4AWL B;  1HQ3 B;  4JJN A;  5F99 A;  1B6W A;  3AZF B;  2CV5 B;  3LZ0 A;  1ZLA D;  3C1B B;  3B0D B;  3UTB C;  2FJ7 A;  5AVC C;  3AZK A;  5AVB A;  5E5A A;  4WU8 C;  3EPL A;  3TU4 B;  3KWQ C;  1M1A B;  3AZH C;  1KX4 D;  3AYW D;  2Y2O A;  3W98 C;  5BT1 C;  2ZM5 A;  1M18 A;  1T3U A;  3AZG C;  5BNV B;  5B31 D;  3AZJ B;  3W97 B;  5DNM D;  3AFA C;  1Z2C B;  3UTA A;  1S32 A;  1P3F B;  3WTP B;  3WAA B;  1WWI A;  2Y2P A;  3MVD B;  1TAF A;  4KHA B;  1U35 B;  3A6N C;  3F6T A;  5DNN D;  4YS3 D;  3KXB D;  3WA9 D;  3EPH A;  4UUZ B;  4KGC D;  1BH8 A;  3UTB B;  3AZM D;  4H9N B;  3AZI D;  3KFU G;  3AV2 C;  4WU8 B;  5JA4 A;  4ZUX D;  3AZE D;  3WTP E;  4WU9 A;  3KWQ B;  5GSU D;  1M19 A;  3AZH B;  4J8V C;  5JRG B;  1KX4 C;  3W98 B;  3W99 B;  5GT0 D;  3AL0 C;  4QLC A;  1N1J B;  3REI B;  1BH9 B;  3AZG B;  1KX5 D;  5B0Z D;  4M6B A;  3LZ1 B;  5B2J C;  3REL D;  1P3B A;  3AFA B;  2Y2L A;  2XD1 A;  5B31 A;  5CPK A;  2F8N H;  5DNM A;  3A6N B;  3X1T A;  3X1V D;  1P3L C;  3WKJ A;  4Z5T B;  3KXB C;  4H9Q A;  1P3K A;  2RVQ D;  3X1U A;  3REJ A;  3AV2 B;  3B6G A;  3B0C W;  2ARO D;  3REH A;  3MGS D;  1KX3 A;  5GXQ A;  1P34 A;  4J8V B;  2Y2M A;  2JSS A;  4CSR B;  3NQJ B;  4J8X A;  5GSU A;  1KX5 C;  1ID3 A;  4H9S A;  3AN2 C;  5B2J B;  1F66 B;  3LEL B;  4X23 D;  1R4V A;  4J8W A;  2XD5 A;  4H9O B;  5CPI A;  2J8P A;  3UT9 A;  1W2E A;  1HQ3 D;  1P3L B;  5CP6 A;  5B33 A;  3AZF D;  2CV5 D;  3C1B D;  4H9R A;  2RVQ C;  5B32 G;  1M1A D;  2ARO C;  3MGP C;  3MGS C;  5AY8 A;  5CHL B;  1P3O A;  4KUD A;  3R45 B;  5B24 A;  1TZY C;  4R8P D;  2VQR A;  1P3M A;  5B1M A;  3REK C;  1KX5 B;  3AZJ D;  3AN2 B;  3MNN A;  1EQZ B;  3B0B A;  1P3F D;  3WTP D;  3WAA D;  2JCH A;  4X23 C;  3MVD D;  2PYO A;  1U35 D;  3LJA A;  5FUG A;  1P3P C;  2NQB B;  3UTB D;  4XUJ C;  4WU8 D;  4Z2M G;  3KWQ D;  5B40 A;  3AZH D;  3MGP B;  1M1A C;  5JRG D;  3O62 A;  3TU4 A;  3W98 D;  5BT1 D;  3W99 D;  4G92 C;  1TZY B;  4R8P C;  3MGR A;  3REI D;  5B0Y C;  3AZG D;  3W96 B;  2Y2J A;  3REK B;  3LZ1 D;  2Y2K A;  1H3O A;  3AFA D;  4DRB A;  1P3I A;  5BO0 A;  2F8N A;  3W97 A;  3X1S B;  3A6N D;  3VH6 W;  3A1I A;  4Z5T D;  1P3P B;  3C1C B;  5AV8 C;  4J8U C;  4CAY A;  3AZN C;  4XUJ B;  3B6F A;  3AV2 D;  5CPJ D;  5B1L A;  5AVC A;  4J8V D;  1AOI C;  4H9P B;  5JRG C;  1JFI A;  4G92 B;  3W99 C;  4R8P B;  2LY8 A;  5B0Y B;  5AV9 C;  3REI C;  5B32 B;  3AV1 C;  5B2J D;  4JJN C;  5F99 C;  3NQU B;  3LZ1 C;  1F66 D;  2ZY5 A;  3LEL D;  2NZD A;  3KUY B;  2BYK A;  4WNN A;  2FJ7 C;  1P3A A;  1P3L D;  3AZK C;  5AVB C;  5E5A C;  3MGQ D;  5GT3 A;  4Z5T C;  4Z66 A;  3AZL A;  4LD9 A;  1Q9C A;  5AV8 B;  4J8U B;  4E45 A;  3AZN B;  2Y2G A;  5B31 G;  5CPJ C;  1ZLA A;  2YFW A;  3V9R A;  1AOI B;  3UTA C;  1S32 C;  3EG5 B;  5G49 B;  5AV9 B;  2G5I C;  1KX4 A;  3AV1 B;  4CSR A;  3AYW A;  3AN2 D;  4JJN B;  5F99 B;  1EQZ D;  1F66 C;  2L5A A;  4DQY B;  3LEL C;  3VH5 W;  2YFV A;  4UPK A;  2BG1 A;  2FJ7 B;  4WZS B;  3AZK B;  5AVB B;  2HIO D;  5E5A B;  3MGQ C;  2NQB D;  2RIQ A;  1F1E A;  4WU9 C;  1M19 C;  5DNN A;  4YS3 A;  3KXB A;  4QLC C;  3WA9 A;  2ZY3 A;  1M18 B;  2Y2Q A;  5AV6 D;  5CPJ B;  4KGC A;  3MGP D;  4NE6 A;  3AZM A;  1P3B C;  3AZI A;  3UTA B;  1TZY D;  1S32 B;  4ZUX A;  3AZE A;  2Y2N A;  3W96 D;  4NE5 A;  1TAF B;  3REK D;  3X1T C;  2BYM A;  1B67 A;  5GT0 A;  3EPK A;  1EQZ C;  1KX5 A;  4WJ3 C;  5B0Z A;  3X1S D;  1BH8 B;  5B2I D;  1P3K C;  3REL A;  3X1U C;  2HIO C;  5JA4 B;  3MGQ B;  3C1C D;  1P3P D;  2NQB C;  4WU9 B;  5GXQ C;  1M19 B;  3X1V A;  1P34 C;  4XUJ D;  2ZY4 A;  2CWE A;  4QLC B;  4J8X C;  5AV6 C;  1ID3 C;  4H9S C;  1P3B B;  4J8W C;  5CPI C;  2ARO A;  3B0C T;  5B0Y D;  3W96 C;  3MGS A;  3UT9 C;  5CPK B;  5B32 D;  3X1T B;  5CP6 C;  3KUY D;  5BS7 A;  5B33 C;  3WKJ B;  4YM6 C;  1HTA A;  4H9Q B;  3X1S C;  1P3K B;  5B2I C;  4X23 A;  3X1U B;  4XZQ D;  2HIO B;  3B6G B;  5KDM A;  2DQN C;  3C1C C;  3REH B;  1KX3 B;  5AV8 D;  4KUD C;  5AY8 C;  5GXQ B;  4J8U D;  1HQ3 A;  1P34 B;  3AZN D;  5B24 C;  1P3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...