4J8WD

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-fluorophenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8wD00
5BO0B 1P3PB 5KDMA 5B0YD 2NZDC 1M1AC 2JSSA 5AVBC 2YFWB 4Z5TC 2BYKA 3W97A 5B1MD 3MGSD 1HQ3A 3REIB 3TU4A 3AZHC 4YS3C 3MNNC 4H9NA 4AWLB 1TZYA 1P3KA 5CP6D 4KHAA 5GT3A 4ZBJB 3REID 3KUYA 5AV5C 1P34C 5CPJC 3WKJC 2CV5B 2BYMA 3MGPC 2HIOD 3X1SC 1BH8B 4UUZB 5AVCA 4WU8B 3X1VB 1AOIA 1EQZD 3AZGD 3AZMD 3AV2D 5GSUD 3LZ0D 1P3AA 4WU9B 3KWQA 3LZ1D 4YM6C 4KUDA 1ULYA 3KXBD 3WTPB 3B0BA 3X1VD 3O62A 2FJ7D 1A7WA 5AY8C 3V9RB 4WU9D 5AVCC 5E5AD 1P3FD 1ID3A 3AZFB 5B40D 1P3LD 3KWQC 4JJNA 3B0CT 3W98B 4KGCA 5B32G 4J8WA 5JRGC 2F8NA 1F66A 5AV8C 5B1LB 3AFAB 5AV9C 3AZFD 5DNND 5B32D 1P3GC 1KX5C 4J8UB 3RELA 3AYWB 3MVDA 4XZQB 5DNMB 5F99A 3UTBA 3A6NC 1U35C 1P3MB 2PYOB 4J8XC 1P3BD 5B33B 5B0YA 3B6GA 3UTAA 1M18A 5B31C 3X1UC 1KX4C 3REHC 5CPKB 1ZLAB 5B1MA 3MGSA 1P3MD 2PYOD 5BO0A 1P3PA 1B6WA 1HQ3D 3TU4D 1S32B 1M19B 2YFWA 3X1TB 5BS7C 1P3KD 5B0YC 3REIA 5GT3D 1TAFB 2F8NK 3B6FB 5CPIB 3KUYD 3AZLB 5GSUA 1AOID 4LD9B 1H3OB 2CV5A 1P3AD 5CP6C 5CPID 5B2IC 4KUDD 1BH8A 4WNNB 4UUZA 4WU8A 3MGRC 3X1VA 2IO5B 3B0DC 3REJD 2HIOC 3O62D 4LD9D 4WU9A 3W99B 1Q9CA 1KX3B 3C1CC 1P3FA 1EQZC 4G92B 3AZGC 3AZMC 5GSUC 3LZ0C 3WTPA 3AV2C 5JA4B 1ID3D 5AV6D 3AZKB 3LZ1C 3KXBC 3C1BB 4JJND 3V9RA 4KGCD 3WAAB 4QLCB 4J8WD 1KX3D 4ZUXD 2FJ7C 3AZFA 4H9SA 3W96C 5E5AC 5BNXB 3W98A 5B2JC 3MGQB 4EO5B 3VH6T 5GXQC 3MVDD 5B40C 5F99D 3UTBD 1P3LC 4H9OB 5B1LA 4X23B 4CSRB 3AFAA 4J8UA 3AYWA 1JFIB 4XZQA 4H9PB 5DNMA 5DNNC 3LJAB 5B32C 3B6GD 3UTAD 1M18D 1P3MA 4X23D 2PYOA 3AZIB 3AZJD 5B33A 2HUEC 3REKC 1P3PD 4R8PB 1P3BC 3AV1B 4Z2MG 1ZLAA 5CPKA 3LELB 4H9RA 4CAYB 3WTPE 1S32A 1M19A 4R8PD 1P3OB 3W97C 4J8VB 3X1TA 1HQ3C 5BNVB 3TU4C 3VH5T 3WA9B 1TAFA 3B0CW 3B6FA 5BT1D 5CPIA 1TZYC 2F8NH 1P3KC 2CV5D 3AN2B 5GT3C 3AZLA 1P3OD 4J8VD 3KUYC 4WU8D 3REJA 4LD9A 1H3OA 3WA9D 2NQBB 5G49B 1AOIC 4WNNA 3UT9B 3AZNB 5AV6A 1P3AC 3WTPD 1P3IB 4KUDC 3W99A 4G91B 1KX3A 4ZUXA 2NQBD 4HGAC 3O62C 5GT0B 5JA4A 4Z66B 4XUJB 3AZKA 2AROB 5B0ZB 3C1BA 1P3ID 5B24B 3W98D 1N1JB 4QLCA 3WAAA 1ID3C 5AV6C 4JJNC 3AZEB 5GT0D 4KGCC 5B1LD 4Z66D 4XUJD 4J8WC 3AFAD 5BNXA 4ZUXC 2NZDB 1F66C 3MGQA 4J8UD 3AYWD 5C3IC 1M1AB 5AVBB 4XZQD 5DNMD 4Z5TB 4H9OA 4X23A 4CSRA 1BH9B 3AZED 3RELC 3AZJA 3MVDC 3AZHB 3MNNB 4YS3B 5F99C 3UTBC 1JFIA 4NE3A 4H9PA 5B33D 3NQJB 5AVBD 4DRAA 1ZLAD 5CPKD 3AZIA 5AV5B 1P34B 5CPJB 4YS3D 1KU5A 4WZSB 3B6GC 3WKJB 3UTAC 2RVQD 1M18C 3MGPB 4R8PA 3X1SB 3AV1A 5B1MC 3MGSC 3AZJC 1BFMA 1S32D 3LELA 5FUGB 1M19D 1P3PC 3X1TD 5AV5D 1P34D 4CAYA 4YM6B 3KSYA 3B6FD 1P3OA 4J8VA 3REIC 5BNVA 3AZLD 2BYMB 3R45B 5AY8B 3WA9A 5AVCB 4AWLC 3VH6W 2YFVB 3AN2A 3AZJB 3KWQB 4ZBJC 5BT1C 4E44A 2CV5C 5JRGB 4E45A 5AV8B 2NQBA 5G49A 3W99D 3X1VC 4WU8C 5AV9B 3UT9A 3AZNA 1P3GB 1KX5B 4WU9C 1P3IA 3AZKD 1P3FC 3C1BD 3A6NB 3VH6A 3WTPC 1U35B 3WAAD 4QLCD 5GT0A 4J8XB 4Z66A 4XUJA 2AROA 1P3GD 5B0ZA 1N1JA 5B31B 3A6ND 3MGQD 3X1UB 3AZFC 3REHB 1KX4B 4H9SC 3AZEA 3W98C 3VH5W 2NZDA 1M1AA 5AVBA 5B1LC 4Z5TA 3AFAC 3LJAD 3REHD 5B0YB 1BH9A 4J8UC 3AYWC 3AZHA 4XZQC 5DNMC 3MNNA 4YS3A 4NFTA 3AZID 1P3MC 2PYOC 3AV1D 5B33C 3LELD 3VH5A 5AV5A 1P34A 5CPJA 3WKJA 4WV4B 5CP6B 5B2IB 3MGPA 1ZLAC 5CPKC 3X1SA 3MGRB 5FUGA 3B0DB 2RVQC 1WWSA 2HIOB 1S32C 4YM6A 3C1CB 1M19C 1EQZB 3AZGB 3AZMB 5B2ID 5GSUB 3LZ0B 1R4VA 3AV2B 3X1TC 3MGRD 2LY8A 3AN2D 4M6BA 3LZ1B 3R45A 3KXBB 5AY8A 3B6FC 5CPIC 3C1CD 2YFVA 3AZLC 2FJ7B 4H9QB 3REJC 4LD9C 3W96B 5E5AB 4NE5A 3UT9D 3AZND 1P3FB 5B2JB 5JRGA 5GXQB 5B40B 5AV8A 1P3LB 2IO5C 5AV9A 1P3GA 1KX5A 3NQUB 3W96D 3W99C 1KX3C 5B2JD 2AROD 4Z2MH 5DNNB 5B0ZD 5GXQD 5B32B 3A6NA 5B24D 4G92C 1U35A 3AZKC 4J8XA 3C1BC 2HUEB 3WAAC 4QLCC 3REKB 1P3BB 2NZDD 5B31A 1M1AD 3X1UA 3LJAA 3REHA 1KX4A 4Z5TD 5CHLB 5KDMB 3MGQC 4EO5C 3AZHD 3MNND 3REKD 2BYKB 3W97B 4X23C 1HQ3B 5BS7A 3TU4B 4DRBA 4NE6A 4H9NB 1TZYB 3LJAC 1P3KB 5CPJD 3WKJD 4KHAB 4H9RB 5GT3B 3W97D 3MGPD 3X1SD 3AZIC 3KUYB 5CP6A 4R8PC 3AV1C 1TZYD 5B2IA 1AOIB 4YM6D 3LELC 3MGRA 1P3AB 2HIOA 4KUDB 1B67A 5AY8D 3C1CA 1P3OC 1EQZA 4J8VC 3AZGA 3AZMA 5AVCD 4HGAB 3LZ0A 3REJB 3O62B 3AV2A 1WWIA 3LZ1A 3WA9C 3KXBA 3KWQD 2L5AA 5JRGD 1ID3B 5AV6B 3AN2C 2FJ7A 5AV8D 4JJNB 4H9QA 4KGCB 4J8WB 3W96A 5E5AA 5AV9D 4ZUXB 2F8NB 5B2JA 1F66B 1KX5D 1F1EA 5C3IB 2NQBC 5GXQA 5B24A 5B40A 1P3LA 2F8NG 1HTAA 3UT9C 3AZNC 3RELB 1U35D 3MVDB 1P3IC 5B31G 3NQUA 5F99B 4J8XD 3UTBB 4G91C 2CWEA 1F66D 2F8ND 5DNNA 5B32A 5GT0C 4Z66C 4XUJC 5B31D 3X1UD 1KX4D 2AROC 3RELD 5B0ZC 3B6GB 5B24C 3UTAB 1M18B 3REKA 1P3BA 5B1MB 3MGSB 3AZEC 3NQJA
chains in the Genus database with same CATH superfamily
5BO0B 1P3PB 5KDMA 5B0YD 3H0LC 2NZDC 1M1AC 2JSSA 5AVBC 2YFWB 4Z5TC 2BYKA 3W97A 5B1MD 3MGSD 1HQ3A 3REIB 3TU4A 3AZHC 4YS3C 3MNNC 4H9NA 4AWLB 2Y2IA 1TZYA 1P3KA 5CP6D 4KHAA 5GT3A 4ZBJB 3REID 3KUYA 5AV5C 1P34C 5CPJC 3WKJC 2CV5B 2BYMA 3MGPC 2HIOD 3X1SC 1BH8B 4UUZB 5AVCA 4WU8B 3X1VB 1AOIA 3P5JB 1EQZD 3AZGD 3AZMD 3AV2D 5GSUD 3LZ0D 1P3AA 4WU9B 2Y2LA 3KWQA 3LZ1D 4YM6C 4KUDA 1ULYA 3KXBD 3AL0C 3WTPB 3B0BA 3X1VD 3O62A 2FJ7D 1A7WA 5AY8C 3V9RB 4WU9D 5AVCC 5E5AD 1P3FD 1ID3A 1W2EA 3AZFB 2F2AC 2XD5A 5B40D 3KWQC 4JJNA 1P3LD 3B0CT 3W98B 4KGCA 5B32G 4J8WA 5JRGC 2DQNC 3EPJA 1F66A 2F8NA 2Y2QA 5AV8C 5B1LB 3AFAB 5AV9C 3AZFD 5DNND 5B32D 1P3GC 1KX5C 4J8UB 3RELA 3AYWB 3MVDA 4XZQB 5DNMB 5F99A 3UTBA 2VQRA 3A6NC 1U35C 1P3MB 2PYOB 4J8XC 1P3BD 5B33B 5B0YA 3B6GA 3UTAA 1M18A 5B31C 3F6TA 3X1UC 3REHC 5CPKB 1KX4C 5B1MA 1ZLAB 3MGSA 1P3MD 2PYOD 5BO0A 1P3PA 1B6WA 1HQ3D 3TU4D 1S32B 1M19B 2Y2OA 2YFWA 3X1TB 2Y2JA 5BS7C 1P3KD 5B0YC 3REIA 5GT3D 1TAFB 2F8NK 3B6FB 5CPIB 3KUYD 3AZLB 5GSUA 1AOID 4LD9B 1H3OB 2CV5A 1P3AD 5CP6C 5CPID 2BG1A 5B2IC 4KUDD 1BH8A 4WNNB 4UUZA 4WU8A 3MGRC 3X1VA 2IO5B 3B0DC 3REJD 2HIOC 3O62D 4LD9D 4WU9A 3W99B 1Q9CA 1KX3B 3C1CC 1P3FA 1EQZC 4G92B 3AZGC 3AZMC 5GSUC 3LZ0C 3WTPA 3AV2C 5JA4B 1ID3D 5AV6D 3AZKB 3LZ1C 3KXBC 3C1BB 4JJND 3V9RA 4KGCD 3WAAB 4QLCB 4J8WD 1KX3D 4ZUXD 2FJ7C 3AZFA 4H9SA 3W96C 5E5AC 5BNXB 3W98A 5B2JC 3MGQB 4DQYB 4EO5B 3VH6T 5GXQC 3MVDD 5B40C 5F99D 3UTBD 1P3LC 2Y2HA 4H9OB 5B1LA 4X23B 4CSRB 3AFAA 4J8UA 3AYWA 1JFIB 4XZQA 4H9PB 5DNMA 5DNNC 3LJAB 5B32C 3B6GD 3A1IA 3H0MC 3UTAD 1M18D 1P3MA 4X23D 2PYOA 3AZIB 3AZJD 5B33A 2HUEC 3REKC 1P3PD 4R8PB 1P3BC 3AV1B 4Z2MG 1ZLAA 5CPKA 3LELB 1PZRA 4H9RA 4CAYB 3WTPE 1S32A 1M19A 4R8PD 1P3OB 3W97C 4J8VB 3X1TA 1HQ3C 5BNVB 3TU4C 2G5HC 3VH5T 3WA9B 1TAFA 3B0CW 3B6FA 5BT1D 5CPIA 1TZYC 2F8NH 1P3KC 2CV5D 3AN2B 5GT3C 3AZLA 1P3OD 4J8VD 3KUYC 4WU8D 3REJA 4LD9A 1H3OA 2FFFB 3WA9D 2NQBB 5G49B 1AOIC 2ZY4A 4WNNA 3UT9B 2Y2PA 5AV6A 3AZNB 1P3AC 3WTPD 2RIQA 1P3IB 4KUDC 3W99A 4G91B 3EPKA 1KX3A 2G5IC 4ZUXA 2NQBD 4HGAC 3O62C 5GT0B 5JA4A 2ZY2A 4Z66B 4XUJB 3AZKA 2AROB 5B0ZB 3C1BA 1P3ID 5B24B 3W98D 1N1JB 4QLCA 3WAAA 1ID3C 5AV6C 4JJNC 3AZEB 2DF4C 5GT0D 4KGCC 5B1LD 4Z66D 4XUJD 4J8WC 3AFAD 5BNXA 4ZUXC 1Z2CB 2NZDB 1F66C 3MGQA 4J8UD 3AYWD 5C3IC 1M1AB 5AVBB 5DNMD 2Y2MA 4XZQD 4Z5TB 4H9OA 4X23A 4CSRA 1BH9B 3AZED 3RELC 3AZJA 3MVDC 3AZHB 3MNNB 4YS3B 5F99C 3UTBC 1JFIA 4NE3A 4H9PA 5B33D 3NQJB 5AVBD 4DRAA 1ZLAD 5CPKD 3AZIA 5AV5B 1P34B 5CPJB 4YS3D 1KU5A 4WZSB 3B6GC 3WKJB 3UTAC 2RVQD 1M18C 3MGPB 1T3UA 4R8PA 3X1SB 3AV1A 5B1MC 3MGSC 3AZJC 1BFMA 1S32D 3LELA 5FUGB 1M19D 3EPHA 1P3PC 3X1TD 2Y2KA 5AV5D 1P34D 4CAYA 4YM6B 3KSYA 3B6FD 1P3OA 4J8VA 3REIC 5BNVA 3AZLD 2BYMB 3R45B 5AY8B 3WA9A 5AVCB 2JE5A 4AWLC 3VH6W 2YFVB 3AN2A 3AZJB 3KWQB 4ZBJC 5BT1C 4E44A 2CV5C 5JRGB 4E45A 3EG5B 5AV8B 2NQBA 5G49A 3W99D 2Y2GA 3X1VC 4WU8C 5AV9B 3UT9A 3AZNA 1P3GB 1KX5B 3H0RC 4WU9C 1P3IA 3AZKD 1P3FC 3C1BD 3A6NB 3VH6A 3WTPC 1U35B 3WAAD 4QLCD 5GT0A 4J8XB 4Z66A 4XUJA 2AROA 1P3GD 5B0ZA 1N1JA 5B31B 3A6ND 3MGQD 3X1UB 3AZFC 3REHB 1KX4B 4H9SC 3AZEA 3W98C 3VH5W 2NZDA 1M1AA 5AVBA 5B1LC 4Z5TA 2ZM5A 3AFAC 3LJAD 3REHD 5B0YB 1BH9A 4J8UC 3AYWC 3AZHA 4XZQC 5DNMC 3MNNA 4YS3A 4NFTA 2Y2NA 3AZID 2J8PA 1P3MC 2PYOC 3AV1D 5B33C 3LELD 3VH5A 5AV5A 1P34A 5CPJA 3WKJA 4WV4B 2XD1A 5CP6B 5B2IB 3MGPA 1ZLAC 5CPKC 3X1SA 3MGRB 5FUGA 3B0DB 2RVQC 1WWSA 2HIOB 1S32C 4YM6A 3C1CB 1M19C 1EQZB 3AZGB 3AZMB 5B2ID 5GSUB 3LZ0B 1R4VA 3AV2B 3X1TC 3MGRD 2LY8A 3AN2D 4M6BA 3LZ1B 3R45A 3KXBB 5AY8A 3B6FC 5CPIC 2ZY5A 3C1CD 2YFVA 3AZLC 2FJ7B 4H9QB 3REJC 4LD9C 3W96B 5E5AB 4NE5A 4WJ3C 3UT9D 3AZND 1P3FB 5B2JB 5JRGA 5GXQB 5B40B 5AV8A 1P3LB 2IO5C 5AV9A 1P3GA 1KX5A 3NQUB 3W96D 3W99C 1KX3C 5B2JD 2AROD 4Z2MH 5DNNB 5B0ZD 5GXQD 5B32B 3A6NA 5B24D 4G92C 1U35A 3AZKC 4J8XA 3C1BC 2HUEB 3WAAC 4QLCC 3REKB 1P3BB 2NZDD 5B31A 1M1AD 3X1UA 3LJAA 3REHA 1KX4A 4Z5TD 3FDDA 5CHLB 5KDMB 3MGQC 4EO5C 3AZHD 3MNND 3REKD 2BYKB 3W97B 4X23C 1HQ3B 5BS7A 3TU4B 4DRBA 4NE6A 4H9NB 1TZYB 3LJAC 1P3KB 5CPJD 3WKJD 4KHAB 4H9RB 5GT3B 3W97D 3MGPD 3EPLA 3X1SD 3AZIC 3KUYB 5CP6A 4R8PC 3AV1C 1TZYD 5B2IA 1AOIB 4YM6D 3LELC 3MGRA 1P3AB 2HIOA 4KUDB 1B67A 3IP4C 5AY8D 3C1CA 1P3OC 1EQZA 4J8VC 3AZGA 3AZMA 5AVCD 4HGAB 3LZ0A 3REJB 3O62B 3AV2A 1WWIA 3LZ1A 3WA9C 3KXBA 3KWQD 2L5AA 2JCHA 5JRGD 1ID3B 5AV6B 3AN2C 2FJ7A 5AV8D 4JJNB 4H9QA 4KGCB 4J8WB 3W96A 5E5AA 5AV9D 3KFUG 4ZUXB 2F8NB 5B2JA 3A1KA 1KX5D 1F66B 1F1EA 5C3IB 2NQBC 5GXQA 5B24A 5B40A 1P3LA 4UPKA 2F8NG 1HTAA 2W8SA 3UT9C 3AZNC 3RELB 1U35D 3MVDB 1P3IC 5B31G 3NQUA 5F99B 4J8XD 3UTBB 4G91C 2CWEA 1F66D 2F8ND 5DNNA 5B32A 5GT0C 2ZY3A 4Z66C 4XUJC 5B31D 3X1UD 1KX4D 2AROC 3RELD 5B0ZC 3B6GB 5B24C 3UTAB 2UWXA 1M18B 3REKA 1P3BA 5B1MB 3MGSB 3AZEC 3NQJA
chains in the Genus database with same CATH topology
5BO0B 1P3PB 5KDMA 5B0YD 3H0LC 2NZDC 1M1AC 2JSSA 5AVBC 2YFWB 4Z5TC 2BYKA 3W97A 5B1MD 3MGSD 1HQ3A 3REIB 3TU4A 3AZHC 4YS3C 3MNNC 4H9NA 4AWLB 2Y2IA 1TZYA 1P3KA 5CP6D 4KHAA 5GT3A 4ZBJB 3REID 3KUYA 5AV5C 1P34C 5CPJC 3WKJC 2CV5B 2BYMA 3MGPC 2HIOD 3X1SC 1BH8B 4UUZB 5AVCA 4WU8B 3X1VB 1AOIA 3P5JB 1EQZD 3AZGD 3AZMD 3AV2D 5GSUD 3LZ0D 1P3AA 4WU9B 2Y2LA 3KWQA 3LZ1D 4YM6C 4KUDA 1ULYA 3KXBD 3AL0C 3WTPB 3B0BA 3X1VD 3O62A 2FJ7D 1A7WA 5AY8C 3V9RB 4WU9D 5AVCC 5E5AD 1P3FD 1ID3A 1W2EA 3AZFB 2F2AC 2XD5A 5B40D 3KWQC 4JJNA 1P3LD 3B0CT 3W98B 4KGCA 5B32G 4J8WA 5JRGC 2DQNC 3EPJA 1F66A 2F8NA 2Y2QA 5AV8C 5B1LB 3AFAB 5AV9C 3AZFD 5DNND 5B32D 1P3GC 1KX5C 4J8UB 3RELA 3AYWB 3MVDA 4XZQB 5DNMB 5F99A 3UTBA 2VQRA 3A6NC 1U35C 1P3MB 2PYOB 4J8XC 1P3BD 5B33B 5B0YA 3B6GA 3UTAA 1M18A 5B31C 3F6TA 3X1UC 3REHC 5CPKB 1KX4C 5B1MA 1ZLAB 3MGSA 1P3MD 2PYOD 5BO0A 1P3PA 1B6WA 1HQ3D 3TU4D 1S32B 1M19B 2Y2OA 2YFWA 3X1TB 2Y2JA 5BS7C 1P3KD 5B0YC 3REIA 5GT3D 1TAFB 2F8NK 3B6FB 5CPIB 3KUYD 3AZLB 5GSUA 1AOID 4LD9B 1H3OB 2CV5A 1P3AD 5CP6C 5CPID 2BG1A 5B2IC 4KUDD 1BH8A 4WNNB 4UUZA 4WU8A 3MGRC 3X1VA 2IO5B 3B0DC 3REJD 2HIOC 3O62D 4LD9D 4WU9A 3W99B 1Q9CA 1KX3B 3C1CC 1P3FA 1EQZC 4G92B 3AZGC 3AZMC 5GSUC 3LZ0C 3WTPA 3AV2C 5JA4B 1ID3D 5AV6D 3AZKB 3LZ1C 3KXBC 3C1BB 4JJND 3V9RA 4KGCD 3WAAB 4QLCB 4J8WD 1KX3D 4ZUXD 2FJ7C 3AZFA 4H9SA 3W96C 5E5AC 5BNXB 3W98A 5B2JC 3MGQB 4DQYB 4EO5B 3VH6T 5GXQC 3MVDD 5B40C 5F99D 3UTBD 1P3LC 2Y2HA 4H9OB 5B1LA 4X23B 4CSRB 3AFAA 4J8UA 3AYWA 1JFIB 4XZQA 4H9PB 5DNMA 5DNNC 3LJAB 5B32C 3B6GD 3A1IA 3H0MC 3UTAD 1M18D 1P3MA 4X23D 2PYOA 3AZIB 3AZJD 5B33A 2HUEC 3REKC 1P3PD 4R8PB 1P3BC 3AV1B 4Z2MG 1ZLAA 5CPKA 3LELB 1PZRA 4H9RA 4CAYB 3WTPE 1S32A 1M19A 4R8PD 1P3OB 3W97C 4J8VB 3X1TA 1HQ3C 5BNVB 3TU4C 2G5HC 3VH5T 3WA9B 1TAFA 3B0CW 3B6FA 5BT1D 5CPIA 1TZYC 2F8NH 1P3KC 2CV5D 3AN2B 5GT3C 3AZLA 1P3OD 4J8VD 3KUYC 4WU8D 3REJA 4LD9A 1H3OA 2FFFB 3WA9D 2NQBB 5G49B 1AOIC 2ZY4A 4WNNA 3UT9B 2Y2PA 5AV6A 3AZNB 1P3AC 3WTPD 2RIQA 1P3IB 4KUDC 3W99A 4G91B 3EPKA 1KX3A 2G5IC 4ZUXA 2NQBD 4HGAC 3O62C 5GT0B 5JA4A 2ZY2A 4Z66B 4XUJB 3AZKA 2AROB 5B0ZB 3C1BA 1P3ID 5B24B 3W98D 1N1JB 4QLCA 3WAAA 1ID3C 5AV6C 4JJNC 3AZEB 2DF4C 5GT0D 4KGCC 5B1LD 4Z66D 4XUJD 4J8WC 3AFAD 5BNXA 4ZUXC 1Z2CB 2NZDB 1F66C 3MGQA 4J8UD 3AYWD 5C3IC 1M1AB 5AVBB 5DNMD 2Y2MA 4XZQD 4Z5TB 4H9OA 4X23A 4CSRA 1BH9B 3AZED 3RELC 3AZJA 3MVDC 3AZHB 3MNNB 4YS3B 5F99C 3UTBC 1JFIA 4NE3A 4H9PA 5B33D 3NQJB 5AVBD 4DRAA 1ZLAD 5CPKD 3AZIA 5AV5B 1P34B 5CPJB 4YS3D 1KU5A 4WZSB 3B6GC 3WKJB 3UTAC 2RVQD 1M18C 3MGPB 1T3UA 4R8PA 3X1SB 3AV1A 5B1MC 3MGSC 3AZJC 1BFMA 1S32D 3LELA 5FUGB 1M19D 3EPHA 1P3PC 3X1TD 2Y2KA 5AV5D 1P34D 4CAYA 4YM6B 3KSYA 3B6FD 1P3OA 4J8VA 3REIC 5BNVA 3AZLD 2BYMB 3R45B 5AY8B 3WA9A 5AVCB 2JE5A 4AWLC 3VH6W 2YFVB 3AN2A 3AZJB 3KWQB 4ZBJC 5BT1C 4E44A 2CV5C 5JRGB 4E45A 3EG5B 5AV8B 2NQBA 5G49A 3W99D 2Y2GA 3X1VC 4WU8C 5AV9B 3UT9A 3AZNA 1P3GB 1KX5B 3H0RC 4WU9C 1P3IA 3AZKD 1P3FC 3C1BD 3A6NB 3VH6A 3WTPC 1U35B 3WAAD 4QLCD 5GT0A 4J8XB 4Z66A 4XUJA 2AROA 1P3GD 5B0ZA 1N1JA 5B31B 3A6ND 3MGQD 3X1UB 3AZFC 3REHB 1KX4B 4H9SC 3AZEA 3W98C 3VH5W 2NZDA 1M1AA 5AVBA 5B1LC 4Z5TA 2ZM5A 3AFAC 3LJAD 3REHD 5B0YB 1BH9A 4J8UC 3AYWC 3AZHA 4XZQC 5DNMC 3MNNA 4YS3A 4NFTA 2Y2NA 3AZID 2J8PA 1P3MC 2PYOC 3AV1D 5B33C 3LELD 3VH5A 5AV5A 1P34A 5CPJA 3WKJA 4WV4B 2XD1A 5CP6B 5B2IB 3MGPA 1ZLAC 5CPKC 3X1SA 3MGRB 5FUGA 3B0DB 2RVQC 1WWSA 2HIOB 1S32C 4YM6A 3C1CB 1M19C 1EQZB 3AZGB 3AZMB 5B2ID 5GSUB 3LZ0B 1R4VA 3AV2B 3X1TC 3MGRD 2LY8A 3AN2D 4M6BA 3LZ1B 3R45A 3KXBB 5AY8A 3B6FC 5CPIC 2ZY5A 3C1CD 2YFVA 3AZLC 2FJ7B 4H9QB 3REJC 4LD9C 3W96B 5E5AB 4NE5A 4WJ3C 3UT9D 3AZND 1P3FB 5B2JB 5JRGA 5GXQB 5B40B 5AV8A 1P3LB 2IO5C 5AV9A 1P3GA 1KX5A 3NQUB 3W96D 3W99C 1KX3C 5B2JD 2AROD 4Z2MH 5DNNB 5B0ZD 5GXQD 5B32B 3A6NA 5B24D 4G92C 1U35A 3AZKC 4J8XA 3C1BC 2HUEB 3WAAC 4QLCC 3REKB 1P3BB 2NZDD 5B31A 1M1AD 3X1UA 3LJAA 3REHA 1KX4A 4Z5TD 3FDDA 5CHLB 5KDMB 3MGQC 4EO5C 3AZHD 3MNND 3REKD 2BYKB 3W97B 4X23C 1HQ3B 5BS7A 3TU4B 4DRBA 4NE6A 4H9NB 1TZYB 3LJAC 1P3KB 5CPJD 3WKJD 4KHAB 4H9RB 5GT3B 3W97D 3MGPD 3EPLA 3X1SD 3AZIC 3KUYB 5CP6A 4R8PC 3AV1C 1TZYD 5B2IA 1AOIB 4YM6D 3LELC 3MGRA 1P3AB 2HIOA 4KUDB 1B67A 3IP4C 5AY8D 3C1CA 1P3OC 1EQZA 4J8VC 3AZGA 3AZMA 5AVCD 4HGAB 3LZ0A 3REJB 3O62B 3AV2A 1WWIA 3LZ1A 3WA9C 3KXBA 3KWQD 2L5AA 2JCHA 5JRGD 1ID3B 5AV6B 3AN2C 2FJ7A 5AV8D 4JJNB 4H9QA 4KGCB 4J8WB 3W96A 5E5AA 5AV9D 3KFUG 4ZUXB 2F8NB 5B2JA 3A1KA 1KX5D 1F66B 1F1EA 5C3IB 2NQBC 5GXQA 5B24A 5B40A 1P3LA 4UPKA 2F8NG 1HTAA 2W8SA 3UT9C 3AZNC 3RELB 1U35D 3MVDB 1P3IC 5B31G 3NQUA 5F99B 4J8XD 3UTBB 4G91C 2CWEA 1F66D 2F8ND 5DNNA 5B32A 5GT0C 2ZY3A 4Z66C 4XUJC 5B31D 3X1UD 1KX4D 2AROC 3RELD 5B0ZC 3B6GB 5B24C 3UTAB 2UWXA 1M18B 3REKA 1P3BA 5B1MB 3MGSB 3AZEC 3NQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BO0 B;  1P3P B;  5KDM A;  5B0Y D;  2NZD C;  1M1A C;  2JSS A;  5AVB C;  2YFW B;  4Z5T C;  2BYK A;  3W97 A;  5B1M D;  3MGS D;  1HQ3 A;  3REI B;  3TU4 A;  3AZH C;  4YS3 C;  3MNN C;  4H9N A;  4AWL B;  1TZY A;  1P3K A;  5CP6 D;  4KHA A;  5GT3 A;  4ZBJ B;  3REI D;  3KUY A;  5AV5 C;  1P34 C;  5CPJ C;  3WKJ C;  2CV5 B;  2BYM A;  3MGP C;  2HIO D;  3X1S C;  1BH8 B;  4UUZ B;  5AVC A;  4WU8 B;  3X1V B;  1AOI A;  1EQZ D;  3AZG D;  3AZM D;  3AV2 D;  5GSU D;  3LZ0 D;  1P3A A;  4WU9 B;  3KWQ A;  3LZ1 D;  4YM6 C;  4KUD A;  1ULY A;  3KXB D;  3WTP B;  3B0B A;  3X1V D;  3O62 A;  2FJ7 D;  1A7W A;  5AY8 C;  3V9R B;  4WU9 D;  5AVC C;  5E5A D;  1P3F D;  1ID3 A;  3AZF B;  5B40 D;  1P3L D;  3KWQ C;  4JJN A;  3B0C T;  3W98 B;  4KGC A;  5B32 G;  4J8W A;  5JRG C;  2F8N A;  1F66 A;  5AV8 C;  5B1L B;  3AFA B;  5AV9 C;  3AZF D;  5DNN D;  5B32 D;  1P3G C;  1KX5 C;  4J8U B;  3REL A;  3AYW B;  3MVD A;  4XZQ B;  5DNM B;  5F99 A;  3UTB A;  3A6N C;  1U35 C;  1P3M B;  2PYO B;  4J8X C;  1P3B D;  5B33 B;  5B0Y A;  3B6G A;  3UTA A;  1M18 A;  5B31 C;  3X1U C;  1KX4 C;  3REH C;  5CPK B;  1ZLA B;  5B1M A;  3MGS A;  1P3M D;  2PYO D;  5BO0 A;  1P3P A;  1B6W A;  1HQ3 D;  3TU4 D;  1S32 B;  1M19 B;  2YFW A;  3X1T B;  5BS7 C;  1P3K D;  5B0Y C;  3REI A;  5GT3 D;  1TAF B;  2F8N K;  3B6F B;  5CPI B;  3KUY D;  3AZL B;  5GSU A;  1AOI D;  4LD9 B;  1H3O B;  2CV5 A;  1P3A D;  5CP6 C;  5CPI D;  5B2I C;  4KUD D;  1BH8 A;  4WNN B;  4UUZ A;  4WU8 A;  3MGR C;  3X1V A;  2IO5 B;  3B0D C;  3REJ D;  2HIO C;  3O62 D;  4LD9 D;  4WU9 A;  3W99 B;  1Q9C A;  1KX3 B;  3C1C C;  1P3F A;  1EQZ C;  4G92 B;  3AZG C;  3AZM C;  5GSU C;  3LZ0 C;  3WTP A;  3AV2 C;  5JA4 B;  1ID3 D;  5AV6 D;  3AZK B;  3LZ1 C;  3KXB C;  3C1B B;  4JJN D;  3V9R A;  4KGC D;  3WAA B;  4QLC B;  4J8W D;  1KX3 D;  4ZUX D;  2FJ7 C;  3AZF A;  4H9S A;  3W96 C;  5E5A C;  5BNX B;  3W98 A;  5B2J C;  3MGQ B;  4EO5 B;  3VH6 T;  5GXQ C;  3MVD D;  5B40 C;  5F99 D;  3UTB D;  1P3L C;  4H9O B;  5B1L A;  4X23 B;  4CSR B;  3AFA A;  4J8U A;  3AYW A;  1JFI B;  4XZQ A;  4H9P B;  5DNM A;  5DNN C;  3LJA B;  5B32 C;  3B6G D;  3UTA D;  1M18 D;  1P3M A;  4X23 D;  2PYO A;  3AZI B;  3AZJ D;  5B33 A;  2HUE C;  3REK C;  1P3P D;  4R8P B;  1P3B C;  3AV1 B;  4Z2M G;  1ZLA A;  5CPK A;  3LEL B;  4H9R A;  4CAY B;  3WTP E;  1S32 A;  1M19 A;  4R8P D;  1P3O B;  3W97 C;  4J8V B;  3X1T A;  1HQ3 C;  5BNV B;  3TU4 C;  3VH5 T;  3WA9 B;  1TAF A;  3B0C W;  3B6F A;  5BT1 D;  5CPI A;  1TZY C;  2F8N H;  1P3K C;  2CV5 D;  3AN2 B;  5GT3 C;  3AZL A;  1P3O D;  4J8V D;  3KUY C;  4WU8 D;  3REJ A;  4LD9 A;  1H3O A;  3WA9 D;  2NQB B;  5G49 B;  1AOI C;  4WNN A;  3UT9 B;  3AZN B;  5AV6 A;  1P3A C;  3WTP D;  1P3I B;  4KUD C;  3W99 A;  4G91 B;  1KX3 A;  4ZUX A;  2NQB D;  4HGA C;  3O62 C;  5GT0 B;  5JA4 A;  4Z66 B;  4XUJ B;  3AZK A;  2ARO B;  5B0Z B;  3C1B A;  1P3I D;  5B24 B;  3W98 D;  1N1J B;  4QLC A;  3WAA A;  1ID3 C;  5AV6 C;  4JJN C;  3AZE B;  5GT0 D;  4KGC C;  5B1L D;  4Z66 D;  4XUJ D;  4J8W C;  3AFA D;  5BNX A;  4ZUX C;  2NZD B;  1F66 C;  3MGQ A;  4J8U D;  3AYW D;  5C3I C;  1M1A B;  5AVB B;  4XZQ D;  5DNM D;  4Z5T B;  4H9O A;  4X23 A;  4CSR A;  1BH9 B;  3AZE D;  3REL C;  3AZJ A;  3MVD C;  3AZH B;  3MNN B;  4YS3 B;  5F99 C;  3UTB C;  1JFI A;  4NE3 A;  4H9P A;  5B33 D;  3NQJ B;  5AVB D;  4DRA A;  1ZLA D;  5CPK D;  3AZI A;  5AV5 B;  1P34 B;  5CPJ B;  4YS3 D;  1KU5 A;  4WZS B;  3B6G C;  3WKJ B;  3UTA C;  2RVQ D;  1M18 C;  3MGP B;  4R8P A;  3X1S B;  3AV1 A;  5B1M C;  3MGS C;  3AZJ C;  1BFM A;  1S32 D;  3LEL A;  5FUG B;  1M19 D;  1P3P C;  3X1T D;  5AV5 D;  1P34 D;  4CAY A;  4YM6 B;  3KSY A;  3B6F D;  1P3O A;  4J8V A;  3REI C;  5BNV A;  3AZL D;  2BYM B;  3R45 B;  5AY8 B;  3WA9 A;  5AVC B;  4AWL C;  3VH6 W;  2YFV B;  3AN2 A;  3AZJ B;  3KWQ B;  4ZBJ C;  5BT1 C;  4E44 A;  2CV5 C;  5JRG B;  4E45 A;  5AV8 B;  2NQB A;  5G49 A;  3W99 D;  3X1V C;  4WU8 C;  5AV9 B;  3UT9 A;  3AZN A;  1P3G B;  1KX5 B;  4WU9 C;  1P3I A;  3AZK D;  1P3F C;  3C1B D;  3A6N B;  3VH6 A;  3WTP C;  1U35 B;  3WAA D;  4QLC D;  5GT0 A;  4J8X B;  4Z66 A;  4XUJ A;  2ARO A;  1P3G D;  5B0Z A;  1N1J A;  5B31 B;  3A6N D;  3MGQ D;  3X1U B;  3AZF C;  3REH B;  1KX4 B;  4H9S C;  3AZE A;  3W98 C;  3VH5 W;  2NZD A;  1M1A A;  5AVB A;  5B1L C;  4Z5T A;  3AFA C;  3LJA D;  3REH D;  5B0Y B;  1BH9 A;  4J8U C;  3AYW C;  3AZH A;  4XZQ C;  5DNM C;  3MNN A;  4YS3 A;  4NFT A;  3AZI D;  1P3M C;  2PYO C;  3AV1 D;  5B33 C;  3LEL D;  3VH5 A;  5AV5 A;  1P34 A;  5CPJ A;  3WKJ A;  4WV4 B;  5CP6 B;  5B2I B;  3MGP A;  1ZLA C;  5CPK C;  3X1S A;  3MGR B;  5FUG A;  3B0D B;  2RVQ C;  1WWS A;  2HIO B;  1S32 C;  4YM6 A;  3C1C B;  1M19 C;  1EQZ B;  3AZG B;  3AZM B;  5B2I D;  5GSU B;  3LZ0 B;  1R4V A;  3AV2 B;  3X1T C;  3MGR D;  2LY8 A;  3AN2 D;  4M6B A;  3LZ1 B;  3R45 A;  3KXB B;  5AY8 A;  3B6F C;  5CPI C;  3C1C D;  2YFV A;  3AZL C;  2FJ7 B;  4H9Q B;  3REJ C;  4LD9 C;  3W96 B;  5E5A B;  4NE5 A;  3UT9 D;  3AZN D;  1P3F B;  5B2J B;  5JRG A;  5GXQ B;  5B40 B;  5AV8 A;  1P3L B;  2IO5 C;  5AV9 A;  1P3G A;  1KX5 A;  3NQU B;  3W96 D;  3W99 C;  1KX3 C;  5B2J D;  2ARO D;  4Z2M H;  5DNN B;  5B0Z D;  5GXQ D;  5B32 B;  3A6N A;  5B24 D;  4G92 C;  1U35 A;  3AZK C;  4J8X A;  3C1B C;  2HUE B;  3WAA C;  4QLC C;  3REK B;  1P3B B;  2NZD D;  5B31 A;  1M1A D;  3X1U A;  3LJA A;  3REH A;  1KX4 A;  4Z5T D;  5CHL B;  5KDM B;  3MGQ C;  4EO5 C;  3AZH D;  3MNN D;  3REK D;  2BYK B;  3W97 B;  4X23 C;  1HQ3 B;  5BS7 A;  3TU4 B;  4DRB A;  4NE6 A;  4H9N B;  1TZY B;  3LJA C;  1P3K B;  5CPJ D;  3WKJ D;  4KHA B;  4H9R B;  5GT3 B;  3W97 D;  3MGP D;  3X1S D;  3AZI C;  3KUY B;  5CP6 A;  4R8P C;  3AV1 C;  1TZY D;  5B2I A;  1AOI B;  4YM6 D;  3LEL C;  3MGR A;  1P3A B;  2HIO A;  4KUD B;  1B67 A;  5AY8 D;  3C1C A;  1P3O C;  1EQZ A;  4J8V C;  3AZG A;  3AZM A;  5AVC D;  4HGA B;  3LZ0 A;  3REJ B;  3O62 B;  3AV2 A;  1WWI A;  3LZ1 A;  3WA9 C;  3KXB A;  3KWQ D;  2L5A A;  5JRG D;  1ID3 B;  5AV6 B;  3AN2 C;  2FJ7 A;  5AV8 D;  4JJN B;  4H9Q A;  4KGC B;  4J8W B;  3W96 A;  5E5A A;  5AV9 D;  4ZUX B;  2F8N B;  5B2J A;  1F66 B;  1KX5 D;  1F1E A;  5C3I B;  2NQB C;  5GXQ A;  5B24 A;  5B40 A;  1P3L A;  2F8N G;  1HTA A;  3UT9 C;  3AZN C;  3REL B;  1U35 D;  3MVD B;  1P3I C;  5B31 G;  3NQU A;  5F99 B;  4J8X D;  3UTB B;  4G91 C;  2CWE A;  1F66 D;  2F8N D;  5DNN A;  5B32 A;  5GT0 C;  4Z66 C;  4XUJ C;  5B31 D;  3X1U D;  1KX4 D;  2ARO C;  3REL D;  5B0Z C;  3B6G B;  5B24 C;  3UTA B;  1M18 B;  3REK A;  1P3B A;  5B1M B;  3MGS B;  3AZE C;  3NQJ A; 
#chains in the Genus database with same CATH topology
 5BO0 B;  1P3P B;  5KDM A;  5B0Y D;  3H0L C;  2NZD C;  1M1A C;  2JSS A;  5AVB C;  2YFW B;  4Z5T C;  2BYK A;  3W97 A;  5B1M D;  3MGS D;  1HQ3 A;  3REI B;  3TU4 A;  3AZH C;  4YS3 C;  3MNN C;  4H9N A;  4AWL B;  2Y2I A;  1TZY A;  1P3K A;  5CP6 D;  4KHA A;  5GT3 A;  4ZBJ B;  3REI D;  3KUY A;  5AV5 C;  1P34 C;  5CPJ C;  3WKJ C;  2CV5 B;  2BYM A;  3MGP C;  2HIO D;  3X1S C;  1BH8 B;  4UUZ B;  5AVC A;  4WU8 B;  3X1V B;  1AOI A;  3P5J B;  1EQZ D;  3AZG D;  3AZM D;  3AV2 D;  5GSU D;  3LZ0 D;  1P3A A;  4WU9 B;  2Y2L A;  3KWQ A;  3LZ1 D;  4YM6 C;  4KUD A;  1ULY A;  3KXB D;  3AL0 C;  3WTP B;  3B0B A;  3X1V D;  3O62 A;  2FJ7 D;  1A7W A;  5AY8 C;  3V9R B;  4WU9 D;  5AVC C;  5E5A D;  1P3F D;  1ID3 A;  1W2E A;  3AZF B;  2F2A C;  2XD5 A;  5B40 D;  3KWQ C;  4JJN A;  1P3L D;  3B0C T;  3W98 B;  4KGC A;  5B32 G;  4J8W A;  5JRG C;  2DQN C;  3EPJ A;  1F66 A;  2F8N A;  2Y2Q A;  5AV8 C;  5B1L B;  3AFA B;  5AV9 C;  3AZF D;  5DNN D;  5B32 D;  1P3G C;  1KX5 C;  4J8U B;  3REL A;  3AYW B;  3MVD A;  4XZQ B;  5DNM B;  5F99 A;  3UTB A;  2VQR A;  3A6N C;  1U35 C;  1P3M B;  2PYO B;  4J8X C;  1P3B D;  5B33 B;  5B0Y A;  3B6G A;  3UTA A;  1M18 A;  5B31 C;  3F6T A;  3X1U C;  3REH C;  5CPK B;  1KX4 C;  5B1M A;  1ZLA B;  3MGS A;  1P3M D;  2PYO D;  5BO0 A;  1P3P A;  1B6W A;  1HQ3 D;  3TU4 D;  1S32 B;  1M19 B;  2Y2O A;  2YFW A;  3X1T B;  2Y2J A;  5BS7 C;  1P3K D;  5B0Y C;  3REI A;  5GT3 D;  1TAF B;  2F8N K;  3B6F B;  5CPI B;  3KUY D;  3AZL B;  5GSU A;  1AOI D;  4LD9 B;  1H3O B;  2CV5 A;  1P3A D;  5CP6 C;  5CPI D;  2BG1 A;  5B2I C;  4KUD D;  1BH8 A;  4WNN B;  4UUZ A;  4WU8 A;  3MGR C;  3X1V A;  2IO5 B;  3B0D C;  3REJ D;  2HIO C;  3O62 D;  4LD9 D;  4WU9 A;  3W99 B;  1Q9C A;  1KX3 B;  3C1C C;  1P3F A;  1EQZ C;  4G92 B;  3AZG C;  3AZM C;  5GSU C;  3LZ0 C;  3WTP A;  3AV2 C;  5JA4 B;  1ID3 D;  5AV6 D;  3AZK B;  3LZ1 C;  3KXB C;  3C1B B;  4JJN D;  3V9R A;  4KGC D;  3WAA B;  4QLC B;  4J8W D;  1KX3 D;  4ZUX D;  2FJ7 C;  3AZF A;  4H9S A;  3W96 C;  5E5A C;  5BNX B;  3W98 A;  5B2J C;  3MGQ B;  4DQY B;  4EO5 B;  3VH6 T;  5GXQ C;  3MVD D;  5B40 C;  5F99 D;  3UTB D;  1P3L C;  2Y2H A;  4H9O B;  5B1L A;  4X23 B;  4CSR B;  3AFA A;  4J8U A;  3AYW A;  1JFI B;  4XZQ A;  4H9P B;  5DNM A;  5DNN C;  3LJA B;  5B32 C;  3B6G D;  3A1I A;  3H0M C;  3UTA D;  1M18 D;  1P3M A;  4X23 D;  2PYO A;  3AZI B;  3AZJ D;  5B33 A;  2HUE C;  3REK C;  1P3P D;  4R8P B;  1P3B C;  3AV1 B;  4Z2M G;  1ZLA A;  5CPK A;  3LEL B;  1PZR A;  4H9R A;  4CAY B;  3WTP E;  1S32 A;  1M19 A;  4R8P D;  1P3O B;  3W97 C;  4J8V B;  3X1T A;  1HQ3 C;  5BNV B;  3TU4 C;  2G5H C;  3VH5 T;  3WA9 B;  1TAF A;  3B0C W;  3B6F A;  5BT1 D;  5CPI A;  1TZY C;  2F8N H;  1P3K C;  2CV5 D;  3AN2 B;  5GT3 C;  3AZL A;  1P3O D;  4J8V D;  3KUY C;  4WU8 D;  3REJ A;  4LD9 A;  1H3O A;  2FFF B;  3WA9 D;  2NQB B;  5G49 B;  1AOI C;  2ZY4 A;  4WNN A;  3UT9 B;  2Y2P A;  5AV6 A;  3AZN B;  1P3A C;  3WTP D;  2RIQ A;  1P3I B;  4KUD C;  3W99 A;  4G91 B;  3EPK A;  1KX3 A;  2G5I C;  4ZUX A;  2NQB D;  4HGA C;  3O62 C;  5GT0 B;  5JA4 A;  2ZY2 A;  4Z66 B;  4XUJ B;  3AZK A;  2ARO B;  5B0Z B;  3C1B A;  1P3I D;  5B24 B;  3W98 D;  1N1J B;  4QLC A;  3WAA A;  1ID3 C;  5AV6 C;  4JJN C;  3AZE B;  2DF4 C;  5GT0 D;  4KGC C;  5B1L D;  4Z66 D;  4XUJ D;  4J8W C;  3AFA D;  5BNX A;  4ZUX C;  1Z2C B;  2NZD B;  1F66 C;  3MGQ A;  4J8U D;  3AYW D;  5C3I C;  1M1A B;  5AVB B;  5DNM D;  2Y2M A;  4XZQ D;  4Z5T B;  4H9O A;  4X23 A;  4CSR A;  1BH9 B;  3AZE D;  3REL C;  3AZJ A;  3MVD C;  3AZH B;  3MNN B;  4YS3 B;  5F99 C;  3UTB C;  1JFI A;  4NE3 A;  4H9P A;  5B33 D;  3NQJ B;  5AVB D;  4DRA A;  1ZLA D;  5CPK D;  3AZI A;  5AV5 B;  1P34 B;  5CPJ B;  4YS3 D;  1KU5 A;  4WZS B;  3B6G C;  3WKJ B;  3UTA C;  2RVQ D;  1M18 C;  3MGP B;  1T3U A;  4R8P A;  3X1S B;  3AV1 A;  5B1M C;  3MGS C;  3AZJ C;  1BFM A;  1S32 D;  3LEL A;  5FUG B;  1M19 D;  3EPH A;  1P3P C;  3X1T D;  2Y2K A;  5AV5 D;  1P34 D;  4CAY A;  4YM6 B;  3KSY A;  3B6F D;  1P3O A;  4J8V A;  3REI C;  5BNV A;  3AZL D;  2BYM B;  3R45 B;  5AY8 B;  3WA9 A;  5AVC B;  2JE5 A;  4AWL C;  3VH6 W;  2YFV B;  3AN2 A;  3AZJ B;  3KWQ B;  4ZBJ C;  5BT1 C;  4E44 A;  2CV5 C;  5JRG B;  4E45 A;  3EG5 B;  5AV8 B;  2NQB A;  5G49 A;  3W99 D;  2Y2G A;  3X1V C;  4WU8 C;  5AV9 B;  3UT9 A;  3AZN A;  1P3G B;  1KX5 B;  3H0R C;  4WU9 C;  1P3I A;  3AZK D;  1P3F C;  3C1B D;  3A6N B;  3VH6 A;  3WTP C;  1U35 B;  3WAA D;  4QLC D;  5GT0 A;  4J8X B;  4Z66 A;  4XUJ A;  2ARO A;  1P3G D;  5B0Z A;  1N1J A;  5B31 B;  3A6N D;  3MGQ D;  3X1U B;  3AZF C;  3REH B;  1KX4 B;  4H9S C;  3AZE A;  3W98 C;  3VH5 W;  2NZD A;  1M1A A;  5AVB A;  5B1L C;  4Z5T A;  2ZM5 A;  3AFA C;  3LJA D;  3REH D;  5B0Y B;  1BH9 A;  4J8U C;  3AYW C;  3AZH A;  4XZQ C;  5DNM C;  3MNN A;  4YS3 A;  4NFT A;  2Y2N A;  3AZI D;  2J8P A;  1P3M C;  2PYO C;  3AV1 D;  5B33 C;  3LEL D;  3VH5 A;  5AV5 A;  1P34 A;  5CPJ A;  3WKJ A;  4WV4 B;  2XD1 A;  5CP6 B;  5B2I B;  3MGP A;  1ZLA C;  5CPK C;  3X1S A;  3MGR B;  5FUG A;  3B0D B;  2RVQ C;  1WWS A;  2HIO B;  1S32 C;  4YM6 A;  3C1C B;  1M19 C;  1EQZ B;  3AZG B;  3AZM B;  5B2I D;  5GSU B;  3LZ0 B;  1R4V A;  3AV2 B;  3X1T C;  3MGR D;  2LY8 A;  3AN2 D;  4M6B A;  3LZ1 B;  3R45 A;  3KXB B;  5AY8 A;  3B6F C;  5CPI C;  2ZY5 A;  3C1C D;  2YFV A;  3AZL C;  2FJ7 B;  4H9Q B;  3REJ C;  4LD9 C;  3W96 B;  5E5A B;  4NE5 A;  4WJ3 C;  3UT9 D;  3AZN D;  1P3F B;  5B2J B;  5JRG A;  5GXQ B;  5B40 B;  5AV8 A;  1P3L B;  2IO5 C;  5AV9 A;  1P3G A;  1KX5 A;  3NQU B;  3W96 D;  3W99 C;  1KX3 C;  5B2J D;  2ARO D;  4Z2M H;  5DNN B;  5B0Z D;  5GXQ D;  5B32 B;  3A6N A;  5B24 D;  4G92 C;  1U35 A;  3AZK C;  4J8X A;  3C1B C;  2HUE B;  3WAA C;  4QLC C;  3REK B;  1P3B B;  2NZD D;  5B31 A;  1M1A D;  3X1U A;  3LJA A;  3REH A;  1KX4 A;  4Z5T D;  3FDD A;  5CHL B;  5KDM B;  3MGQ C;  4EO5 C;  3AZH D;  3MNN D;  3REK D;  2BYK B;  3W97 B;  4X23 C;  1HQ3 B;  5BS7 A;  3TU4 B;  4DRB A;  4NE6 A;  4H9N B;  1TZY B;  3LJA C;  1P3K B;  5CPJ D;  3WKJ D;  4KHA B;  4H9R B;  5GT3 B;  3W97 D;  3MGP D;  3EPL A;  3X1S D;  3AZI C;  3KUY B;  5CP6 A;  4R8P C;  3AV1 C;  1TZY D;  5B2I A;  1AOI B;  4YM6 D;  3LEL C;  3MGR A;  1P3A B;  2HIO A;  4KUD B;  1B67 A;  3IP4 C;  5AY8 D;  3C1C A;  1P3O C;  1EQZ A;  4J8V C;  3AZG A;  3AZM A;  5AVC D;  4HGA B;  3LZ0 A;  3REJ B;  3O62 B;  3AV2 A;  1WWI A;  3LZ1 A;  3WA9 C;  3KXB A;  3KWQ D;  2L5A A;  2JCH A;  5JRG D;  1ID3 B;  5AV6 B;  3AN2 C;  2FJ7 A;  5AV8 D;  4JJN B;  4H9Q A;  4KGC B;  4J8W B;  3W96 A;  5E5A A;  5AV9 D;  3KFU G;  4ZUX B;  2F8N B;  5B2J A;  3A1K A;  1KX5 D;  1F66 B;  1F1E A;  5C3I B;  2NQB C;  5GXQ A;  5B24 A;  5B40 A;  1P3L A;  4UPK A;  2F8N G;  1HTA A;  2W8S A;  3UT9 C;  3AZN C;  3REL B;  1U35 D;  3MVD B;  1P3I C;  5B31 G;  3NQU A;  5F99 B;  4J8X D;  3UTB B;  4G91 C;  2CWE A;  1F66 D;  2F8N D;  5DNN A;  5B32 A;  5GT0 C;  2ZY3 A;  4Z66 C;  4XUJ C;  5B31 D;  3X1U D;  1KX4 D;  2ARO C;  3REL D;  5B0Z C;  3B6G B;  5B24 C;  3UTA B;  2UWX A;  1M18 B;  3REK A;  1P3B A;  5B1M B;  3MGS B;  3AZE C;  3NQJ A; 
#chains in the Genus database with same CATH homology
 5BO0 B;  1P3P B;  5KDM A;  5B0Y D;  3H0L C;  2NZD C;  1M1A C;  2JSS A;  5AVB C;  2YFW B;  4Z5T C;  2BYK A;  3W97 A;  5B1M D;  3MGS D;  1HQ3 A;  3REI B;  3TU4 A;  3AZH C;  4YS3 C;  3MNN C;  4H9N A;  4AWL B;  2Y2I A;  1TZY A;  1P3K A;  5CP6 D;  4KHA A;  5GT3 A;  4ZBJ B;  3REI D;  3KUY A;  5AV5 C;  1P34 C;  5CPJ C;  3WKJ C;  2CV5 B;  2BYM A;  3MGP C;  2HIO D;  3X1S C;  1BH8 B;  4UUZ B;  5AVC A;  4WU8 B;  3X1V B;  1AOI A;  3P5J B;  1EQZ D;  3AZG D;  3AZM D;  3AV2 D;  5GSU D;  3LZ0 D;  1P3A A;  4WU9 B;  2Y2L A;  3KWQ A;  3LZ1 D;  4YM6 C;  4KUD A;  1ULY A;  3KXB D;  3AL0 C;  3WTP B;  3B0B A;  3X1V D;  3O62 A;  2FJ7 D;  1A7W A;  5AY8 C;  3V9R B;  4WU9 D;  5AVC C;  5E5A D;  1P3F D;  1ID3 A;  1W2E A;  3AZF B;  2F2A C;  2XD5 A;  5B40 D;  3KWQ C;  4JJN A;  1P3L D;  3B0C T;  3W98 B;  4KGC A;  5B32 G;  4J8W A;  5JRG C;  2DQN C;  3EPJ A;  1F66 A;  2F8N A;  2Y2Q A;  5AV8 C;  5B1L B;  3AFA B;  5AV9 C;  3AZF D;  5DNN D;  5B32 D;  1P3G C;  1KX5 C;  4J8U B;  3REL A;  3AYW B;  3MVD A;  4XZQ B;  5DNM B;  5F99 A;  3UTB A;  2VQR A;  3A6N C;  1U35 C;  1P3M B;  2PYO B;  4J8X C;  1P3B D;  5B33 B;  5B0Y A;  3B6G A;  3UTA A;  1M18 A;  5B31 C;  3F6T A;  3X1U C;  3REH C;  5CPK B;  1KX4 C;  5B1M A;  1ZLA B;  3MGS A;  1P3M D;  2PYO D;  5BO0 A;  1P3P A;  1B6W A;  1HQ3 D;  3TU4 D;  1S32 B;  1M19 B;  2Y2O A;  2YFW A;  3X1T B;  2Y2J A;  5BS7 C;  1P3K D;  5B0Y C;  3REI A;  5GT3 D;  1TAF B;  2F8N K;  3B6F B;  5CPI B;  3KUY D;  3AZL B;  5GSU A;  1AOI D;  4LD9 B;  1H3O B;  2CV5 A;  1P3A D;  5CP6 C;  5CPI D;  2BG1 A;  5B2I C;  4KUD D;  1BH8 A;  4WNN B;  4UUZ A;  4WU8 A;  3MGR C;  3X1V A;  2IO5 B;  3B0D C;  3REJ D;  2HIO C;  3O62 D;  4LD9 D;  4WU9 A;  3W99 B;  1Q9C A;  1KX3 B;  3C1C C;  1P3F A;  1EQZ C;  4G92 B;  3AZG C;  3AZM C;  5GSU C;  3LZ0 C;  3WTP A;  3AV2 C;  5JA4 B;  1ID3 D;  5AV6 D;  3AZK B;  3LZ1 C;  3KXB C;  3C1B B;  4JJN D;  3V9R A;  4KGC D;  3WAA B;  4QLC B;  4J8W D;  1KX3 D;  4ZUX D;  2FJ7 C;  3AZF A;  4H9S A;  3W96 C;  5E5A C;  5BNX B;  3W98 A;  5B2J C;  3MGQ B;  4DQY B;  4EO5 B;  3VH6 T;  5GXQ C;  3MVD D;  5B40 C;  5F99 D;  3UTB D;  1P3L C;  2Y2H A;  4H9O B;  5B1L A;  4X23 B;  4CSR B;  3AFA A;  4J8U A;  3AYW A;  1JFI B;  4XZQ A;  4H9P B;  5DNM A;  5DNN C;  3LJA B;  5B32 C;  3B6G D;  3A1I A;  3H0M C;  3UTA D;  1M18 D;  1P3M A;  4X23 D;  2PYO A;  3AZI B;  3AZJ D;  5B33 A;  2HUE C;  3REK C;  1P3P D;  4R8P B;  1P3B C;  3AV1 B;  4Z2M G;  1ZLA A;  5CPK A;  3LEL B;  1PZR A;  4H9R A;  4CAY B;  3WTP E;  1S32 A;  1M19 A;  4R8P D;  1P3O B;  3W97 C;  4J8V B;  3X1T A;  1HQ3 C;  5BNV B;  3TU4 C;  2G5H C;  3VH5 T;  3WA9 B;  1TAF A;  3B0C W;  3B6F A;  5BT1 D;  5CPI A;  1TZY C;  2F8N H;  1P3K C;  2CV5 D;  3AN2 B;  5GT3 C;  3AZL A;  1P3O D;  4J8V D;  3KUY C;  4WU8 D;  3REJ A;  4LD9 A;  1H3O A;  2FFF B;  3WA9 D;  2NQB B;  5G49 B;  1AOI C;  2ZY4 A;  4WNN A;  3UT9 B;  2Y2P A;  5AV6 A;  3AZN B;  1P3A C;  3WTP D;  2RIQ A;  1P3I B;  4KUD C;  3W99 A;  4G91 B;  3EPK A;  1KX3 A;  2G5I C;  4ZUX A;  2NQB D;  4HGA C;  3O62 C;  5GT0 B;  5JA4 A;  2ZY2 A;  4Z66 B;  4XUJ B;  3AZK A;  2ARO B;  5B0Z B;  3C1B A;  1P3I D;  5B24 B;  3W98 D;  1N1J B;  4QLC A;  3WAA A;  1ID3 C;  5AV6 C;  4JJN C;  3AZE B;  2DF4 C;  5GT0 D;  4KGC C;  5B1L D;  4Z66 D;  4XUJ D;  4J8W C;  3AFA D;  5BNX A;  4ZUX C;  1Z2C B;  2NZD B;  1F66 C;  3MGQ A;  4J8U D;  3AYW D;  5C3I C;  1M1A B;  5AVB B;  5DNM D;  2Y2M A;  4XZQ D;  4Z5T B;  4H9O A;  4X23 A;  4CSR A;  1BH9 B;  3AZE D;  3REL C;  3AZJ A;  3MVD C;  3AZH B;  3MNN B;  4YS3 B;  5F99 C;  3UTB C;  1JFI A;  4NE3 A;  4H9P A;  5B33 D;  3NQJ B;  5AVB D;  4DRA A;  1ZLA D;  5CPK D;  3AZI A;  5AV5 B;  1P34 B;  5CPJ B;  4YS3 D;  1KU5 A;  4WZS B;  3B6G C;  3WKJ B;  3UTA C;  2RVQ D;  1M18 C;  3MGP B;  1T3U A;  4R8P A;  3X1S B;  3AV1 A;  5B1M C;  3MGS C;  3AZJ C;  1BFM A;  1S32 D;  3LEL A;  5FUG B;  1M19 D;  3EPH A;  1P3P C;  3X1T D;  2Y2K A;  5AV5 D;  1P34 D;  4CAY A;  4YM6 B;  3KSY A;  3B6F D;  1P3O A;  4J8V A;  3REI C;  5BNV A;  3AZL D;  2BYM B;  3R45 B;  5AY8 B;  3WA9 A;  5AVC B;  2JE5 A;  4AWL C;  3VH6 W;  2YFV B;  3AN2 A;  3AZJ B;  3KWQ B;  4ZBJ C;  5BT1 C;  4E44 A;  2CV5 C;  5JRG B;  4E45 A;  3EG5 B;  5AV8 B;  2NQB A;  5G49 A;  3W99 D;  2Y2G A;  3X1V C;  4WU8 C;  5AV9 B;  3UT9 A;  3AZN A;  1P3G B;  1KX5 B;  3H0R C;  4WU9 C;  1P3I A;  3AZK D;  1P3F C;  3C1B D;  3A6N B;  3VH6 A;  3WTP C;  1U35 B;  3WAA D;  4QLC D;  5GT0 A;  4J8X B;  4Z66 A;  4XUJ A;  2ARO A;  1P3G D;  5B0Z A;  1N1J A;  5B31 B;  3A6N D;  3MGQ D;  3X1U B;  3AZF C;  3REH B;  1KX4 B;  4H9S C;  3AZE A;  3W98 C;  3VH5 W;  2NZD A;  1M1A A;  5AVB A;  5B1L C;  4Z5T A;  2ZM5 A;  3AFA C;  3LJA D;  3REH D;  5B0Y B;  1BH9 A;  4J8U C;  3AYW C;  3AZH A;  4XZQ C;  5DNM C;  3MNN A;  4YS3 A;  4NFT A;  2Y2N A;  3AZI D;  2J8P A;  1P3M C;  2PYO C;  3AV1 D;  5B33 C;  3LEL D;  3VH5 A;  5AV5 A;  1P34 A;  5CPJ A;  3WKJ A;  4WV4 B;  2XD1 A;  5CP6 B;  5B2I B;  3MGP A;  1ZLA C;  5CPK C;  3X1S A;  3MGR B;  5FUG A;  3B0D B;  2RVQ C;  1WWS A;  2HIO B;  1S32 C;  4YM6 A;  3C1C B;  1M19 C;  1EQZ B;  3AZG B;  3AZM B;  5B2I D;  5GSU B;  3LZ0 B;  1R4V A;  3AV2 B;  3X1T C;  3MGR D;  2LY8 A;  3AN2 D;  4M6B A;  3LZ1 B;  3R45 A;  3KXB B;  5AY8 A;  3B6F C;  5CPI C;  2ZY5 A;  3C1C D;  2YFV A;  3AZL C;  2FJ7 B;  4H9Q B;  3REJ C;  4LD9 C;  3W96 B;  5E5A B;  4NE5 A;  4WJ3 C;  3UT9 D;  3AZN D;  1P3F B;  5B2J B;  5JRG A;  5GXQ B;  5B40 B;  5AV8 A;  1P3L B;  2IO5 C;  5AV9 A;  1P3G A;  1KX5 A;  3NQU B;  3W96 D;  3W99 C;  1KX3 C;  5B2J D;  2ARO D;  4Z2M H;  5DNN B;  5B0Z D;  5GXQ D;  5B32 B;  3A6N A;  5B24 D;  4G92 C;  1U35 A;  3AZK C;  4J8X A;  3C1B C;  2HUE B;  3WAA C;  4QLC C;  3REK B;  1P3B B;  2NZD D;  5B31 A;  1M1A D;  3X1U A;  3LJA A;  3REH A;  1KX4 A;  4Z5T D;  3FDD A;  5CHL B;  5KDM B;  3MGQ C;  4EO5 C;  3AZH D;  3MNN D;  3REK D;  2BYK B;  3W97 B;  4X23 C;  1HQ3 B;  5BS7 A;  3TU4 B;  4DRB A;  4NE6 A;  4H9N B;  1TZY B;  3LJA C;  1P3K B;  5CPJ D;  3WKJ D;  4KHA B;  4H9R B;  5GT3 B;  3W97 D;  3MGP D;  3EPL A;  3X1S D;  3AZI C;  3KUY B;  5CP6 A;  4R8P C;  3AV1 C;  1TZY D;  5B2I A;  1AOI B;  4YM6 D;  3LEL C;  3MGR A;  1P3A B;  2HIO A;  4KUD B;  1B67 A;  3IP4 C;  5AY8 D;  3C1C A;  1P3O C;  1EQZ A;  4J8V C;  3AZG A;  3AZM A;  5AVC D;  4HGA B;  3LZ0 A;  3REJ B;  3O62 B;  3AV2 A;  1WWI A;  3LZ1 A;  3WA9 C;  3KXB A;  3KWQ D;  2L5A A;  2JCH A;  5JRG D;  1ID3 B;  5AV6 B;  3AN2 C;  2FJ7 A;  5AV8 D;  4JJN B;  4H9Q A;  4KGC B;  4J8W B;  3W96 A;  5E5A A;  5AV9 D;  3KFU G;  4ZUX B;  2F8N B;  5B2J A;  3A1K A;  1KX5 D;  1F66 B;  1F1E A;  5C3I B;  2NQB C;  5GXQ A;  5B24 A;  5B40 A;  1P3L A;  4UPK A;  2F8N G;  1HTA A;  2W8S A;  3UT9 C;  3AZN C;  3REL B;  1U35 D;  3MVD B;  1P3I C;  5B31 G;  3NQU A;  5F99 B;  4J8X D;  3UTB B;  4G91 C;  2CWE A;  1F66 D;  2F8N D;  5DNN A;  5B32 A;  5GT0 C;  2ZY3 A;  4Z66 C;  4XUJ C;  5B31 D;  3X1U D;  1KX4 D;  2ARO C;  3REL D;  5B0Z C;  3B6G B;  5B24 C;  3UTA B;  2UWX A;  1M18 B;  3REK A;  1P3B A;  5B1M B;  3MGS B;  3AZE C;  3NQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...