3MGSD

Binding of cesium ions to the nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 38
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsD00
1P3MC 3NQJA 3MGRB 3WTPB 1P3LA 3LJAC 5CP6B 3R45A 3REIC 5CP6C 5B33C 3AZKC 2BYMA 4X23B 3MGSA 3REHD 2HIOC 3KUYA 3WA9D 3AZNC 3MVDB 3B6GA 5AV5B 5DNND 5GT3B 3MVDC 4KUDD 1M19C 1H3OB 5CPIA 3MNNB 4WU9A 2BYKB 3WTPD 5DNMB 3MVDA 3B6GB 5B24D 3B6GD 3AV2D 3REKB 3AZED 2FJ7C 4X23A 3MGSB 3MNNC 5BT1D 3MGSD 1ZLAA 2PYOD 5BNXA 1HQ3B 5AVBA 3TU4C 3AZLB 4H9OA 1P3LB 3AZLD 3X1TC 1M18B 3X1TB 3A6NA 4KGCD 4H9OB 3AZFD 2JSSA 3X1TA 4X23D 2F8NG 1KX5D 3AZLA 3MVDD 3KWQA 5AVBB 4WU9D 3AZMC 5B1LD 2LY8A 4XUJC 5CPIB 1ZLAB 1KX4C 1ZLAD 3UTAD 3W98A 3UTBD 5CP6D 5GT3C 5DNMA 1BH9A 4J8XB 3RELD 3NQUA 5BT1C 1KX4A 4J8XA 5BS7A 4XZQD 4H9PB 3B6FA 2BYMB 3B0DC 3UT9C 5B33B 3TU4B 5CP6A 1HQ3C 1KX5A 4H9QA 5B0YB 3LELB 3AZIA 5KDMB 4WU8D 5B1LB 3MNND 2YFVA 3AZEC 3X1UA 3UTAC 4HGAC 3AZIC 1P3BB 3UTBB 3AZFA 1M18C 1P3GB 4NE5A 3WAAD 4WNNB 3AZMD 4WU9C 5B1MD 5CPKA 3LJAD 5B0ZA 3KSYA 4X23C 1P3IB 5BNVA 5E5AA 1H3OA 5AVBC 3VH6W 1N1JA 4Z5TA 3TU4D 2F8NK 1JFIB 5AV5A 3A6NC 1HTAA 1P3AB 3VH5A 4H9NA 4Z5TC 1WWSA 2F8ND 3AFAD 1P3FD 5AV5C 3KXBC 3C1BC 5B31G 4XUJA 3REJD 4UUZB 5G49A 4WU8C 3KXBA 5JA4B 3LZ0A 3W98C 1TAFA 3X1SA 3LJAB 5E5AD 1P3LD 3WKJA 1BH8A 5AV6A 2NQBC 4J8WC 4ZBJC 5B31C 3UT9D 4KGCA 4CAYA 3VH6T 5CHLB 1P3PC 5B40C 1P3KC 5AV6C 4G92C 4EO5C 4ZUXB 4ZBJB 4YM6B 4YM6D 5B2IA 2F8NB 4QLCB 3MGQD 3WKJD 3AZHC 5AY8D 5B24A 4WV4B 3MGRC 1KX3D 5CPJA 3O62A 3AZHA 4R8PD 2NZDD 5B24B 2CV5D 4XZQB 5E5AB 5B2JA 3B0CT 3WAAC 1P3IA 5B2IB 2F8NA 1P3GC 5JRGD 5B32G 1M1AB 5F99B 5CPKB 4R8PA 1M1AD 5AV5D 5CPJD 1P3AC 4KGCB 4J8UD 3AZFB 4LD9D 5B32B 3C1CB 2AROB 2YFWA 3WA9C 4WU8B 3LZ1C 3AZHD 3W96B 4QLCC 3O62D 4ZUXD 2NZDB 5B32C 4Z66D 3LJAA 3C1CC 3REID 5B1MA 5AV8A 1U35B 5G49B 5B2JB 3AN2A 2HIOA 5FUGB 1P3BC 3AZGD 5B31D 4G91B 5AV8D 1ULYA 5B0YC 3W96C 5F99D 3LELC 4DRAA 3WA9B 3REJC 3W97D 1EQZB 5AY8C 3AV1B 2FJ7D 4J8VA 1P3OC 1U35A 4YM6C 3REJA 2NZDA 5B2IC 1KX3A 1U35C 2CWEA 4XZQC 3UTBA 2AROA 4J8WB 3X1SB 2NZDC 3AZJB 4DRBA 5DNNC 3REHA 3A6NB 2YFVB 3MGRD 1KX3C 4UUZA 5GSUB 5B1LA 5B0ZD 5AVCA 5F99A 5CPKD 5BNXB 3AZMA 4J8UC 3UT9B 4LD9C 3WAAA 5GXQD 1P3PD 1M1AC 2L5AA 5GT0B 3W99C 1AOIA 4H9RA 4WU9B 3X1VD 1P3AA 3AYWA 1ID3B 5GT3D 1KU5A 3AZID 1N1JB 4Z5TB 3REIA 2PYOA 1A7WA 3AYWC 4XUJD 4QLCA 3VH5W 1KX4B 3MGSC 1WWIA 3W98B 3X1SD 1KX5C 3B0DB 3MGPC 4CAYB 1HQ3D 1M19B 1P3BA 2HUEB 2IO5C 1BH8B 5AV6B 4G92B 3WTPA 1P3OD 5GXQC 5AV9B 1Q9CA 3AZNA 3RELC 3UTAA 3AZIB 3B6FD 3LZ0B 3KUYD 3W99B 4KUDB 4J8VD 1M18A 3X1VB 2FJ7A 3LZ1D 4XUJB 1KX4D 1ZLAC 3RELA 4AWLC 2RVQC 3B0BA 3TU4A 1M19A 5CPIC 1P34D 1ID3D 4E45A 5B2ID 3AZJC 4H9PA 1TZYB 3MNNA 3NQUB 4JJNA 4YS3A 1TZYC 1ID3A 4YS3C 4JJNC 1P3OB 5B33D 1F66B 1TZYA 4H9RB 4Z2MH 3LZ0D 3KUYB 3C1BA 4WZSB 3KXBD 1P3MD 2FJ7B 1P3MB 4H9SA 4KUDA 3AZMB 5BS7C 1F1EA 2AROD 3KWQC 3X1SC 1S32A 4J8XD 3RELB 5AVCB 3REKD 3X1VC 3VH6A 4KUDC 5DNMD 3REHB 1S32B 5KDMA 4J8WA 1S32C 1HQ3A 3AZNB 3AZND 1P3MA 1P3LC 5B40A 1P3KA 1KX5B 2IO5B 1TZYD 3B6FC 5B33A 2BYKA 3AZKB 5GSUC 3KUYC 3C1BD 3X1UC 3B6FB 3B6GC 3W99D 3V9RB 3WTPC 3AZFC 4JJNB 4YS3B 4QLCD 3O62C 3MGQB 2F8NH 2PYOB 4G91C 1AOID 1AOIB 3MGPD 4KHAA 3VH5T 5B2JC 3AYWD 3WAAB 3AZEA 3KWQB 3R45B 5GT0A 3AV2C 2HIOB 3WTPE 5BO0A 1B6WA 3AZKD 3AZJA 4NE3A 3AV2A 5JRGB 5AV9A 3LZ1A 1R4VA 5B32A 3C1CA 1EQZD 1ID3C 4Z2MG 5AV8C 4M6BA 5GXQB 5AV9C 4J8VB 3AFAA 1P3FA 1P3PB 5B0YD 4R8PB 3LELD 3AZLC 3REKA 3AN2C 3AV1A 2CV5A 1S32D 4Z66B 3REJB 3MGPB 1U35D 5AY8B 3AV1C 1P3ID 3REKC 3REIB 4AWLB 3AZJD 3KWQD 5GT3A 5DNMC 3AYWB 5GSUD 5CPJB 5DNNB 3LZ0C 4EO5B 4ZUXC 5AY8A 4YS3D 4JJND 3UT9A 3W96D 5AV8B 4YM6A 2HUEC 4Z66A 5B31A 3W97B 4ZUXA 2NQBB 5AVBD 5GSUA 3NQJB 3AFAB 3MGRA 1P34B 1P3FB 4J8UB 1P3PA 4LD9B 5B1MB 2YFWB 2AROC 5AVCD 3LZ1B 1KX3B 1P3IC 1M18D 5JRGA 5F99C 3AZGB 3AV2B 4CSRA 4J8UA 4LD9A 5B2JD 5CPKC 1EQZA 1M1AA 5C3IB 4J8WD 1F66D 3W97A 5GT0C 5B31B 5C3IC 5B0ZC 3WA9A 5AV9D 5E5AC 1EQZC 4KHAB 4H9NB 5B1MC 3B0CW 2NQBD 3AZHB 4NE6A 1JFIA 3V9RA 2RVQD 4Z5TD 5FUGA 3AN2D 3AN2B 3AFAC 1P3FC 3AZKA 4CSRB 3MGPA 5B0ZB 2CV5C 2CV5B 3A6ND 4HGAB 2HIOD 3W96A 5GXQA 4WU8A 1TAFB 4E44A 5AV6D 3WKJC 1P34A 3WKJB 1M19D 2NQBA 5B40D 1P3KD 5B0YA 3LELA 3AV1D 3KXBB 4KGCC 1F66C 5CPID 1P34C 5BO0B 3C1BB 1B67A 5B32D 4Z66C 3C1CD 4XZQA 3UTBC 1F66A 5DNNA 3REHC 3AZEB 4J8VC 1P3OA 3O62B 3MGQC 5B1LC 5AVCC 3W98D 1P3BD 5B24C 5BNVB 5CPJC 3MGQA 5JRGC 1BH9B 4WNNA 3X1TD 1P3GA 4H9SC 3W97C 5GT0D 3AZGA 4R8PC 5B40B 1P3KB 2PYOC 4NFTA 3X1VA 1P3AD 4J8XC 1AOIC 3W99A 3AZGC 3UTAB 5JA4A 1BFMA 3X1UB 4H9QB 1P3GD 3X1UD
chains in the Genus database with same CATH superfamily
1P3MC 3NQJA 3MGRB 3WTPB 1P3LA 3LJAC 5CP6B 3R45A 3REIC 5CP6C 5B33C 3AZKC 2BYMA 4X23B 3MGSA 3REHD 2HIOC 3KUYA 3WA9D 3AZNC 3MVDB 3B6GA 3EPKA 5AV5B 5DNND 5GT3B 3MVDC 2W8SA 4KUDD 1M19C 1H3OB 2Y2KA 5CPIA 3MNNB 4WU9A 2BYKB 3WTPD 5DNMB 3MVDA 3B6GB 3H0RC 5B24D 3B6GD 3AV2D 3REKB 3AZED 2FJ7C 4X23A 3MGSB 3MNNC 5BT1D 3MGSD 1ZLAA 2PYOD 5BNXA 1HQ3B 5AVBA 3TU4C 3AZLB 4H9OA 1P3LB 3AZLD 3X1TC 1M18B 3X1TB 3A6NA 4KGCD 4H9OB 3AZFD 3EPJA 2JSSA 3X1TA 4X23D 2F8NG 2DQNC 2G5HC 1KX5D 3AZLA 3MVDD 3KWQA 5AVBB 4WU9D 3AZMC 5B1LD 2LY8A 4XUJC 5CPIB 1ZLAB 1KX4C 1ZLAD 3UTAD 3W98A 3UTBD 5CP6D 5GT3C 5DNMA 1BH9A 4J8XB 3RELD 3NQUA 5BT1C 1KX4A 4J8XA 5BS7A 4XZQD 4H9PB 3B6FA 2BYMB 3B0DC 3UT9C 5B33B 3TU4B 5CP6A 1HQ3C 1KX5A 4H9QA 5B0YB 3LELB 3AZIA 5KDMB 4WU8D 5B1LB 3MNND 2YFVA 3AZEC 3X1UA 3UTAC 4HGAC 3AZIC 2FFFB 1P3BB 3UTBB 3AZFA 1M18C 1P3GB 4NE5A 3WAAD 3F6TA 4WNNB 3AZMD 4WU9C 5B1MD 5CPKA 2Y2OA 3LJAD 5B0ZA 3KSYA 4X23C 1P3IB 2ZY4A 5BNVA 5E5AA 1H3OA 5AVBC 3VH6W 1N1JA 4Z5TA 3TU4D 2F8NK 1JFIB 5AV5A 3A6NC 1HTAA 1P3AB 3VH5A 4DQYB 4H9NA 4Z5TC 1WWSA 2F8ND 3AFAD 1P3FD 5AV5C 3KXBC 3C1BC 5B31G 4XUJA 3REJD 4UUZB 5G49A 4WU8C 3KXBA 5JA4B 3A1KA 3LZ0A 1TAFA 3X1SA 3W98C 3LJAB 5E5AD 1P3LD 3WKJA 1BH8A 5AV6A 2NQBC 4J8WC 4ZBJC 5B31C 3UT9D 4KGCA 4CAYA 3VH6T 5CHLB 1P3PC 5B40C 1P3KC 5AV6C 4G92C 4EO5C 4ZUXB 4ZBJB 4UPKA 4YM6B 4YM6D 5B2IA 2F8NB 4QLCB 3MGQD 3WKJD 3AZHC 5AY8D 5B24A 4WV4B 3MGRC 1KX3D 5CPJA 3O62A 3AZHA 4R8PD 2NZDD 5B24B 2CV5D 4XZQB 5E5AB 5B2JA 3B0CT 3WAAC 1P3IA 5B2IB 2F8NA 1P3GC 1Z2CB 5JRGD 5B32G 1M1AB 5F99B 5CPKB 4R8PA 1M1AD 5AV5D 5CPJD 1P3AC 4KGCB 4J8UD 3AZFB 4LD9D 5B32B 3C1CB 2AROB 2YFWA 3WA9C 4WU8B 3LZ1C 3AZHD 3W96B 4QLCC 3O62D 4ZUXD 2NZDB 5B32C 4Z66D 3LJAA 3C1CC 3REID 5B1MA 5AV8A 1U35B 5G49B 5B2JB 3AN2A 2HIOA 5FUGB 1P3BC 3AZGD 5B31D 4G91B 5AV8D 3H0MC 1ULYA 2Y2QA 5B0YC 3W96C 5F99D 3LELC 4DRAA 2Y2LA 3WA9B 3REJC 3W97D 3FDDA 2Y2NA 1EQZB 5AY8C 3AV1B 2FJ7D 4J8VA 1P3OC 1U35A 4YM6C 3REJA 2NZDA 5B2IC 1KX3A 1U35C 2CWEA 4XZQC 3UTBA 2AROA 4J8WB 3X1SB 2NZDC 3AZJB 4DRBA 5DNNC 3REHA 3A6NB 2YFVB 3MGRD 1KX3C 4UUZA 5GSUB 5B1LA 5B0ZD 5AVCA 5F99A 3AL0C 1T3UA 5CPKD 5BNXB 3AZMA 4J8UC 3UT9B 4LD9C 3WAAA 5GXQD 1P3PD 1M1AC 2ZM5A 2L5AA 5GT0B 3W99C 1AOIA 4H9RA 3H0LC 2Y2HA 2F2AC 4WU9B 3X1VD 1P3AA 2Y2JA 3AYWA 1ID3B 5GT3D 1KU5A 3AZID 3IP4C 1N1JB 4Z5TB 3REIA 2PYOA 1A7WA 3AYWC 4XUJD 4QLCA 1W2EA 3VH5W 3MGSC 1KX4B 1WWIA 3W98B 3X1SD 1KX5C 3B0DB 3MGPC 4CAYB 1HQ3D 1M19B 1P3BA 2HUEB 2IO5C 1BH8B 5AV6B 4G92B 3WTPA 1P3OD 5GXQC 5AV9B 1Q9CA 3AZNA 3EG5B 3RELC 3UTAA 3AZIB 3B6FD 3LZ0B 3KUYD 3W99B 4KUDB 4J8VD 1M18A 3X1VB 2FJ7A 3LZ1D 4XUJB 1KX4D 1ZLAC 3RELA 4AWLC 2RVQC 3B0BA 3TU4A 1M19A 5CPIC 1P34D 1ID3D 4E45A 5B2ID 3AZJC 4H9PA 1TZYB 3MNNA 3NQUB 4JJNA 4YS3A 2UWXA 1TZYC 1ID3A 4YS3C 4JJNC 1P3OB 5B33D 1F66B 1TZYA 4H9RB 4Z2MH 2XD5A 3LZ0D 3KUYB 3C1BA 4WZSB 3KXBD 1P3MD 2FJ7B 1P3MB 4H9SA 4KUDA 3AZMB 5BS7C 1F1EA 2AROD 2BG1A 3KWQC 3X1SC 1S32A 4J8XD 3RELB 5AVCB 3REKD 3X1VC 2Y2PA 3VH6A 4KUDC 5DNMD 3REHB 1S32B 5KDMA 4J8WA 1S32C 1HQ3A 3AZNB 3AZND 1P3MA 1P3LC 5B40A 1P3KA 1KX5B 2IO5B 1TZYD 3B6FC 5B33A 2BYKA 3AZKB 5GSUC 2Y2IA 3KUYC 3C1BD 3X1UC 3B6FB 3B6GC 3W99D 3V9RB 3A1IA 3WTPC 3AZFC 4JJNB 4YS3B 4QLCD 3O62C 3MGQB 4WJ3C 2F8NH 2Y2GA 2PYOB 4G91C 1AOID 1AOIB 3MGPD 4KHAA 3VH5T 5B2JC 3AYWD 3WAAB 3AZEA 3KWQB 3R45B 5GT0A 3AV2C 2HIOB 3EPHA 3EPLA 3WTPE 5BO0A 1B6WA 3AZKD 2DF4C 3AZJA 4NE3A 3AV2A 5JRGB 5AV9A 3LZ1A 3P5JB 1R4VA 5B32A 3C1CA 1EQZD 1ID3C 4Z2MG 5AV8C 4M6BA 5GXQB 5AV9C 4J8VB 3AFAA 1P3FA 1P3PB 5B0YD 4R8PB 3LELD 3AZLC 3REKA 3AN2C 3AV1A 2ZY3A 2CV5A 1S32D 4Z66B 3REJB 3MGPB 1U35D 5AY8B 3AV1C 1P3ID 3REKC 3REIB 2J8PA 4AWLB 3AZJD 3KWQD 5GT3A 5DNMC 3AYWB 5GSUD 5CPJB 5DNNB 3LZ0C 4EO5B 4ZUXC 5AY8A 4YS3D 4JJND 3UT9A 3W96D 5AV8B 4YM6A 2HUEC 4Z66A 5B31A 3W97B 4ZUXA 2NQBB 5AVBD 5GSUA 3NQJB 3AFAB 3MGRA 1P34B 1P3FB 4J8UB 1P3PA 4LD9B 5B1MB 2YFWB 2AROC 5AVCD 3LZ1B 1KX3B 1P3IC 1M18D 5JRGA 2XD1A 5F99C 3AZGB 3AV2B 4CSRA 4J8UA 4LD9A 5B2JD 5CPKC 1EQZA 1PZRA 5C3IB 4J8WD 1M1AA 3W97A 5GT0C 5B31B 5C3IC 1F66D 5B0ZC 2ZY2A 3WA9A 5AV9D 5E5AC 1EQZC 3KFUG 4KHAB 4H9NB 2ZY5A 5B1MC 3B0CW 2NQBD 2Y2MA 3AZHB 4NE6A 1JFIA 3V9RA 2RVQD 4Z5TD 5FUGA 3AN2D 3AN2B 3AFAC 1P3FC 3AZKA 4CSRB 3MGPA 5B0ZB 2CV5C 2CV5B 3A6ND 4HGAB 2HIOD 3W96A 5GXQA 4WU8A 2RIQA 2JE5A 1TAFB 4E44A 5AV6D 3WKJC 1P34A 3WKJB 1M19D 2NQBA 5B40D 1P3KD 5B0YA 3LELA 3AV1D 3KXBB 4KGCC 1F66C 5CPID 1P34C 5BO0B 3C1BB 1B67A 5B32D 4Z66C 3C1CD 4XZQA 3UTBC 1F66A 5DNNA 3REHC 3AZEB 4J8VC 1P3OA 3O62B 3MGQC 5B1LC 5AVCC 3W98D 1P3BD 5B24C 5BNVB 5CPJC 3MGQA 5JRGC 1BH9B 4WNNA 3X1TD 1P3GA 4H9SC 3W97C 2VQRA 5GT0D 3AZGA 4R8PC 5B40B 1P3KB 2PYOC 4NFTA 2G5IC 3X1VA 1P3AD 4J8XC 1AOIC 3W99A 3AZGC 2JCHA 3UTAB 5JA4A 1BFMA 3X1UB 4H9QB 1P3GD 3X1UD
chains in the Genus database with same CATH topology
1P3MC 3NQJA 3MGRB 3WTPB 1P3LA 3LJAC 5CP6B 3R45A 3REIC 5CP6C 5B33C 3AZKC 2BYMA 4X23B 3MGSA 3REHD 2HIOC 3KUYA 3WA9D 3AZNC 3MVDB 3B6GA 3EPKA 5AV5B 5DNND 5GT3B 3MVDC 2W8SA 4KUDD 1M19C 1H3OB 2Y2KA 5CPIA 3MNNB 4WU9A 2BYKB 3WTPD 5DNMB 3MVDA 3B6GB 3H0RC 5B24D 3B6GD 3AV2D 3REKB 3AZED 2FJ7C 4X23A 3MGSB 3MNNC 5BT1D 3MGSD 1ZLAA 2PYOD 5BNXA 1HQ3B 5AVBA 3TU4C 3AZLB 4H9OA 1P3LB 3AZLD 3X1TC 1M18B 3X1TB 3A6NA 4KGCD 4H9OB 3AZFD 3EPJA 2JSSA 3X1TA 4X23D 2F8NG 2DQNC 2G5HC 1KX5D 3AZLA 3MVDD 3KWQA 5AVBB 4WU9D 3AZMC 5B1LD 2LY8A 4XUJC 5CPIB 1ZLAB 1KX4C 1ZLAD 3UTAD 3W98A 3UTBD 5CP6D 5GT3C 5DNMA 1BH9A 4J8XB 3RELD 3NQUA 5BT1C 1KX4A 4J8XA 5BS7A 4XZQD 4H9PB 3B6FA 2BYMB 3B0DC 3UT9C 5B33B 3TU4B 5CP6A 1HQ3C 1KX5A 4H9QA 5B0YB 3LELB 3AZIA 5KDMB 4WU8D 5B1LB 3MNND 2YFVA 3AZEC 3X1UA 3UTAC 4HGAC 3AZIC 2FFFB 1P3BB 3UTBB 3AZFA 1M18C 1P3GB 4NE5A 3WAAD 3F6TA 4WNNB 3AZMD 4WU9C 5B1MD 5CPKA 2Y2OA 3LJAD 5B0ZA 3KSYA 4X23C 1P3IB 2ZY4A 5BNVA 5E5AA 1H3OA 5AVBC 3VH6W 1N1JA 4Z5TA 3TU4D 2F8NK 1JFIB 5AV5A 3A6NC 1HTAA 1P3AB 3VH5A 4DQYB 4H9NA 4Z5TC 1WWSA 2F8ND 3AFAD 1P3FD 5AV5C 3KXBC 3C1BC 5B31G 4XUJA 3REJD 4UUZB 5G49A 4WU8C 3KXBA 5JA4B 3A1KA 3LZ0A 1TAFA 3X1SA 3W98C 3LJAB 5E5AD 1P3LD 3WKJA 1BH8A 5AV6A 2NQBC 4J8WC 4ZBJC 5B31C 3UT9D 4KGCA 4CAYA 3VH6T 5CHLB 1P3PC 5B40C 1P3KC 5AV6C 4G92C 4EO5C 4ZUXB 4ZBJB 4UPKA 4YM6B 4YM6D 5B2IA 2F8NB 4QLCB 3MGQD 3WKJD 3AZHC 5AY8D 5B24A 4WV4B 3MGRC 1KX3D 5CPJA 3O62A 3AZHA 4R8PD 2NZDD 5B24B 2CV5D 4XZQB 5E5AB 5B2JA 3B0CT 3WAAC 1P3IA 5B2IB 2F8NA 1P3GC 1Z2CB 5JRGD 5B32G 1M1AB 5F99B 5CPKB 4R8PA 1M1AD 5AV5D 5CPJD 1P3AC 4KGCB 4J8UD 3AZFB 4LD9D 5B32B 3C1CB 2AROB 2YFWA 3WA9C 4WU8B 3LZ1C 3AZHD 3W96B 4QLCC 3O62D 4ZUXD 2NZDB 5B32C 4Z66D 3LJAA 3C1CC 3REID 5B1MA 5AV8A 1U35B 5G49B 5B2JB 3AN2A 2HIOA 5FUGB 1P3BC 3AZGD 5B31D 4G91B 5AV8D 3H0MC 1ULYA 2Y2QA 5B0YC 3W96C 5F99D 3LELC 4DRAA 2Y2LA 3WA9B 3REJC 3W97D 3FDDA 2Y2NA 1EQZB 5AY8C 3AV1B 2FJ7D 4J8VA 1P3OC 1U35A 4YM6C 3REJA 2NZDA 5B2IC 1KX3A 1U35C 2CWEA 4XZQC 3UTBA 2AROA 4J8WB 3X1SB 2NZDC 3AZJB 4DRBA 5DNNC 3REHA 3A6NB 2YFVB 3MGRD 1KX3C 4UUZA 5GSUB 5B1LA 5B0ZD 5AVCA 5F99A 3AL0C 1T3UA 5CPKD 5BNXB 3AZMA 4J8UC 3UT9B 4LD9C 3WAAA 5GXQD 1P3PD 1M1AC 2ZM5A 2L5AA 5GT0B 3W99C 1AOIA 4H9RA 3H0LC 2Y2HA 2F2AC 4WU9B 3X1VD 1P3AA 2Y2JA 3AYWA 1ID3B 5GT3D 1KU5A 3AZID 3IP4C 1N1JB 4Z5TB 3REIA 2PYOA 1A7WA 3AYWC 4XUJD 4QLCA 1W2EA 3VH5W 3MGSC 1KX4B 1WWIA 3W98B 3X1SD 1KX5C 3B0DB 3MGPC 4CAYB 1HQ3D 1M19B 1P3BA 2HUEB 2IO5C 1BH8B 5AV6B 4G92B 3WTPA 1P3OD 5GXQC 5AV9B 1Q9CA 3AZNA 3EG5B 3RELC 3UTAA 3AZIB 3B6FD 3LZ0B 3KUYD 3W99B 4KUDB 4J8VD 1M18A 3X1VB 2FJ7A 3LZ1D 4XUJB 1KX4D 1ZLAC 3RELA 4AWLC 2RVQC 3B0BA 3TU4A 1M19A 5CPIC 1P34D 1ID3D 4E45A 5B2ID 3AZJC 4H9PA 1TZYB 3MNNA 3NQUB 4JJNA 4YS3A 2UWXA 1TZYC 1ID3A 4YS3C 4JJNC 1P3OB 5B33D 1F66B 1TZYA 4H9RB 4Z2MH 2XD5A 3LZ0D 3KUYB 3C1BA 4WZSB 3KXBD 1P3MD 2FJ7B 1P3MB 4H9SA 4KUDA 3AZMB 5BS7C 1F1EA 2AROD 2BG1A 3KWQC 3X1SC 1S32A 4J8XD 3RELB 5AVCB 3REKD 3X1VC 2Y2PA 3VH6A 4KUDC 5DNMD 3REHB 1S32B 5KDMA 4J8WA 1S32C 1HQ3A 3AZNB 3AZND 1P3MA 1P3LC 5B40A 1P3KA 1KX5B 2IO5B 1TZYD 3B6FC 5B33A 2BYKA 3AZKB 5GSUC 2Y2IA 3KUYC 3C1BD 3X1UC 3B6FB 3B6GC 3W99D 3V9RB 3A1IA 3WTPC 3AZFC 4JJNB 4YS3B 4QLCD 3O62C 3MGQB 4WJ3C 2F8NH 2Y2GA 2PYOB 4G91C 1AOID 1AOIB 3MGPD 4KHAA 3VH5T 5B2JC 3AYWD 3WAAB 3AZEA 3KWQB 3R45B 5GT0A 3AV2C 2HIOB 3EPHA 3EPLA 3WTPE 5BO0A 1B6WA 3AZKD 2DF4C 3AZJA 4NE3A 3AV2A 5JRGB 5AV9A 3LZ1A 3P5JB 1R4VA 5B32A 3C1CA 1EQZD 1ID3C 4Z2MG 5AV8C 4M6BA 5GXQB 5AV9C 4J8VB 3AFAA 1P3FA 1P3PB 5B0YD 4R8PB 3LELD 3AZLC 3REKA 3AN2C 3AV1A 2ZY3A 2CV5A 1S32D 4Z66B 3REJB 3MGPB 1U35D 5AY8B 3AV1C 1P3ID 3REKC 3REIB 2J8PA 4AWLB 3AZJD 3KWQD 5GT3A 5DNMC 3AYWB 5GSUD 5CPJB 5DNNB 3LZ0C 4EO5B 4ZUXC 5AY8A 4YS3D 4JJND 3UT9A 3W96D 5AV8B 4YM6A 2HUEC 4Z66A 5B31A 3W97B 4ZUXA 2NQBB 5AVBD 5GSUA 3NQJB 3AFAB 3MGRA 1P34B 1P3FB 4J8UB 1P3PA 4LD9B 5B1MB 2YFWB 2AROC 5AVCD 3LZ1B 1KX3B 1P3IC 1M18D 5JRGA 2XD1A 5F99C 3AZGB 3AV2B 4CSRA 4J8UA 4LD9A 5B2JD 5CPKC 1EQZA 1PZRA 5C3IB 4J8WD 1M1AA 3W97A 5GT0C 5B31B 5C3IC 1F66D 5B0ZC 2ZY2A 3WA9A 5AV9D 5E5AC 1EQZC 3KFUG 4KHAB 4H9NB 2ZY5A 5B1MC 3B0CW 2NQBD 2Y2MA 3AZHB 4NE6A 1JFIA 3V9RA 2RVQD 4Z5TD 5FUGA 3AN2D 3AN2B 3AFAC 1P3FC 3AZKA 4CSRB 3MGPA 5B0ZB 2CV5C 2CV5B 3A6ND 4HGAB 2HIOD 3W96A 5GXQA 4WU8A 2RIQA 2JE5A 1TAFB 4E44A 5AV6D 3WKJC 1P34A 3WKJB 1M19D 2NQBA 5B40D 1P3KD 5B0YA 3LELA 3AV1D 3KXBB 4KGCC 1F66C 5CPID 1P34C 5BO0B 3C1BB 1B67A 5B32D 4Z66C 3C1CD 4XZQA 3UTBC 1F66A 5DNNA 3REHC 3AZEB 4J8VC 1P3OA 3O62B 3MGQC 5B1LC 5AVCC 3W98D 1P3BD 5B24C 5BNVB 5CPJC 3MGQA 5JRGC 1BH9B 4WNNA 3X1TD 1P3GA 4H9SC 3W97C 2VQRA 5GT0D 3AZGA 4R8PC 5B40B 1P3KB 2PYOC 4NFTA 2G5IC 3X1VA 1P3AD 4J8XC 1AOIC 3W99A 3AZGC 2JCHA 3UTAB 5JA4A 1BFMA 3X1UB 4H9QB 1P3GD 3X1UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M C;  3NQJ A;  3MGR B;  3WTP B;  1P3L A;  3LJA C;  5CP6 B;  3R45 A;  3REI C;  5CP6 C;  5B33 C;  3AZK C;  2BYM A;  4X23 B;  3MGS A;  3REH D;  2HIO C;  3KUY A;  3WA9 D;  3AZN C;  3MVD B;  3B6G A;  5AV5 B;  5DNN D;  5GT3 B;  3MVD C;  4KUD D;  1M19 C;  1H3O B;  5CPI A;  3MNN B;  4WU9 A;  2BYK B;  3WTP D;  5DNM B;  3MVD A;  3B6G B;  5B24 D;  3B6G D;  3AV2 D;  3REK B;  3AZE D;  2FJ7 C;  4X23 A;  3MGS B;  3MNN C;  5BT1 D;  3MGS D;  1ZLA A;  2PYO D;  5BNX A;  1HQ3 B;  5AVB A;  3TU4 C;  3AZL B;  4H9O A;  1P3L B;  3AZL D;  3X1T C;  1M18 B;  3X1T B;  3A6N A;  4KGC D;  4H9O B;  3AZF D;  2JSS A;  3X1T A;  4X23 D;  2F8N G;  1KX5 D;  3AZL A;  3MVD D;  3KWQ A;  5AVB B;  4WU9 D;  3AZM C;  5B1L D;  2LY8 A;  4XUJ C;  5CPI B;  1ZLA B;  1KX4 C;  1ZLA D;  3UTA D;  3W98 A;  3UTB D;  5CP6 D;  5GT3 C;  5DNM A;  1BH9 A;  4J8X B;  3REL D;  3NQU A;  5BT1 C;  1KX4 A;  4J8X A;  5BS7 A;  4XZQ D;  4H9P B;  3B6F A;  2BYM B;  3B0D C;  3UT9 C;  5B33 B;  3TU4 B;  5CP6 A;  1HQ3 C;  1KX5 A;  4H9Q A;  5B0Y B;  3LEL B;  3AZI A;  5KDM B;  4WU8 D;  5B1L B;  3MNN D;  2YFV A;  3AZE C;  3X1U A;  3UTA C;  4HGA C;  3AZI C;  1P3B B;  3UTB B;  3AZF A;  1M18 C;  1P3G B;  4NE5 A;  3WAA D;  4WNN B;  3AZM D;  4WU9 C;  5B1M D;  5CPK A;  3LJA D;  5B0Z A;  3KSY A;  4X23 C;  1P3I B;  5BNV A;  5E5A A;  1H3O A;  5AVB C;  3VH6 W;  1N1J A;  4Z5T A;  3TU4 D;  2F8N K;  1JFI B;  5AV5 A;  3A6N C;  1HTA A;  1P3A B;  3VH5 A;  4H9N A;  4Z5T C;  1WWS A;  2F8N D;  3AFA D;  1P3F D;  5AV5 C;  3KXB C;  3C1B C;  5B31 G;  4XUJ A;  3REJ D;  4UUZ B;  5G49 A;  4WU8 C;  3KXB A;  5JA4 B;  3LZ0 A;  3W98 C;  1TAF A;  3X1S A;  3LJA B;  5E5A D;  1P3L D;  3WKJ A;  1BH8 A;  5AV6 A;  2NQB C;  4J8W C;  4ZBJ C;  5B31 C;  3UT9 D;  4KGC A;  4CAY A;  3VH6 T;  5CHL B;  1P3P C;  5B40 C;  1P3K C;  5AV6 C;  4G92 C;  4EO5 C;  4ZUX B;  4ZBJ B;  4YM6 B;  4YM6 D;  5B2I A;  2F8N B;  4QLC B;  3MGQ D;  3WKJ D;  3AZH C;  5AY8 D;  5B24 A;  4WV4 B;  3MGR C;  1KX3 D;  5CPJ A;  3O62 A;  3AZH A;  4R8P D;  2NZD D;  5B24 B;  2CV5 D;  4XZQ B;  5E5A B;  5B2J A;  3B0C T;  3WAA C;  1P3I A;  5B2I B;  2F8N A;  1P3G C;  5JRG D;  5B32 G;  1M1A B;  5F99 B;  5CPK B;  4R8P A;  1M1A D;  5AV5 D;  5CPJ D;  1P3A C;  4KGC B;  4J8U D;  3AZF B;  4LD9 D;  5B32 B;  3C1C B;  2ARO B;  2YFW A;  3WA9 C;  4WU8 B;  3LZ1 C;  3AZH D;  3W96 B;  4QLC C;  3O62 D;  4ZUX D;  2NZD B;  5B32 C;  4Z66 D;  3LJA A;  3C1C C;  3REI D;  5B1M A;  5AV8 A;  1U35 B;  5G49 B;  5B2J B;  3AN2 A;  2HIO A;  5FUG B;  1P3B C;  3AZG D;  5B31 D;  4G91 B;  5AV8 D;  1ULY A;  5B0Y C;  3W96 C;  5F99 D;  3LEL C;  4DRA A;  3WA9 B;  3REJ C;  3W97 D;  1EQZ B;  5AY8 C;  3AV1 B;  2FJ7 D;  4J8V A;  1P3O C;  1U35 A;  4YM6 C;  3REJ A;  2NZD A;  5B2I C;  1KX3 A;  1U35 C;  2CWE A;  4XZQ C;  3UTB A;  2ARO A;  4J8W B;  3X1S B;  2NZD C;  3AZJ B;  4DRB A;  5DNN C;  3REH A;  3A6N B;  2YFV B;  3MGR D;  1KX3 C;  4UUZ A;  5GSU B;  5B1L A;  5B0Z D;  5AVC A;  5F99 A;  5CPK D;  5BNX B;  3AZM A;  4J8U C;  3UT9 B;  4LD9 C;  3WAA A;  5GXQ D;  1P3P D;  1M1A C;  2L5A A;  5GT0 B;  3W99 C;  1AOI A;  4H9R A;  4WU9 B;  3X1V D;  1P3A A;  3AYW A;  1ID3 B;  5GT3 D;  1KU5 A;  3AZI D;  1N1J B;  4Z5T B;  3REI A;  2PYO A;  1A7W A;  3AYW C;  4XUJ D;  4QLC A;  3VH5 W;  1KX4 B;  3MGS C;  1WWI A;  3W98 B;  3X1S D;  1KX5 C;  3B0D B;  3MGP C;  4CAY B;  1HQ3 D;  1M19 B;  1P3B A;  2HUE B;  2IO5 C;  1BH8 B;  5AV6 B;  4G92 B;  3WTP A;  1P3O D;  5GXQ C;  5AV9 B;  1Q9C A;  3AZN A;  3REL C;  3UTA A;  3AZI B;  3B6F D;  3LZ0 B;  3KUY D;  3W99 B;  4KUD B;  4J8V D;  1M18 A;  3X1V B;  2FJ7 A;  3LZ1 D;  4XUJ B;  1KX4 D;  1ZLA C;  3REL A;  4AWL C;  2RVQ C;  3B0B A;  3TU4 A;  1M19 A;  5CPI C;  1P34 D;  1ID3 D;  4E45 A;  5B2I D;  3AZJ C;  4H9P A;  1TZY B;  3MNN A;  3NQU B;  4JJN A;  4YS3 A;  1TZY C;  1ID3 A;  4YS3 C;  4JJN C;  1P3O B;  5B33 D;  1F66 B;  1TZY A;  4H9R B;  4Z2M H;  3LZ0 D;  3KUY B;  3C1B A;  4WZS B;  3KXB D;  1P3M D;  2FJ7 B;  1P3M B;  4H9S A;  4KUD A;  3AZM B;  5BS7 C;  1F1E A;  2ARO D;  3KWQ C;  3X1S C;  1S32 A;  4J8X D;  3REL B;  5AVC B;  3REK D;  3X1V C;  3VH6 A;  4KUD C;  5DNM D;  3REH B;  1S32 B;  5KDM A;  4J8W A;  1S32 C;  1HQ3 A;  3AZN B;  3AZN D;  1P3M A;  1P3L C;  5B40 A;  1P3K A;  1KX5 B;  2IO5 B;  1TZY D;  3B6F C;  5B33 A;  2BYK A;  3AZK B;  5GSU C;  3KUY C;  3C1B D;  3X1U C;  3B6F B;  3B6G C;  3W99 D;  3V9R B;  3WTP C;  3AZF C;  4JJN B;  4YS3 B;  4QLC D;  3O62 C;  3MGQ B;  2F8N H;  2PYO B;  4G91 C;  1AOI D;  1AOI B;  3MGP D;  4KHA A;  3VH5 T;  5B2J C;  3AYW D;  3WAA B;  3AZE A;  3KWQ B;  3R45 B;  5GT0 A;  3AV2 C;  2HIO B;  3WTP E;  5BO0 A;  1B6W A;  3AZK D;  3AZJ A;  4NE3 A;  3AV2 A;  5JRG B;  5AV9 A;  3LZ1 A;  1R4V A;  5B32 A;  3C1C A;  1EQZ D;  1ID3 C;  4Z2M G;  5AV8 C;  4M6B A;  5GXQ B;  5AV9 C;  4J8V B;  3AFA A;  1P3F A;  1P3P B;  5B0Y D;  4R8P B;  3LEL D;  3AZL C;  3REK A;  3AN2 C;  3AV1 A;  2CV5 A;  1S32 D;  4Z66 B;  3REJ B;  3MGP B;  1U35 D;  5AY8 B;  3AV1 C;  1P3I D;  3REK C;  3REI B;  4AWL B;  3AZJ D;  3KWQ D;  5GT3 A;  5DNM C;  3AYW B;  5GSU D;  5CPJ B;  5DNN B;  3LZ0 C;  4EO5 B;  4ZUX C;  5AY8 A;  4YS3 D;  4JJN D;  3UT9 A;  3W96 D;  5AV8 B;  4YM6 A;  2HUE C;  4Z66 A;  5B31 A;  3W97 B;  4ZUX A;  2NQB B;  5AVB D;  5GSU A;  3NQJ B;  3AFA B;  3MGR A;  1P34 B;  1P3F B;  4J8U B;  1P3P A;  4LD9 B;  5B1M B;  2YFW B;  2ARO C;  5AVC D;  3LZ1 B;  1KX3 B;  1P3I C;  1M18 D;  5JRG A;  5F99 C;  3AZG B;  3AV2 B;  4CSR A;  4J8U A;  4LD9 A;  5B2J D;  5CPK C;  1EQZ A;  1M1A A;  5C3I B;  4J8W D;  1F66 D;  3W97 A;  5GT0 C;  5B31 B;  5C3I C;  5B0Z C;  3WA9 A;  5AV9 D;  5E5A C;  1EQZ C;  4KHA B;  4H9N B;  5B1M C;  3B0C W;  2NQB D;  3AZH B;  4NE6 A;  1JFI A;  3V9R A;  2RVQ D;  4Z5T D;  5FUG A;  3AN2 D;  3AN2 B;  3AFA C;  1P3F C;  3AZK A;  4CSR B;  3MGP A;  5B0Z B;  2CV5 C;  2CV5 B;  3A6N D;  4HGA B;  2HIO D;  3W96 A;  5GXQ A;  4WU8 A;  1TAF B;  4E44 A;  5AV6 D;  3WKJ C;  1P34 A;  3WKJ B;  1M19 D;  2NQB A;  5B40 D;  1P3K D;  5B0Y A;  3LEL A;  3AV1 D;  3KXB B;  4KGC C;  1F66 C;  5CPI D;  1P34 C;  5BO0 B;  3C1B B;  1B67 A;  5B32 D;  4Z66 C;  3C1C D;  4XZQ A;  3UTB C;  1F66 A;  5DNN A;  3REH C;  3AZE B;  4J8V C;  1P3O A;  3O62 B;  3MGQ C;  5B1L C;  5AVC C;  3W98 D;  1P3B D;  5B24 C;  5BNV B;  5CPJ C;  3MGQ A;  5JRG C;  1BH9 B;  4WNN A;  3X1T D;  1P3G A;  4H9S C;  3W97 C;  5GT0 D;  3AZG A;  4R8P C;  5B40 B;  1P3K B;  2PYO C;  4NFT A;  3X1V A;  1P3A D;  4J8X C;  1AOI C;  3W99 A;  3AZG C;  3UTA B;  5JA4 A;  1BFM A;  3X1U B;  4H9Q B;  1P3G D;  3X1U D; 
#chains in the Genus database with same CATH topology
 1P3M C;  3NQJ A;  3MGR B;  3WTP B;  1P3L A;  3LJA C;  5CP6 B;  3R45 A;  3REI C;  5CP6 C;  5B33 C;  3AZK C;  2BYM A;  4X23 B;  3MGS A;  3REH D;  2HIO C;  3KUY A;  3WA9 D;  3AZN C;  3MVD B;  3B6G A;  3EPK A;  5AV5 B;  5DNN D;  5GT3 B;  3MVD C;  2W8S A;  4KUD D;  1M19 C;  1H3O B;  2Y2K A;  5CPI A;  3MNN B;  4WU9 A;  2BYK B;  3WTP D;  5DNM B;  3MVD A;  3B6G B;  3H0R C;  5B24 D;  3B6G D;  3AV2 D;  3REK B;  3AZE D;  2FJ7 C;  4X23 A;  3MGS B;  3MNN C;  5BT1 D;  3MGS D;  1ZLA A;  2PYO D;  5BNX A;  1HQ3 B;  5AVB A;  3TU4 C;  3AZL B;  4H9O A;  1P3L B;  3AZL D;  3X1T C;  1M18 B;  3X1T B;  3A6N A;  4KGC D;  4H9O B;  3AZF D;  3EPJ A;  2JSS A;  3X1T A;  4X23 D;  2F8N G;  2DQN C;  2G5H C;  1KX5 D;  3AZL A;  3MVD D;  3KWQ A;  5AVB B;  4WU9 D;  3AZM C;  5B1L D;  2LY8 A;  4XUJ C;  5CPI B;  1ZLA B;  1KX4 C;  1ZLA D;  3UTA D;  3W98 A;  3UTB D;  5CP6 D;  5GT3 C;  5DNM A;  1BH9 A;  4J8X B;  3REL D;  3NQU A;  5BT1 C;  1KX4 A;  4J8X A;  5BS7 A;  4XZQ D;  4H9P B;  3B6F A;  2BYM B;  3B0D C;  3UT9 C;  5B33 B;  3TU4 B;  5CP6 A;  1HQ3 C;  1KX5 A;  4H9Q A;  5B0Y B;  3LEL B;  3AZI A;  5KDM B;  4WU8 D;  5B1L B;  3MNN D;  2YFV A;  3AZE C;  3X1U A;  3UTA C;  4HGA C;  3AZI C;  2FFF B;  1P3B B;  3UTB B;  3AZF A;  1M18 C;  1P3G B;  4NE5 A;  3WAA D;  3F6T A;  4WNN B;  3AZM D;  4WU9 C;  5B1M D;  5CPK A;  2Y2O A;  3LJA D;  5B0Z A;  3KSY A;  4X23 C;  1P3I B;  2ZY4 A;  5BNV A;  5E5A A;  1H3O A;  5AVB C;  3VH6 W;  1N1J A;  4Z5T A;  3TU4 D;  2F8N K;  1JFI B;  5AV5 A;  3A6N C;  1HTA A;  1P3A B;  3VH5 A;  4DQY B;  4H9N A;  4Z5T C;  1WWS A;  2F8N D;  3AFA D;  1P3F D;  5AV5 C;  3KXB C;  3C1B C;  5B31 G;  4XUJ A;  3REJ D;  4UUZ B;  5G49 A;  4WU8 C;  3KXB A;  5JA4 B;  3A1K A;  3LZ0 A;  1TAF A;  3X1S A;  3W98 C;  3LJA B;  5E5A D;  1P3L D;  3WKJ A;  1BH8 A;  5AV6 A;  2NQB C;  4J8W C;  4ZBJ C;  5B31 C;  3UT9 D;  4KGC A;  4CAY A;  3VH6 T;  5CHL B;  1P3P C;  5B40 C;  1P3K C;  5AV6 C;  4G92 C;  4EO5 C;  4ZUX B;  4ZBJ B;  4UPK A;  4YM6 B;  4YM6 D;  5B2I A;  2F8N B;  4QLC B;  3MGQ D;  3WKJ D;  3AZH C;  5AY8 D;  5B24 A;  4WV4 B;  3MGR C;  1KX3 D;  5CPJ A;  3O62 A;  3AZH A;  4R8P D;  2NZD D;  5B24 B;  2CV5 D;  4XZQ B;  5E5A B;  5B2J A;  3B0C T;  3WAA C;  1P3I A;  5B2I B;  2F8N A;  1P3G C;  1Z2C B;  5JRG D;  5B32 G;  1M1A B;  5F99 B;  5CPK B;  4R8P A;  1M1A D;  5AV5 D;  5CPJ D;  1P3A C;  4KGC B;  4J8U D;  3AZF B;  4LD9 D;  5B32 B;  3C1C B;  2ARO B;  2YFW A;  3WA9 C;  4WU8 B;  3LZ1 C;  3AZH D;  3W96 B;  4QLC C;  3O62 D;  4ZUX D;  2NZD B;  5B32 C;  4Z66 D;  3LJA A;  3C1C C;  3REI D;  5B1M A;  5AV8 A;  1U35 B;  5G49 B;  5B2J B;  3AN2 A;  2HIO A;  5FUG B;  1P3B C;  3AZG D;  5B31 D;  4G91 B;  5AV8 D;  3H0M C;  1ULY A;  2Y2Q A;  5B0Y C;  3W96 C;  5F99 D;  3LEL C;  4DRA A;  2Y2L A;  3WA9 B;  3REJ C;  3W97 D;  3FDD A;  2Y2N A;  1EQZ B;  5AY8 C;  3AV1 B;  2FJ7 D;  4J8V A;  1P3O C;  1U35 A;  4YM6 C;  3REJ A;  2NZD A;  5B2I C;  1KX3 A;  1U35 C;  2CWE A;  4XZQ C;  3UTB A;  2ARO A;  4J8W B;  3X1S B;  2NZD C;  3AZJ B;  4DRB A;  5DNN C;  3REH A;  3A6N B;  2YFV B;  3MGR D;  1KX3 C;  4UUZ A;  5GSU B;  5B1L A;  5B0Z D;  5AVC A;  5F99 A;  3AL0 C;  1T3U A;  5CPK D;  5BNX B;  3AZM A;  4J8U C;  3UT9 B;  4LD9 C;  3WAA A;  5GXQ D;  1P3P D;  1M1A C;  2ZM5 A;  2L5A A;  5GT0 B;  3W99 C;  1AOI A;  4H9R A;  3H0L C;  2Y2H A;  2F2A C;  4WU9 B;  3X1V D;  1P3A A;  2Y2J A;  3AYW A;  1ID3 B;  5GT3 D;  1KU5 A;  3AZI D;  3IP4 C;  1N1J B;  4Z5T B;  3REI A;  2PYO A;  1A7W A;  3AYW C;  4XUJ D;  4QLC A;  1W2E A;  3VH5 W;  3MGS C;  1KX4 B;  1WWI A;  3W98 B;  3X1S D;  1KX5 C;  3B0D B;  3MGP C;  4CAY B;  1HQ3 D;  1M19 B;  1P3B A;  2HUE B;  2IO5 C;  1BH8 B;  5AV6 B;  4G92 B;  3WTP A;  1P3O D;  5GXQ C;  5AV9 B;  1Q9C A;  3AZN A;  3EG5 B;  3REL C;  3UTA A;  3AZI B;  3B6F D;  3LZ0 B;  3KUY D;  3W99 B;  4KUD B;  4J8V D;  1M18 A;  3X1V B;  2FJ7 A;  3LZ1 D;  4XUJ B;  1KX4 D;  1ZLA C;  3REL A;  4AWL C;  2RVQ C;  3B0B A;  3TU4 A;  1M19 A;  5CPI C;  1P34 D;  1ID3 D;  4E45 A;  5B2I D;  3AZJ C;  4H9P A;  1TZY B;  3MNN A;  3NQU B;  4JJN A;  4YS3 A;  2UWX A;  1TZY C;  1ID3 A;  4YS3 C;  4JJN C;  1P3O B;  5B33 D;  1F66 B;  1TZY A;  4H9R B;  4Z2M H;  2XD5 A;  3LZ0 D;  3KUY B;  3C1B A;  4WZS B;  3KXB D;  1P3M D;  2FJ7 B;  1P3M B;  4H9S A;  4KUD A;  3AZM B;  5BS7 C;  1F1E A;  2ARO D;  2BG1 A;  3KWQ C;  3X1S C;  1S32 A;  4J8X D;  3REL B;  5AVC B;  3REK D;  3X1V C;  2Y2P A;  3VH6 A;  4KUD C;  5DNM D;  3REH B;  1S32 B;  5KDM A;  4J8W A;  1S32 C;  1HQ3 A;  3AZN B;  3AZN D;  1P3M A;  1P3L C;  5B40 A;  1P3K A;  1KX5 B;  2IO5 B;  1TZY D;  3B6F C;  5B33 A;  2BYK A;  3AZK B;  5GSU C;  2Y2I A;  3KUY C;  3C1B D;  3X1U C;  3B6F B;  3B6G C;  3W99 D;  3V9R B;  3A1I A;  3WTP C;  3AZF C;  4JJN B;  4YS3 B;  4QLC D;  3O62 C;  3MGQ B;  4WJ3 C;  2F8N H;  2Y2G A;  2PYO B;  4G91 C;  1AOI D;  1AOI B;  3MGP D;  4KHA A;  3VH5 T;  5B2J C;  3AYW D;  3WAA B;  3AZE A;  3KWQ B;  3R45 B;  5GT0 A;  3AV2 C;  2HIO B;  3EPH A;  3EPL A;  3WTP E;  5BO0 A;  1B6W A;  3AZK D;  2DF4 C;  3AZJ A;  4NE3 A;  3AV2 A;  5JRG B;  5AV9 A;  3LZ1 A;  3P5J B;  1R4V A;  5B32 A;  3C1C A;  1EQZ D;  1ID3 C;  4Z2M G;  5AV8 C;  4M6B A;  5GXQ B;  5AV9 C;  4J8V B;  3AFA A;  1P3F A;  1P3P B;  5B0Y D;  4R8P B;  3LEL D;  3AZL C;  3REK A;  3AN2 C;  3AV1 A;  2ZY3 A;  2CV5 A;  1S32 D;  4Z66 B;  3REJ B;  3MGP B;  1U35 D;  5AY8 B;  3AV1 C;  1P3I D;  3REK C;  3REI B;  2J8P A;  4AWL B;  3AZJ D;  3KWQ D;  5GT3 A;  5DNM C;  3AYW B;  5GSU D;  5CPJ B;  5DNN B;  3LZ0 C;  4EO5 B;  4ZUX C;  5AY8 A;  4YS3 D;  4JJN D;  3UT9 A;  3W96 D;  5AV8 B;  4YM6 A;  2HUE C;  4Z66 A;  5B31 A;  3W97 B;  4ZUX A;  2NQB B;  5AVB D;  5GSU A;  3NQJ B;  3AFA B;  3MGR A;  1P34 B;  1P3F B;  4J8U B;  1P3P A;  4LD9 B;  5B1M B;  2YFW B;  2ARO C;  5AVC D;  3LZ1 B;  1KX3 B;  1P3I C;  1M18 D;  5JRG A;  2XD1 A;  5F99 C;  3AZG B;  3AV2 B;  4CSR A;  4J8U A;  4LD9 A;  5B2J D;  5CPK C;  1EQZ A;  1PZR A;  5C3I B;  4J8W D;  1M1A A;  3W97 A;  5GT0 C;  5B31 B;  5C3I C;  1F66 D;  5B0Z C;  2ZY2 A;  3WA9 A;  5AV9 D;  5E5A C;  1EQZ C;  3KFU G;  4KHA B;  4H9N B;  2ZY5 A;  5B1M C;  3B0C W;  2NQB D;  2Y2M A;  3AZH B;  4NE6 A;  1JFI A;  3V9R A;  2RVQ D;  4Z5T D;  5FUG A;  3AN2 D;  3AN2 B;  3AFA C;  1P3F C;  3AZK A;  4CSR B;  3MGP A;  5B0Z B;  2CV5 C;  2CV5 B;  3A6N D;  4HGA B;  2HIO D;  3W96 A;  5GXQ A;  4WU8 A;  2RIQ A;  2JE5 A;  1TAF B;  4E44 A;  5AV6 D;  3WKJ C;  1P34 A;  3WKJ B;  1M19 D;  2NQB A;  5B40 D;  1P3K D;  5B0Y A;  3LEL A;  3AV1 D;  3KXB B;  4KGC C;  1F66 C;  5CPI D;  1P34 C;  5BO0 B;  3C1B B;  1B67 A;  5B32 D;  4Z66 C;  3C1C D;  4XZQ A;  3UTB C;  1F66 A;  5DNN A;  3REH C;  3AZE B;  4J8V C;  1P3O A;  3O62 B;  3MGQ C;  5B1L C;  5AVC C;  3W98 D;  1P3B D;  5B24 C;  5BNV B;  5CPJ C;  3MGQ A;  5JRG C;  1BH9 B;  4WNN A;  3X1T D;  1P3G A;  4H9S C;  3W97 C;  2VQR A;  5GT0 D;  3AZG A;  4R8P C;  5B40 B;  1P3K B;  2PYO C;  4NFT A;  2G5I C;  3X1V A;  1P3A D;  4J8X C;  1AOI C;  3W99 A;  3AZG C;  2JCH A;  3UTA B;  5JA4 A;  1BFM A;  3X1U B;  4H9Q B;  1P3G D;  3X1U D; 
#chains in the Genus database with same CATH homology
 1P3M C;  3NQJ A;  3MGR B;  3WTP B;  1P3L A;  3LJA C;  5CP6 B;  3R45 A;  3REI C;  5CP6 C;  5B33 C;  3AZK C;  2BYM A;  4X23 B;  3MGS A;  3REH D;  2HIO C;  3KUY A;  3WA9 D;  3AZN C;  3MVD B;  3B6G A;  3EPK A;  5AV5 B;  5DNN D;  5GT3 B;  3MVD C;  2W8S A;  4KUD D;  1M19 C;  1H3O B;  2Y2K A;  5CPI A;  3MNN B;  4WU9 A;  2BYK B;  3WTP D;  5DNM B;  3MVD A;  3B6G B;  3H0R C;  5B24 D;  3B6G D;  3AV2 D;  3REK B;  3AZE D;  2FJ7 C;  4X23 A;  3MGS B;  3MNN C;  5BT1 D;  3MGS D;  1ZLA A;  2PYO D;  5BNX A;  1HQ3 B;  5AVB A;  3TU4 C;  3AZL B;  4H9O A;  1P3L B;  3AZL D;  3X1T C;  1M18 B;  3X1T B;  3A6N A;  4KGC D;  4H9O B;  3AZF D;  3EPJ A;  2JSS A;  3X1T A;  4X23 D;  2F8N G;  2DQN C;  2G5H C;  1KX5 D;  3AZL A;  3MVD D;  3KWQ A;  5AVB B;  4WU9 D;  3AZM C;  5B1L D;  2LY8 A;  4XUJ C;  5CPI B;  1ZLA B;  1KX4 C;  1ZLA D;  3UTA D;  3W98 A;  3UTB D;  5CP6 D;  5GT3 C;  5DNM A;  1BH9 A;  4J8X B;  3REL D;  3NQU A;  5BT1 C;  1KX4 A;  4J8X A;  5BS7 A;  4XZQ D;  4H9P B;  3B6F A;  2BYM B;  3B0D C;  3UT9 C;  5B33 B;  3TU4 B;  5CP6 A;  1HQ3 C;  1KX5 A;  4H9Q A;  5B0Y B;  3LEL B;  3AZI A;  5KDM B;  4WU8 D;  5B1L B;  3MNN D;  2YFV A;  3AZE C;  3X1U A;  3UTA C;  4HGA C;  3AZI C;  2FFF B;  1P3B B;  3UTB B;  3AZF A;  1M18 C;  1P3G B;  4NE5 A;  3WAA D;  3F6T A;  4WNN B;  3AZM D;  4WU9 C;  5B1M D;  5CPK A;  2Y2O A;  3LJA D;  5B0Z A;  3KSY A;  4X23 C;  1P3I B;  2ZY4 A;  5BNV A;  5E5A A;  1H3O A;  5AVB C;  3VH6 W;  1N1J A;  4Z5T A;  3TU4 D;  2F8N K;  1JFI B;  5AV5 A;  3A6N C;  1HTA A;  1P3A B;  3VH5 A;  4DQY B;  4H9N A;  4Z5T C;  1WWS A;  2F8N D;  3AFA D;  1P3F D;  5AV5 C;  3KXB C;  3C1B C;  5B31 G;  4XUJ A;  3REJ D;  4UUZ B;  5G49 A;  4WU8 C;  3KXB A;  5JA4 B;  3A1K A;  3LZ0 A;  1TAF A;  3X1S A;  3W98 C;  3LJA B;  5E5A D;  1P3L D;  3WKJ A;  1BH8 A;  5AV6 A;  2NQB C;  4J8W C;  4ZBJ C;  5B31 C;  3UT9 D;  4KGC A;  4CAY A;  3VH6 T;  5CHL B;  1P3P C;  5B40 C;  1P3K C;  5AV6 C;  4G92 C;  4EO5 C;  4ZUX B;  4ZBJ B;  4UPK A;  4YM6 B;  4YM6 D;  5B2I A;  2F8N B;  4QLC B;  3MGQ D;  3WKJ D;  3AZH C;  5AY8 D;  5B24 A;  4WV4 B;  3MGR C;  1KX3 D;  5CPJ A;  3O62 A;  3AZH A;  4R8P D;  2NZD D;  5B24 B;  2CV5 D;  4XZQ B;  5E5A B;  5B2J A;  3B0C T;  3WAA C;  1P3I A;  5B2I B;  2F8N A;  1P3G C;  1Z2C B;  5JRG D;  5B32 G;  1M1A B;  5F99 B;  5CPK B;  4R8P A;  1M1A D;  5AV5 D;  5CPJ D;  1P3A C;  4KGC B;  4J8U D;  3AZF B;  4LD9 D;  5B32 B;  3C1C B;  2ARO B;  2YFW A;  3WA9 C;  4WU8 B;  3LZ1 C;  3AZH D;  3W96 B;  4QLC C;  3O62 D;  4ZUX D;  2NZD B;  5B32 C;  4Z66 D;  3LJA A;  3C1C C;  3REI D;  5B1M A;  5AV8 A;  1U35 B;  5G49 B;  5B2J B;  3AN2 A;  2HIO A;  5FUG B;  1P3B C;  3AZG D;  5B31 D;  4G91 B;  5AV8 D;  3H0M C;  1ULY A;  2Y2Q A;  5B0Y C;  3W96 C;  5F99 D;  3LEL C;  4DRA A;  2Y2L A;  3WA9 B;  3REJ C;  3W97 D;  3FDD A;  2Y2N A;  1EQZ B;  5AY8 C;  3AV1 B;  2FJ7 D;  4J8V A;  1P3O C;  1U35 A;  4YM6 C;  3REJ A;  2NZD A;  5B2I C;  1KX3 A;  1U35 C;  2CWE A;  4XZQ C;  3UTB A;  2ARO A;  4J8W B;  3X1S B;  2NZD C;  3AZJ B;  4DRB A;  5DNN C;  3REH A;  3A6N B;  2YFV B;  3MGR D;  1KX3 C;  4UUZ A;  5GSU B;  5B1L A;  5B0Z D;  5AVC A;  5F99 A;  3AL0 C;  1T3U A;  5CPK D;  5BNX B;  3AZM A;  4J8U C;  3UT9 B;  4LD9 C;  3WAA A;  5GXQ D;  1P3P D;  1M1A C;  2ZM5 A;  2L5A A;  5GT0 B;  3W99 C;  1AOI A;  4H9R A;  3H0L C;  2Y2H A;  2F2A C;  4WU9 B;  3X1V D;  1P3A A;  2Y2J A;  3AYW A;  1ID3 B;  5GT3 D;  1KU5 A;  3AZI D;  3IP4 C;  1N1J B;  4Z5T B;  3REI A;  2PYO A;  1A7W A;  3AYW C;  4XUJ D;  4QLC A;  1W2E A;  3VH5 W;  3MGS C;  1KX4 B;  1WWI A;  3W98 B;  3X1S D;  1KX5 C;  3B0D B;  3MGP C;  4CAY B;  1HQ3 D;  1M19 B;  1P3B A;  2HUE B;  2IO5 C;  1BH8 B;  5AV6 B;  4G92 B;  3WTP A;  1P3O D;  5GXQ C;  5AV9 B;  1Q9C A;  3AZN A;  3EG5 B;  3REL C;  3UTA A;  3AZI B;  3B6F D;  3LZ0 B;  3KUY D;  3W99 B;  4KUD B;  4J8V D;  1M18 A;  3X1V B;  2FJ7 A;  3LZ1 D;  4XUJ B;  1KX4 D;  1ZLA C;  3REL A;  4AWL C;  2RVQ C;  3B0B A;  3TU4 A;  1M19 A;  5CPI C;  1P34 D;  1ID3 D;  4E45 A;  5B2I D;  3AZJ C;  4H9P A;  1TZY B;  3MNN A;  3NQU B;  4JJN A;  4YS3 A;  2UWX A;  1TZY C;  1ID3 A;  4YS3 C;  4JJN C;  1P3O B;  5B33 D;  1F66 B;  1TZY A;  4H9R B;  4Z2M H;  2XD5 A;  3LZ0 D;  3KUY B;  3C1B A;  4WZS B;  3KXB D;  1P3M D;  2FJ7 B;  1P3M B;  4H9S A;  4KUD A;  3AZM B;  5BS7 C;  1F1E A;  2ARO D;  2BG1 A;  3KWQ C;  3X1S C;  1S32 A;  4J8X D;  3REL B;  5AVC B;  3REK D;  3X1V C;  2Y2P A;  3VH6 A;  4KUD C;  5DNM D;  3REH B;  1S32 B;  5KDM A;  4J8W A;  1S32 C;  1HQ3 A;  3AZN B;  3AZN D;  1P3M A;  1P3L C;  5B40 A;  1P3K A;  1KX5 B;  2IO5 B;  1TZY D;  3B6F C;  5B33 A;  2BYK A;  3AZK B;  5GSU C;  2Y2I A;  3KUY C;  3C1B D;  3X1U C;  3B6F B;  3B6G C;  3W99 D;  3V9R B;  3A1I A;  3WTP C;  3AZF C;  4JJN B;  4YS3 B;  4QLC D;  3O62 C;  3MGQ B;  4WJ3 C;  2F8N H;  2Y2G A;  2PYO B;  4G91 C;  1AOI D;  1AOI B;  3MGP D;  4KHA A;  3VH5 T;  5B2J C;  3AYW D;  3WAA B;  3AZE A;  3KWQ B;  3R45 B;  5GT0 A;  3AV2 C;  2HIO B;  3EPH A;  3EPL A;  3WTP E;  5BO0 A;  1B6W A;  3AZK D;  2DF4 C;  3AZJ A;  4NE3 A;  3AV2 A;  5JRG B;  5AV9 A;  3LZ1 A;  3P5J B;  1R4V A;  5B32 A;  3C1C A;  1EQZ D;  1ID3 C;  4Z2M G;  5AV8 C;  4M6B A;  5GXQ B;  5AV9 C;  4J8V B;  3AFA A;  1P3F A;  1P3P B;  5B0Y D;  4R8P B;  3LEL D;  3AZL C;  3REK A;  3AN2 C;  3AV1 A;  2ZY3 A;  2CV5 A;  1S32 D;  4Z66 B;  3REJ B;  3MGP B;  1U35 D;  5AY8 B;  3AV1 C;  1P3I D;  3REK C;  3REI B;  2J8P A;  4AWL B;  3AZJ D;  3KWQ D;  5GT3 A;  5DNM C;  3AYW B;  5GSU D;  5CPJ B;  5DNN B;  3LZ0 C;  4EO5 B;  4ZUX C;  5AY8 A;  4YS3 D;  4JJN D;  3UT9 A;  3W96 D;  5AV8 B;  4YM6 A;  2HUE C;  4Z66 A;  5B31 A;  3W97 B;  4ZUX A;  2NQB B;  5AVB D;  5GSU A;  3NQJ B;  3AFA B;  3MGR A;  1P34 B;  1P3F B;  4J8U B;  1P3P A;  4LD9 B;  5B1M B;  2YFW B;  2ARO C;  5AVC D;  3LZ1 B;  1KX3 B;  1P3I C;  1M18 D;  5JRG A;  2XD1 A;  5F99 C;  3AZG B;  3AV2 B;  4CSR A;  4J8U A;  4LD9 A;  5B2J D;  5CPK C;  1EQZ A;  1PZR A;  5C3I B;  4J8W D;  1M1A A;  3W97 A;  5GT0 C;  5B31 B;  5C3I C;  1F66 D;  5B0Z C;  2ZY2 A;  3WA9 A;  5AV9 D;  5E5A C;  1EQZ C;  3KFU G;  4KHA B;  4H9N B;  2ZY5 A;  5B1M C;  3B0C W;  2NQB D;  2Y2M A;  3AZH B;  4NE6 A;  1JFI A;  3V9R A;  2RVQ D;  4Z5T D;  5FUG A;  3AN2 D;  3AN2 B;  3AFA C;  1P3F C;  3AZK A;  4CSR B;  3MGP A;  5B0Z B;  2CV5 C;  2CV5 B;  3A6N D;  4HGA B;  2HIO D;  3W96 A;  5GXQ A;  4WU8 A;  2RIQ A;  2JE5 A;  1TAF B;  4E44 A;  5AV6 D;  3WKJ C;  1P34 A;  3WKJ B;  1M19 D;  2NQB A;  5B40 D;  1P3K D;  5B0Y A;  3LEL A;  3AV1 D;  3KXB B;  4KGC C;  1F66 C;  5CPI D;  1P34 C;  5BO0 B;  3C1B B;  1B67 A;  5B32 D;  4Z66 C;  3C1C D;  4XZQ A;  3UTB C;  1F66 A;  5DNN A;  3REH C;  3AZE B;  4J8V C;  1P3O A;  3O62 B;  3MGQ C;  5B1L C;  5AVC C;  3W98 D;  1P3B D;  5B24 C;  5BNV B;  5CPJ C;  3MGQ A;  5JRG C;  1BH9 B;  4WNN A;  3X1T D;  1P3G A;  4H9S C;  3W97 C;  2VQR A;  5GT0 D;  3AZG A;  4R8P C;  5B40 B;  1P3K B;  2PYO C;  4NFT A;  2G5I C;  3X1V A;  1P3A D;  4J8X C;  1AOI C;  3W99 A;  3AZG C;  2JCH A;  3UTA B;  5JA4 A;  1BFM A;  3X1U B;  4H9Q B;  1P3G D;  3X1U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...