3MGSD

Binding of cesium ions to the nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsD00
3W99C 4DRBA 3W97B 4YM6B 4J8XC 5DNMB 4QLCA 4G91B 1U35A 4J8XA 3W97D 3MGRB 2HIOC 4E44A 5DNMD 5AV6D 3AN2B 1P3AB 3REKB 4H9OB 1P3IC 3AN2D 1P3AD 3WTPE 3REKD 1P3IA 4KHAB 4J8WB 2FJ7B 3AV1B 3W97A 1ULYA 4YM6A 1BH9B 5B1LC 5DNMA 4ZUXD 5B33B 5AV9C 3C1CB 5GSUC 2FJ7D 3B6FC 3AV1D 1KX5B 3MGRA 3AN2A 1P3AA 4H9PB 3MNNC 2HUEC 3VH6W 3REKA 3UTBB 4JJND 1B67A 4H9OA 3MGQB 4E45A 5AV5B 3TU4B 1EQZD 5B32G 5B31G 3REJD 3X1UD 4YS3B 3R45B 3UTBD 3X1VB 1P3KD 1P3OD 3MGQD 4J8WA 5B33C 2FJ7A 5AV5D 3AV1A 3AZKB 5CPKD 4YS3D 1BH9A 5B24B 3KWQD 3C1CA 1KX5C 3LZ0B 2F8NG 3AZKD 1KX5A 1EQZA 3UTAD 3REJA 4Z66C 3TU4C 1ZLAC 3UTBA 1P3KA 3LZ0D 3AZFC 3MGQA 4KGCB 5AV5A 3X1VC 1M19B 3VH5T 5CPKA 4YS3A 3R45A 5GT0B 1WWIA 5B24C 4KGCD 1M19D 1ID3B 3MVDD 3AZHC 5AVCC 3AZKA 5KDMB 3AZMD 5B24A 5GT0D 1N1JB 3LZ0A 1ID3D 5GT3C 5BS7A 5B40B 5B1MD 3AZJC 1M19A 4KGCA 2NQBB 5GT0A 4J8UB 3WTPB 3KUYB 5B40D 1ID3A 2NQBD 3B6GD 1F1EA 5KDMA 4J8UD 3X1SB 4WU8C 1N1JA 1P3GB 5AY8C 3VH6T 3X1SD 5G49B 5AVBC 5CPID 5B40A 1P3GD 3WTPC 2NQBA 3VH5A 5DNNB 4J8UA 1P34D 4ZBJB 5GXQC 4XUJB 3AYWC 4UUZB 3KUYA 3NQUB 4LD9C 3X1SA 3MGSC 1P3MB 3RELB 4HGAB 2PYOB 1P3GA 5B2JC 5G49A 3RELD 2PYOD 4ZBJC 4XUJC 4X23D 1HTAA 5B32C 5DNNA 5B31C 1P3PB 4XUJA 1F66D 4UUZA 3W96C 4Z5TB 1P3MC 3AZIB 4NE5A 4EO5C 3LJAD 5BT1D 5E5AC 3RELA 3REIB 1P3FC 2PYOA 4XZQC 3C1BC 4Z2MH 3LZ1C 3VH6A 1HQ3B 3REID 1P3PC 3REHC 3WAAD 1KU5A 3AZED 4Z5TC 1P3PA 1M18D 3AZIC 3AZIA 3W98C 1P3LB 3O62B 4R8PC 3REIA 3AZLC 4KUDC 1HQ3C 1P3LD 3AZEA 3O62D 1HQ3A 4QLCC 3B0CT 1U35C 5AV6B 1B6WA 5AV8B 3AZGB 2NZDD 1P3LA 5AV8D 3O62A 3AZGD 4AWLB 4ZUXB 3W97C 1KX3D 4YM6C 5DNMC 4G91C 5AV6A 3MGRC 5AV8A 3AN2C 1P3AC 3AZGA 5CP6D 4JJNB 3REKC 1EQZB 3REJB 3X1UB 4WNNB 4AWLC 1P3KB 1P3OB 4ZUXC 1Q9CA 4J8WC 5CPKB 2FJ7C 4ZUXA 3AV1C 2YFVB 3KWQB 3C1CC 5CP6A 3B6FD 3UTAB 5JRGB 1EQZC 1P3BB 3REJC 4JJNA 3UT9D 3UTBC 1P3KC 1P3OC 3WA9D 3MGQC 3X1UA 4WNNA 5JRGD 5AV5C 1P3BD 5CPKC 4Z2MG 5C3IB 4YS3C 1P3OA 3KWQC 3MVDB 3AZMB 4CSRB 2YFVA 3KWQA 3AZKC 5BNXB 4NE3A 2F8NK 3LZ0C 3UTAA 5JRGA 1P3BA 5BS7C 2BYKB 3MGPD 5B1MB 5C3IC 4KGCC 1M19C 3MVDC 5GT0C 3B6GB 3MVDA 1ID3C 3AZMA 4CSRA 4H9RB 5BNXA 3MGPA 2BYKA 5CPIB 5B1MA 3B0DB 5B40C 2NQBC 1BH8B 5FUGB 1P34B 4H9QB 4WV4B 4J8UC 3B6GA 3B0CW 3X1TB 3AFAB 3KUYC 5F99D 4WU9D 4H9RA 3X1SC 5B0YD 3X1TD 3AFAD 4WU8D 3WKJB 5CPIC 4H9SA 1S32D 1P3GC 5CPIA 3WKJD 4H9NA 5AVBD 3KXBB 4X23B 1BH8A 1M1AD 2AROB 5FUGA 1P34A 3KXBD 4H9QA 5DNNC 3AYWD 1F66B 5B0YA 3AFAA 1R4VA 3X1TA 4G92B 2AROD 2RVQC 3LJAB 3WKJA 3RELC 4HGAC 2PYOC 5JA4B 4X23C 1P3IB 5B2JD 3KXBA 4X23A 2IO5B 3A6ND 1F66C 3WAAB 3AZEB 1M18B 2AROA 5B0ZD 5B31D 1F66A 3LJAA 1AOIB 3AZND 1H3OB 3REIC 3LELD 5JA4A 2F8ND 1AOID 4NE6A 3WAAC 2IO5C 4XZQD 5CPJD 3AZEC 3AV2D 3WAAA 3REHD 1TZYB 1M18A 5B2ID 3AZNA 1TZYD 3LELA 3W98D 1KX4B 2NZDB 4CAYB 1AOIA 2CV5B 1P3LC 2L5AA 1H3OA 3O62C 4R8PD 4J8VB 3AZLD 3W99B 1KX4D 4KUDD 2CV5D 1KX3B 4J8VD 3W99D 2HIOB 1TZYA 1U35D 4J8XD 5AV6C 2BYMA 5CP6B 2YFWB 5AV8C 3AZGC 2HIOD 2NZDA 1KX4A 4CAYA 3B0BA 2CV5A 3V9RB 1KX3C 4J8VA 1P3ID 3W99A 5B1LB 5AV9B 1KX3A 4YM6D 5GSUB 3B6FB 5CP6C 2HIOA 5B1LD 5AV9D 3MGRD 3MNNB 2HUEB 5GSUD 2YFWA 3UT9B 4JJNC 3WA9B 3MNND 5BNVB 3X1UC 3V9RA 4J8WD 5B1LA 5AV9A 5GSUA 5B33D 3C1CD 3B6FA 3UT9C 1KX5D 3WA9C 3UTAC 3MNNA 4Z66B 5JRGC 1P3BC 1ZLAB 3MGPB 3UT9A 3AZFB 3WA9A 4KHAA 4Z66D 5BNVA 3TU4D 1ZLAD 3AZFD 5B33A 3X1VD 3AZHB 5AVCB 3AZMC 5B24D 4H9PA 3AZHD 5AVCD 5GT3B 3MGPC 4Z66A 3TU4A 1ZLAA 3AZFA 5GT3D 3AZJB 3X1VA 5B1MC 4H9NB 1TAFB 3AZJD 3AZHA 5AVCA 3B6GC 5F99B 4WU9B 1BFMA 5B0YB 3KSYA 4WU8B 5GT3A 3NQJB 1S32B 5AY8B 4H9SC 5AVBB 1A7WA 3AZJA 5AY8D 1M1AB 3B0DC 5F99C 5GXQB 3AYWB 4WU9C 1P34C 1TAFA 3WTPD 5F99A 4WZSB 5B0YC 3AFAC 3KUYD 3X1TC 4WU9A 4LD9B 5GXQD 1S32C 3MGSB 4WU8A 3WKJC 3NQJA 1S32A 5AY8A 4LD9D 5B2JB 3MGSD 5AVBA 1M1AC 2JSSA 3A6NB 3KXBC 3WTPA 1M1AA 5B32B 5B0ZB 5B31B 5GXQA 2AROC 3AYWA 5DNND 3W96B 4XUJD 4M6BA 4LD9A 5B32D 4G92C 2RVQD 4EO5B 3MGSA 3AZNB 5E5AB 3LJAC 2LY8A 5CHLB 5BT1C 1JFIB 3W96D 1P3MD 1P3FB 3LELB 2F8NB 4XZQB 3A6NC 3C1BB 5B2JA 2CWEA 5CPJB 5E5AD 3LZ1B 3AV2B 5B0ZC 1P3FD 3A6NA 3REHB 3C1BD 3NQUA 5B32A 5B2IB 5B31A 5B0ZA 3LZ1D 1M18C 3W96A 1P3PD 5BO0B 1P3MA 3AZNC 2F8NH 3W98B 4Z5TD 3AZID 2BYMB 3LELC 5E5AA 1JFIA 1AOIC 4R8PB 5CPJC 1P3FA 3AZLB 2F8NA 4KUDB 3AV2C 1WWSA 4XZQA 3C1BA 5CPJA 3LZ1A 3AV2A 5B2IC 4QLCB 1HQ3D 4NFTA 3REHA 1U35B 4J8XB 4Z5TA 5B2IA 1TZYC 4QLCD 5BO0A 3W98A 4DRAA 3VH5W 1KX4C 2NZDC 2CV5C 4R8PA 3AZLA 4KUDA 4J8VC
chains in the Genus database with same CATH superfamily
4UPKA 2Y2MA 3W99C 4DRBA 3W97B 4YM6B 4J8XC 5DNMB 4QLCA 4G91B 1U35A 4J8XA 3W97D 3MGRB 2HIOC 4E44A 5DNMD 5AV6D 3AN2B 1P3AB 3REKB 2DF4C 4H9OB 1P3IC 3AN2D 1P3AD 3WTPE 3REKD 1P3IA 3H0LC 4KHAB 4J8WB 2FJ7B 2Y2GA 3W97A 3AV1B 1ULYA 4YM6A 1BH9B 5B1LC 5DNMA 4ZUXD 5B33B 5AV9C 3C1CB 5GSUC 2FJ7D 3B6FC 3AV1D 1KX5B 3MGRA 3AN2A 2ZY3A 1P3AA 4H9PB 3MNNC 2HUEC 3VH6W 3REKA 3UTBB 4JJND 1B67A 4H9OA 3MGQB 3P5JB 4E45A 5AV5B 3TU4B 1EQZD 5B32G 5B31G 3REJD 3X1UD 4YS3B 3R45B 3UTBD 3X1VB 1P3KD 1P3OD 2XD1A 3MGQD 4J8WA 5B33C 2FJ7A 5AV5D 3AV1A 3AZKB 5CPKD 4YS3D 1BH9A 5B24B 3KWQD 3C1CA 1KX5C 3LZ0B 2F8NG 3AZKD 1KX5A 1EQZA 3UTAD 3REJA 4Z66C 3TU4C 1ZLAC 3UTBA 1P3KA 3LZ0D 3AZFC 3MGQA 4KGCB 5AV5A 3X1VC 1M19B 3VH5T 5CPKA 4YS3A 3R45A 5GT0B 1WWIA 5B24C 4KGCD 1M19D 1ID3B 3MVDD 3AZHC 5AVCC 3AZKA 5KDMB 3AZMD 5B24A 5GT0D 1N1JB 3LZ0A 1ID3D 5GT3C 4WJ3C 3H0RC 5BS7A 2RIQA 5B40B 2BG1A 5B1MD 3AZJC 1M19A 4KGCA 2NQBB 5GT0A 4J8UB 3WTPB 3KUYB 5B40D 1ID3A 2NQBD 3B6GD 1F1EA 5KDMA 4J8UD 3X1SB 4WU8C 1N1JA 1P3GB 5AY8C 3VH6T 3X1SD 5G49B 5AVBC 5CPID 2ZY4A 5B40A 3WTPC 1P3GD 2NQBA 3VH5A 5DNNB 4J8UA 1P34D 4ZBJB 5GXQC 4XUJB 3AYWC 4UUZB 3KUYA 3NQUB 4LD9C 3X1SA 3MGSC 1P3MB 3RELB 4HGAB 2PYOB 1P3GA 5B2JC 5G49A 3RELD 2PYOD 4ZBJC 4XUJC 4X23D 1HTAA 5B32C 5DNNA 5B31C 1P3PB 4XUJA 1F66D 4UUZA 3W96C 4Z5TB 1P3MC 3AZIB 3EPKA 4NE5A 4EO5C 3LJAD 5BT1D 5E5AC 3RELA 3REIB 1P3FC 2PYOA 4XZQC 3C1BC 4Z2MH 3LZ1C 3VH6A 1HQ3B 3REID 2XD5A 2W8SA 1P3PC 3REHC 3WAAD 1KU5A 3AZED 4Z5TC 1P3PA 1M18D 3AZIC 3AZIA 3AL0C 3W98C 1P3LB 3O62B 4R8PC 3REIA 3AZLC 4KUDC 1HQ3C 1P3LD 3AZEA 3O62D 1HQ3A 4QLCC 3B0CT 1U35C 5AV6B 1B6WA 5AV8B 3AZGB 2NZDD 1P3LA 5AV8D 3O62A 3AZGD 2Y2QA 4AWLB 4ZUXB 3W97C 1KX3D 4YM6C 5DNMC 4G91C 5AV6A 3MGRC 5AV8A 3AN2C 1P3AC 3AZGA 5CP6D 4JJNB 3REKC 1EQZB 3REJB 3X1UB 4WNNB 4AWLC 1P3KB 1P3OB 4ZUXC 1Q9CA 4J8WC 5CPKB 2FJ7C 4ZUXA 3AV1C 2YFVB 3KWQB 3C1CC 5CP6A 3B6FD 3UTAB 5JRGB 1EQZC 1P3BB 3A1KA 3REJC 4JJNA 3UT9D 3UTBC 1P3KC 1P3OC 3WA9D 3MGQC 5JRGD 4WNNA 5AV5C 3X1UA 1P3BD 5CPKC 2UWXA 4Z2MG 5C3IB 4YS3C 1P3OA 3KWQC 2J8PA 3MVDB 3AZMB 4CSRB 1W2EA 2YFVA 3KWQA 3AZKC 5BNXB 4NE3A 2F8NK 3LZ0C 3UTAA 5JRGA 1P3BA 3EPLA 5BS7C 2BYKB 3MGPD 5B1MB 5C3IC 2ZY2A 4KGCC 1M19C 3MVDC 5GT0C 3B6GB 3MVDA 1ID3C 3AZMA 4CSRA 4H9RB 2Y2HA 5BNXA 3MGPA 2BYKA 5CPIB 5B1MA 3B0DB 5B40C 2NQBC 1BH8B 2G5HC 5FUGB 1P34B 4H9QB 4WV4B 4J8UC 3B6GA 3B0CW 3X1TB 3AFAB 3KUYC 5F99D 4WU9D 4H9RA 3H0MC 3X1SC 5B0YD 3X1TD 3AFAD 4WU8D 3WKJB 5CPIC 4H9SA 1S32D 1P3GC 5CPIA 3WKJD 4H9NA 5AVBD 3KXBB 2ZY5A 4X23B 1BH8A 1M1AD 2AROB 5FUGA 1P34A 3KXBD 4H9QA 5DNNC 3AYWD 1F66B 5B0YA 3AFAA 1R4VA 3X1TA 4G92B 2AROD 2RVQC 3LJAB 3WKJA 3RELC 4HGAC 2PYOC 5JA4B 2Y2JA 4X23C 1P3IB 5B2JD 3KXBA 4X23A 2IO5B 3A6ND 1F66C 2F2AC 3WAAB 3AZEB 1M18B 2AROA 5B0ZD 5B31D 1F66A 3LJAA 1AOIB 3AZND 1H3OB 3REIC 3LELD 5JA4A 2F8ND 1AOID 4NE6A 3WAAC 2IO5C 4XZQD 5CPJD 3AZEC 3AV2D 3WAAA 2Y2LA 3REHD 1TZYB 1M18A 5B2ID 3AZNA 1TZYD 3LELA 3W98D 1KX4B 2NZDB 4CAYB 1AOIA 2CV5B 1P3LC 2L5AA 1H3OA 3O62C 4R8PD 4J8VB 3AZLD 3W99B 1KX4D 4KUDD 2CV5D 1KX3B 3A1IA 4J8VD 3W99D 2HIOB 1TZYA 1U35D 4J8XD 5AV6C 2BYMA 5CP6B 2YFWB 5AV8C 3AZGC 2HIOD 2NZDA 1KX4A 4CAYA 3B0BA 2CV5A 3V9RB 3F6TA 1KX3C 4J8VA 1P3ID 3W99A 3FDDA 5B1LB 5AV9B 1KX3A 4YM6D 5GSUB 3B6FB 5CP6C 2HIOA 5B1LD 5AV9D 3MGRD 3MNNB 2HUEB 5GSUD 2YFWA 3UT9B 4JJNC 3WA9B 2Y2KA 3MNND 5BNVB 3X1UC 3V9RA 4J8WD 5B1LA 5AV9A 5GSUA 5B33D 3C1CD 3B6FA 3UT9C 1KX5D 3WA9C 3UTAC 3MNNA 4Z66B 5JRGC 1P3BC 1ZLAB 3MGPB 3UT9A 3AZFB 3WA9A 4KHAA 2G5IC 4Z66D 5BNVA 3TU4D 1ZLAD 3AZFD 2ZM5A 5B33A 3X1VD 3IP4C 5AVCB 4DQYB 3AZHB 3AZMC 5B24D 4H9PA 3AZHD 5AVCD 2JCHA 5GT3B 3MGPC 4Z66A 3TU4A 1ZLAA 3AZFA 2VQRA 5GT3D 3AZJB 3X1VA 5B1MC 2DQNC 4H9NB 1TAFB 3KFUG 3AZJD 1T3UA 3AZHA 5AVCA 3B6GC 5F99B 4WU9B 1BFMA 2Y2IA 5B0YB 3KSYA 4WU8B 5GT3A 3NQJB 1S32B 5AY8B 4H9SC 5AVBB 3EG5B 1A7WA 3AZJA 5AY8D 1M1AB 3B0DC 1PZRA 5F99C 2Y2OA 5GXQB 3AYWB 4WU9C 1P34C 1TAFA 3WTPD 5F99A 4WZSB 5B0YC 3AFAC 3KUYD 3X1TC 4WU9A 4LD9B 5GXQD 1S32C 3MGSB 4WU8A 3WKJC 3NQJA 1S32A 5AY8A 4LD9D 5B2JB 3MGSD 5AVBA 1M1AC 2JSSA 3A6NB 3KXBC 3WTPA 3EPJA 1M1AA 5B32B 5B0ZB 5B31B 5GXQA 2AROC 3AYWA 5DNND 3W96B 4XUJD 4M6BA 2Y2NA 4LD9A 5B32D 4G92C 2RVQD 4EO5B 3MGSA 3AZNB 5E5AB 3LJAC 2LY8A 5CHLB 5BT1C 1JFIB 3W96D 1P3MD 2FFFB 1P3FB 3LELB 2F8NB 4XZQB 3A6NC 3C1BB 5B2JA 2CWEA 2Y2PA 5CPJB 5E5AD 3LZ1B 3EPHA 3AV2B 5B0ZC 1P3FD 3A6NA 3REHB 2JE5A 3C1BD 3NQUA 5B32A 5B2IB 5B31A 5B0ZA 3LZ1D 1M18C 3W96A 1P3PD 5BO0B 1P3MA 3AZNC 2F8NH 3W98B 4Z5TD 1Z2CB 2BYMB 3LELC 3AZID 5E5AA 1JFIA 1AOIC 4R8PB 5CPJC 1P3FA 3AZLB 2F8NA 4KUDB 3AV2C 1WWSA 4XZQA 3C1BA 5CPJA 3LZ1A 3AV2A 5B2IC 4QLCB 1HQ3D 4NFTA 3REHA 1U35B 4J8XB 4Z5TA 5B2IA 1TZYC 4QLCD 5BO0A 3W98A 4DRAA 3VH5W 1KX4C 2NZDC 2CV5C 4R8PA 3AZLA 4KUDA 4J8VC
chains in the Genus database with same CATH topology
4UPKA 2Y2MA 3W99C 4DRBA 3W97B 4YM6B 4J8XC 5DNMB 4QLCA 4G91B 1U35A 4J8XA 3W97D 3MGRB 2HIOC 4E44A 5DNMD 5AV6D 3AN2B 1P3AB 3REKB 2DF4C 4H9OB 1P3IC 3AN2D 1P3AD 3WTPE 3REKD 1P3IA 3H0LC 4KHAB 4J8WB 2FJ7B 2Y2GA 3W97A 3AV1B 1ULYA 4YM6A 1BH9B 5B1LC 5DNMA 4ZUXD 5B33B 5AV9C 3C1CB 5GSUC 2FJ7D 3B6FC 3AV1D 1KX5B 3MGRA 3AN2A 2ZY3A 1P3AA 4H9PB 3MNNC 2HUEC 3VH6W 3REKA 3UTBB 4JJND 1B67A 4H9OA 3MGQB 3P5JB 4E45A 5AV5B 3TU4B 1EQZD 5B32G 5B31G 3REJD 3X1UD 4YS3B 3R45B 3UTBD 3X1VB 1P3KD 1P3OD 2XD1A 3MGQD 4J8WA 5B33C 2FJ7A 5AV5D 3AV1A 3AZKB 5CPKD 4YS3D 1BH9A 5B24B 3KWQD 3C1CA 1KX5C 3LZ0B 2F8NG 3AZKD 1KX5A 1EQZA 3UTAD 3REJA 4Z66C 3TU4C 1ZLAC 3UTBA 1P3KA 3LZ0D 3AZFC 3MGQA 4KGCB 5AV5A 3X1VC 1M19B 3VH5T 5CPKA 4YS3A 3R45A 5GT0B 1WWIA 5B24C 4KGCD 1M19D 1ID3B 3MVDD 3AZHC 5AVCC 3AZKA 5KDMB 3AZMD 5B24A 5GT0D 1N1JB 3LZ0A 1ID3D 5GT3C 4WJ3C 3H0RC 5BS7A 2RIQA 5B40B 2BG1A 5B1MD 3AZJC 1M19A 4KGCA 2NQBB 5GT0A 4J8UB 3WTPB 3KUYB 5B40D 1ID3A 2NQBD 3B6GD 1F1EA 5KDMA 4J8UD 3X1SB 4WU8C 1N1JA 1P3GB 5AY8C 3VH6T 3X1SD 5G49B 5AVBC 5CPID 2ZY4A 5B40A 3WTPC 1P3GD 2NQBA 3VH5A 5DNNB 4J8UA 1P34D 4ZBJB 5GXQC 4XUJB 3AYWC 4UUZB 3KUYA 3NQUB 4LD9C 3X1SA 3MGSC 1P3MB 3RELB 4HGAB 2PYOB 1P3GA 5B2JC 5G49A 3RELD 2PYOD 4ZBJC 4XUJC 4X23D 1HTAA 5B32C 5DNNA 5B31C 1P3PB 4XUJA 1F66D 4UUZA 3W96C 4Z5TB 1P3MC 3AZIB 3EPKA 4NE5A 4EO5C 3LJAD 5BT1D 5E5AC 3RELA 3REIB 1P3FC 2PYOA 4XZQC 3C1BC 4Z2MH 3LZ1C 3VH6A 1HQ3B 3REID 2XD5A 2W8SA 1P3PC 3REHC 3WAAD 1KU5A 3AZED 4Z5TC 1P3PA 1M18D 3AZIC 3AZIA 3AL0C 3W98C 1P3LB 3O62B 4R8PC 3REIA 3AZLC 4KUDC 1HQ3C 1P3LD 3AZEA 3O62D 1HQ3A 4QLCC 3B0CT 1U35C 5AV6B 1B6WA 5AV8B 3AZGB 2NZDD 1P3LA 5AV8D 3O62A 3AZGD 2Y2QA 4AWLB 4ZUXB 3W97C 1KX3D 4YM6C 5DNMC 4G91C 5AV6A 3MGRC 5AV8A 3AN2C 1P3AC 3AZGA 5CP6D 4JJNB 3REKC 1EQZB 3REJB 3X1UB 4WNNB 4AWLC 1P3KB 1P3OB 4ZUXC 1Q9CA 4J8WC 5CPKB 2FJ7C 4ZUXA 3AV1C 2YFVB 3KWQB 3C1CC 5CP6A 3B6FD 3UTAB 5JRGB 1EQZC 1P3BB 3A1KA 3REJC 4JJNA 3UT9D 3UTBC 1P3KC 1P3OC 3WA9D 3MGQC 5JRGD 4WNNA 5AV5C 3X1UA 1P3BD 5CPKC 2UWXA 4Z2MG 5C3IB 4YS3C 1P3OA 3KWQC 2J8PA 3MVDB 3AZMB 4CSRB 1W2EA 2YFVA 3KWQA 3AZKC 5BNXB 4NE3A 2F8NK 3LZ0C 3UTAA 5JRGA 1P3BA 3EPLA 5BS7C 2BYKB 3MGPD 5B1MB 5C3IC 2ZY2A 4KGCC 1M19C 3MVDC 5GT0C 3B6GB 3MVDA 1ID3C 3AZMA 4CSRA 4H9RB 2Y2HA 5BNXA 3MGPA 2BYKA 5CPIB 5B1MA 3B0DB 5B40C 2NQBC 1BH8B 2G5HC 5FUGB 1P34B 4H9QB 4WV4B 4J8UC 3B6GA 3B0CW 3X1TB 3AFAB 3KUYC 5F99D 4WU9D 4H9RA 3H0MC 3X1SC 5B0YD 3X1TD 3AFAD 4WU8D 3WKJB 5CPIC 4H9SA 1S32D 1P3GC 5CPIA 3WKJD 4H9NA 5AVBD 3KXBB 2ZY5A 4X23B 1BH8A 1M1AD 2AROB 5FUGA 1P34A 3KXBD 4H9QA 5DNNC 3AYWD 1F66B 5B0YA 3AFAA 1R4VA 3X1TA 4G92B 2AROD 2RVQC 3LJAB 3WKJA 3RELC 4HGAC 2PYOC 5JA4B 2Y2JA 4X23C 1P3IB 5B2JD 3KXBA 4X23A 2IO5B 3A6ND 1F66C 2F2AC 3WAAB 3AZEB 1M18B 2AROA 5B0ZD 5B31D 1F66A 3LJAA 1AOIB 3AZND 1H3OB 3REIC 3LELD 5JA4A 2F8ND 1AOID 4NE6A 3WAAC 2IO5C 4XZQD 5CPJD 3AZEC 3AV2D 3WAAA 2Y2LA 3REHD 1TZYB 1M18A 5B2ID 3AZNA 1TZYD 3LELA 3W98D 1KX4B 2NZDB 4CAYB 1AOIA 2CV5B 1P3LC 2L5AA 1H3OA 3O62C 4R8PD 4J8VB 3AZLD 3W99B 1KX4D 4KUDD 2CV5D 1KX3B 3A1IA 4J8VD 3W99D 2HIOB 1TZYA 1U35D 4J8XD 5AV6C 2BYMA 5CP6B 2YFWB 5AV8C 3AZGC 2HIOD 2NZDA 1KX4A 4CAYA 3B0BA 2CV5A 3V9RB 3F6TA 1KX3C 4J8VA 1P3ID 3W99A 3FDDA 5B1LB 5AV9B 1KX3A 4YM6D 5GSUB 3B6FB 5CP6C 2HIOA 5B1LD 5AV9D 3MGRD 3MNNB 2HUEB 5GSUD 2YFWA 3UT9B 4JJNC 3WA9B 2Y2KA 3MNND 5BNVB 3X1UC 3V9RA 4J8WD 5B1LA 5AV9A 5GSUA 5B33D 3C1CD 3B6FA 3UT9C 1KX5D 3WA9C 3UTAC 3MNNA 4Z66B 5JRGC 1P3BC 1ZLAB 3MGPB 3UT9A 3AZFB 3WA9A 4KHAA 2G5IC 4Z66D 5BNVA 3TU4D 1ZLAD 3AZFD 2ZM5A 5B33A 3X1VD 3IP4C 5AVCB 4DQYB 3AZHB 3AZMC 5B24D 4H9PA 3AZHD 5AVCD 2JCHA 5GT3B 3MGPC 4Z66A 3TU4A 1ZLAA 3AZFA 2VQRA 5GT3D 3AZJB 3X1VA 5B1MC 2DQNC 4H9NB 1TAFB 3KFUG 3AZJD 1T3UA 3AZHA 5AVCA 3B6GC 5F99B 4WU9B 1BFMA 2Y2IA 5B0YB 3KSYA 4WU8B 5GT3A 3NQJB 1S32B 5AY8B 4H9SC 5AVBB 3EG5B 1A7WA 3AZJA 5AY8D 1M1AB 3B0DC 1PZRA 5F99C 2Y2OA 5GXQB 3AYWB 4WU9C 1P34C 1TAFA 3WTPD 5F99A 4WZSB 5B0YC 3AFAC 3KUYD 3X1TC 4WU9A 4LD9B 5GXQD 1S32C 3MGSB 4WU8A 3WKJC 3NQJA 1S32A 5AY8A 4LD9D 5B2JB 3MGSD 5AVBA 1M1AC 2JSSA 3A6NB 3KXBC 3WTPA 3EPJA 1M1AA 5B32B 5B0ZB 5B31B 5GXQA 2AROC 3AYWA 5DNND 3W96B 4XUJD 4M6BA 2Y2NA 4LD9A 5B32D 4G92C 2RVQD 4EO5B 3MGSA 3AZNB 5E5AB 3LJAC 2LY8A 5CHLB 5BT1C 1JFIB 3W96D 1P3MD 2FFFB 1P3FB 3LELB 2F8NB 4XZQB 3A6NC 3C1BB 5B2JA 2CWEA 2Y2PA 5CPJB 5E5AD 3LZ1B 3EPHA 3AV2B 5B0ZC 1P3FD 3A6NA 3REHB 2JE5A 3C1BD 3NQUA 5B32A 5B2IB 5B31A 5B0ZA 3LZ1D 1M18C 3W96A 1P3PD 5BO0B 1P3MA 3AZNC 2F8NH 3W98B 4Z5TD 1Z2CB 2BYMB 3LELC 3AZID 5E5AA 1JFIA 1AOIC 4R8PB 5CPJC 1P3FA 3AZLB 2F8NA 4KUDB 3AV2C 1WWSA 4XZQA 3C1BA 5CPJA 3LZ1A 3AV2A 5B2IC 4QLCB 1HQ3D 4NFTA 3REHA 1U35B 4J8XB 4Z5TA 5B2IA 1TZYC 4QLCD 5BO0A 3W98A 4DRAA 3VH5W 1KX4C 2NZDC 2CV5C 4R8PA 3AZLA 4KUDA 4J8VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 C;  4DRB A;  3W97 B;  4YM6 B;  4J8X C;  5DNM B;  4QLC A;  4G91 B;  1U35 A;  4J8X A;  3W97 D;  3MGR B;  2HIO C;  4E44 A;  5DNM D;  5AV6 D;  3AN2 B;  1P3A B;  3REK B;  4H9O B;  1P3I C;  3AN2 D;  1P3A D;  3WTP E;  3REK D;  1P3I A;  4KHA B;  4J8W B;  2FJ7 B;  3AV1 B;  3W97 A;  1ULY A;  4YM6 A;  1BH9 B;  5B1L C;  5DNM A;  4ZUX D;  5B33 B;  5AV9 C;  3C1C B;  5GSU C;  2FJ7 D;  3B6F C;  3AV1 D;  1KX5 B;  3MGR A;  3AN2 A;  1P3A A;  4H9P B;  3MNN C;  2HUE C;  3VH6 W;  3REK A;  3UTB B;  4JJN D;  1B67 A;  4H9O A;  3MGQ B;  4E45 A;  5AV5 B;  3TU4 B;  1EQZ D;  5B32 G;  5B31 G;  3REJ D;  3X1U D;  4YS3 B;  3R45 B;  3UTB D;  3X1V B;  1P3K D;  1P3O D;  3MGQ D;  4J8W A;  5B33 C;  2FJ7 A;  5AV5 D;  3AV1 A;  3AZK B;  5CPK D;  4YS3 D;  1BH9 A;  5B24 B;  3KWQ D;  3C1C A;  1KX5 C;  3LZ0 B;  2F8N G;  3AZK D;  1KX5 A;  1EQZ A;  3UTA D;  3REJ A;  4Z66 C;  3TU4 C;  1ZLA C;  3UTB A;  1P3K A;  3LZ0 D;  3AZF C;  3MGQ A;  4KGC B;  5AV5 A;  3X1V C;  1M19 B;  3VH5 T;  5CPK A;  4YS3 A;  3R45 A;  5GT0 B;  1WWI A;  5B24 C;  4KGC D;  1M19 D;  1ID3 B;  3MVD D;  3AZH C;  5AVC C;  3AZK A;  5KDM B;  3AZM D;  5B24 A;  5GT0 D;  1N1J B;  3LZ0 A;  1ID3 D;  5GT3 C;  5BS7 A;  5B40 B;  5B1M D;  3AZJ C;  1M19 A;  4KGC A;  2NQB B;  5GT0 A;  4J8U B;  3WTP B;  3KUY B;  5B40 D;  1ID3 A;  2NQB D;  3B6G D;  1F1E A;  5KDM A;  4J8U D;  3X1S B;  4WU8 C;  1N1J A;  1P3G B;  5AY8 C;  3VH6 T;  3X1S D;  5G49 B;  5AVB C;  5CPI D;  5B40 A;  1P3G D;  3WTP C;  2NQB A;  3VH5 A;  5DNN B;  4J8U A;  1P34 D;  4ZBJ B;  5GXQ C;  4XUJ B;  3AYW C;  4UUZ B;  3KUY A;  3NQU B;  4LD9 C;  3X1S A;  3MGS C;  1P3M B;  3REL B;  4HGA B;  2PYO B;  1P3G A;  5B2J C;  5G49 A;  3REL D;  2PYO D;  4ZBJ C;  4XUJ C;  4X23 D;  1HTA A;  5B32 C;  5DNN A;  5B31 C;  1P3P B;  4XUJ A;  1F66 D;  4UUZ A;  3W96 C;  4Z5T B;  1P3M C;  3AZI B;  4NE5 A;  4EO5 C;  3LJA D;  5BT1 D;  5E5A C;  3REL A;  3REI B;  1P3F C;  2PYO A;  4XZQ C;  3C1B C;  4Z2M H;  3LZ1 C;  3VH6 A;  1HQ3 B;  3REI D;  1P3P C;  3REH C;  3WAA D;  1KU5 A;  3AZE D;  4Z5T C;  1P3P A;  1M18 D;  3AZI C;  3AZI A;  3W98 C;  1P3L B;  3O62 B;  4R8P C;  3REI A;  3AZL C;  4KUD C;  1HQ3 C;  1P3L D;  3AZE A;  3O62 D;  1HQ3 A;  4QLC C;  3B0C T;  1U35 C;  5AV6 B;  1B6W A;  5AV8 B;  3AZG B;  2NZD D;  1P3L A;  5AV8 D;  3O62 A;  3AZG D;  4AWL B;  4ZUX B;  3W97 C;  1KX3 D;  4YM6 C;  5DNM C;  4G91 C;  5AV6 A;  3MGR C;  5AV8 A;  3AN2 C;  1P3A C;  3AZG A;  5CP6 D;  4JJN B;  3REK C;  1EQZ B;  3REJ B;  3X1U B;  4WNN B;  4AWL C;  1P3K B;  1P3O B;  4ZUX C;  1Q9C A;  4J8W C;  5CPK B;  2FJ7 C;  4ZUX A;  3AV1 C;  2YFV B;  3KWQ B;  3C1C C;  5CP6 A;  3B6F D;  3UTA B;  5JRG B;  1EQZ C;  1P3B B;  3REJ C;  4JJN A;  3UT9 D;  3UTB C;  1P3K C;  1P3O C;  3WA9 D;  3MGQ C;  3X1U A;  4WNN A;  5JRG D;  5AV5 C;  1P3B D;  5CPK C;  4Z2M G;  5C3I B;  4YS3 C;  1P3O A;  3KWQ C;  3MVD B;  3AZM B;  4CSR B;  2YFV A;  3KWQ A;  3AZK C;  5BNX B;  4NE3 A;  2F8N K;  3LZ0 C;  3UTA A;  5JRG A;  1P3B A;  5BS7 C;  2BYK B;  3MGP D;  5B1M B;  5C3I C;  4KGC C;  1M19 C;  3MVD C;  5GT0 C;  3B6G B;  3MVD A;  1ID3 C;  3AZM A;  4CSR A;  4H9R B;  5BNX A;  3MGP A;  2BYK A;  5CPI B;  5B1M A;  3B0D B;  5B40 C;  2NQB C;  1BH8 B;  5FUG B;  1P34 B;  4H9Q B;  4WV4 B;  4J8U C;  3B6G A;  3B0C W;  3X1T B;  3AFA B;  3KUY C;  5F99 D;  4WU9 D;  4H9R A;  3X1S C;  5B0Y D;  3X1T D;  3AFA D;  4WU8 D;  3WKJ B;  5CPI C;  4H9S A;  1S32 D;  1P3G C;  5CPI A;  3WKJ D;  4H9N A;  5AVB D;  3KXB B;  4X23 B;  1BH8 A;  1M1A D;  2ARO B;  5FUG A;  1P34 A;  3KXB D;  4H9Q A;  5DNN C;  3AYW D;  1F66 B;  5B0Y A;  3AFA A;  1R4V A;  3X1T A;  4G92 B;  2ARO D;  2RVQ C;  3LJA B;  3WKJ A;  3REL C;  4HGA C;  2PYO C;  5JA4 B;  4X23 C;  1P3I B;  5B2J D;  3KXB A;  4X23 A;  2IO5 B;  3A6N D;  1F66 C;  3WAA B;  3AZE B;  1M18 B;  2ARO A;  5B0Z D;  5B31 D;  1F66 A;  3LJA A;  1AOI B;  3AZN D;  1H3O B;  3REI C;  3LEL D;  5JA4 A;  2F8N D;  1AOI D;  4NE6 A;  3WAA C;  2IO5 C;  4XZQ D;  5CPJ D;  3AZE C;  3AV2 D;  3WAA A;  3REH D;  1TZY B;  1M18 A;  5B2I D;  3AZN A;  1TZY D;  3LEL A;  3W98 D;  1KX4 B;  2NZD B;  4CAY B;  1AOI A;  2CV5 B;  1P3L C;  2L5A A;  1H3O A;  3O62 C;  4R8P D;  4J8V B;  3AZL D;  3W99 B;  1KX4 D;  4KUD D;  2CV5 D;  1KX3 B;  4J8V D;  3W99 D;  2HIO B;  1TZY A;  1U35 D;  4J8X D;  5AV6 C;  2BYM A;  5CP6 B;  2YFW B;  5AV8 C;  3AZG C;  2HIO D;  2NZD A;  1KX4 A;  4CAY A;  3B0B A;  2CV5 A;  3V9R B;  1KX3 C;  4J8V A;  1P3I D;  3W99 A;  5B1L B;  5AV9 B;  1KX3 A;  4YM6 D;  5GSU B;  3B6F B;  5CP6 C;  2HIO A;  5B1L D;  5AV9 D;  3MGR D;  3MNN B;  2HUE B;  5GSU D;  2YFW A;  3UT9 B;  4JJN C;  3WA9 B;  3MNN D;  5BNV B;  3X1U C;  3V9R A;  4J8W D;  5B1L A;  5AV9 A;  5GSU A;  5B33 D;  3C1C D;  3B6F A;  3UT9 C;  1KX5 D;  3WA9 C;  3UTA C;  3MNN A;  4Z66 B;  5JRG C;  1P3B C;  1ZLA B;  3MGP B;  3UT9 A;  3AZF B;  3WA9 A;  4KHA A;  4Z66 D;  5BNV A;  3TU4 D;  1ZLA D;  3AZF D;  5B33 A;  3X1V D;  3AZH B;  5AVC B;  3AZM C;  5B24 D;  4H9P A;  3AZH D;  5AVC D;  5GT3 B;  3MGP C;  4Z66 A;  3TU4 A;  1ZLA A;  3AZF A;  5GT3 D;  3AZJ B;  3X1V A;  5B1M C;  4H9N B;  1TAF B;  3AZJ D;  3AZH A;  5AVC A;  3B6G C;  5F99 B;  4WU9 B;  1BFM A;  5B0Y B;  3KSY A;  4WU8 B;  5GT3 A;  3NQJ B;  1S32 B;  5AY8 B;  4H9S C;  5AVB B;  1A7W A;  3AZJ A;  5AY8 D;  1M1A B;  3B0D C;  5F99 C;  5GXQ B;  3AYW B;  4WU9 C;  1P34 C;  1TAF A;  3WTP D;  5F99 A;  4WZS B;  5B0Y C;  3AFA C;  3KUY D;  3X1T C;  4WU9 A;  4LD9 B;  5GXQ D;  1S32 C;  3MGS B;  4WU8 A;  3WKJ C;  3NQJ A;  1S32 A;  5AY8 A;  4LD9 D;  5B2J B;  3MGS D;  5AVB A;  1M1A C;  2JSS A;  3A6N B;  3KXB C;  3WTP A;  1M1A A;  5B32 B;  5B0Z B;  5B31 B;  5GXQ A;  2ARO C;  3AYW A;  5DNN D;  3W96 B;  4XUJ D;  4M6B A;  4LD9 A;  5B32 D;  4G92 C;  2RVQ D;  4EO5 B;  3MGS A;  3AZN B;  5E5A B;  3LJA C;  2LY8 A;  5CHL B;  5BT1 C;  1JFI B;  3W96 D;  1P3M D;  1P3F B;  3LEL B;  2F8N B;  4XZQ B;  3A6N C;  3C1B B;  5B2J A;  2CWE A;  5CPJ B;  5E5A D;  3LZ1 B;  3AV2 B;  5B0Z C;  1P3F D;  3A6N A;  3REH B;  3C1B D;  3NQU A;  5B32 A;  5B2I B;  5B31 A;  5B0Z A;  3LZ1 D;  1M18 C;  3W96 A;  1P3P D;  5BO0 B;  1P3M A;  3AZN C;  2F8N H;  3W98 B;  4Z5T D;  3AZI D;  2BYM B;  3LEL C;  5E5A A;  1JFI A;  1AOI C;  4R8P B;  5CPJ C;  1P3F A;  3AZL B;  2F8N A;  4KUD B;  3AV2 C;  1WWS A;  4XZQ A;  3C1B A;  5CPJ A;  3LZ1 A;  3AV2 A;  5B2I C;  4QLC B;  1HQ3 D;  4NFT A;  3REH A;  1U35 B;  4J8X B;  4Z5T A;  5B2I A;  1TZY C;  4QLC D;  5BO0 A;  3W98 A;  4DRA A;  3VH5 W;  1KX4 C;  2NZD C;  2CV5 C;  4R8P A;  3AZL A;  4KUD A;  4J8V C; 
#chains in the Genus database with same CATH topology
 4UPK A;  2Y2M A;  3W99 C;  4DRB A;  3W97 B;  4YM6 B;  4J8X C;  5DNM B;  4QLC A;  4G91 B;  1U35 A;  4J8X A;  3W97 D;  3MGR B;  2HIO C;  4E44 A;  5DNM D;  5AV6 D;  3AN2 B;  1P3A B;  3REK B;  2DF4 C;  4H9O B;  1P3I C;  3AN2 D;  1P3A D;  3WTP E;  3REK D;  1P3I A;  3H0L C;  4KHA B;  4J8W B;  2FJ7 B;  2Y2G A;  3W97 A;  3AV1 B;  1ULY A;  4YM6 A;  1BH9 B;  5B1L C;  5DNM A;  4ZUX D;  5B33 B;  5AV9 C;  3C1C B;  5GSU C;  2FJ7 D;  3B6F C;  3AV1 D;  1KX5 B;  3MGR A;  3AN2 A;  2ZY3 A;  1P3A A;  4H9P B;  3MNN C;  2HUE C;  3VH6 W;  3REK A;  3UTB B;  4JJN D;  1B67 A;  4H9O A;  3MGQ B;  3P5J B;  4E45 A;  5AV5 B;  3TU4 B;  1EQZ D;  5B32 G;  5B31 G;  3REJ D;  3X1U D;  4YS3 B;  3R45 B;  3UTB D;  3X1V B;  1P3K D;  1P3O D;  2XD1 A;  3MGQ D;  4J8W A;  5B33 C;  2FJ7 A;  5AV5 D;  3AV1 A;  3AZK B;  5CPK D;  4YS3 D;  1BH9 A;  5B24 B;  3KWQ D;  3C1C A;  1KX5 C;  3LZ0 B;  2F8N G;  3AZK D;  1KX5 A;  1EQZ A;  3UTA D;  3REJ A;  4Z66 C;  3TU4 C;  1ZLA C;  3UTB A;  1P3K A;  3LZ0 D;  3AZF C;  3MGQ A;  4KGC B;  5AV5 A;  3X1V C;  1M19 B;  3VH5 T;  5CPK A;  4YS3 A;  3R45 A;  5GT0 B;  1WWI A;  5B24 C;  4KGC D;  1M19 D;  1ID3 B;  3MVD D;  3AZH C;  5AVC C;  3AZK A;  5KDM B;  3AZM D;  5B24 A;  5GT0 D;  1N1J B;  3LZ0 A;  1ID3 D;  5GT3 C;  4WJ3 C;  3H0R C;  5BS7 A;  2RIQ A;  5B40 B;  2BG1 A;  5B1M D;  3AZJ C;  1M19 A;  4KGC A;  2NQB B;  5GT0 A;  4J8U B;  3WTP B;  3KUY B;  5B40 D;  1ID3 A;  2NQB D;  3B6G D;  1F1E A;  5KDM A;  4J8U D;  3X1S B;  4WU8 C;  1N1J A;  1P3G B;  5AY8 C;  3VH6 T;  3X1S D;  5G49 B;  5AVB C;  5CPI D;  2ZY4 A;  5B40 A;  3WTP C;  1P3G D;  2NQB A;  3VH5 A;  5DNN B;  4J8U A;  1P34 D;  4ZBJ B;  5GXQ C;  4XUJ B;  3AYW C;  4UUZ B;  3KUY A;  3NQU B;  4LD9 C;  3X1S A;  3MGS C;  1P3M B;  3REL B;  4HGA B;  2PYO B;  1P3G A;  5B2J C;  5G49 A;  3REL D;  2PYO D;  4ZBJ C;  4XUJ C;  4X23 D;  1HTA A;  5B32 C;  5DNN A;  5B31 C;  1P3P B;  4XUJ A;  1F66 D;  4UUZ A;  3W96 C;  4Z5T B;  1P3M C;  3AZI B;  3EPK A;  4NE5 A;  4EO5 C;  3LJA D;  5BT1 D;  5E5A C;  3REL A;  3REI B;  1P3F C;  2PYO A;  4XZQ C;  3C1B C;  4Z2M H;  3LZ1 C;  3VH6 A;  1HQ3 B;  3REI D;  2XD5 A;  2W8S A;  1P3P C;  3REH C;  3WAA D;  1KU5 A;  3AZE D;  4Z5T C;  1P3P A;  1M18 D;  3AZI C;  3AZI A;  3AL0 C;  3W98 C;  1P3L B;  3O62 B;  4R8P C;  3REI A;  3AZL C;  4KUD C;  1HQ3 C;  1P3L D;  3AZE A;  3O62 D;  1HQ3 A;  4QLC C;  3B0C T;  1U35 C;  5AV6 B;  1B6W A;  5AV8 B;  3AZG B;  2NZD D;  1P3L A;  5AV8 D;  3O62 A;  3AZG D;  2Y2Q A;  4AWL B;  4ZUX B;  3W97 C;  1KX3 D;  4YM6 C;  5DNM C;  4G91 C;  5AV6 A;  3MGR C;  5AV8 A;  3AN2 C;  1P3A C;  3AZG A;  5CP6 D;  4JJN B;  3REK C;  1EQZ B;  3REJ B;  3X1U B;  4WNN B;  4AWL C;  1P3K B;  1P3O B;  4ZUX C;  1Q9C A;  4J8W C;  5CPK B;  2FJ7 C;  4ZUX A;  3AV1 C;  2YFV B;  3KWQ B;  3C1C C;  5CP6 A;  3B6F D;  3UTA B;  5JRG B;  1EQZ C;  1P3B B;  3A1K A;  3REJ C;  4JJN A;  3UT9 D;  3UTB C;  1P3K C;  1P3O C;  3WA9 D;  3MGQ C;  5JRG D;  4WNN A;  5AV5 C;  3X1U A;  1P3B D;  5CPK C;  2UWX A;  4Z2M G;  5C3I B;  4YS3 C;  1P3O A;  3KWQ C;  2J8P A;  3MVD B;  3AZM B;  4CSR B;  1W2E A;  2YFV A;  3KWQ A;  3AZK C;  5BNX B;  4NE3 A;  2F8N K;  3LZ0 C;  3UTA A;  5JRG A;  1P3B A;  3EPL A;  5BS7 C;  2BYK B;  3MGP D;  5B1M B;  5C3I C;  2ZY2 A;  4KGC C;  1M19 C;  3MVD C;  5GT0 C;  3B6G B;  3MVD A;  1ID3 C;  3AZM A;  4CSR A;  4H9R B;  2Y2H A;  5BNX A;  3MGP A;  2BYK A;  5CPI B;  5B1M A;  3B0D B;  5B40 C;  2NQB C;  1BH8 B;  2G5H C;  5FUG B;  1P34 B;  4H9Q B;  4WV4 B;  4J8U C;  3B6G A;  3B0C W;  3X1T B;  3AFA B;  3KUY C;  5F99 D;  4WU9 D;  4H9R A;  3H0M C;  3X1S C;  5B0Y D;  3X1T D;  3AFA D;  4WU8 D;  3WKJ B;  5CPI C;  4H9S A;  1S32 D;  1P3G C;  5CPI A;  3WKJ D;  4H9N A;  5AVB D;  3KXB B;  2ZY5 A;  4X23 B;  1BH8 A;  1M1A D;  2ARO B;  5FUG A;  1P34 A;  3KXB D;  4H9Q A;  5DNN C;  3AYW D;  1F66 B;  5B0Y A;  3AFA A;  1R4V A;  3X1T A;  4G92 B;  2ARO D;  2RVQ C;  3LJA B;  3WKJ A;  3REL C;  4HGA C;  2PYO C;  5JA4 B;  2Y2J A;  4X23 C;  1P3I B;  5B2J D;  3KXB A;  4X23 A;  2IO5 B;  3A6N D;  1F66 C;  2F2A C;  3WAA B;  3AZE B;  1M18 B;  2ARO A;  5B0Z D;  5B31 D;  1F66 A;  3LJA A;  1AOI B;  3AZN D;  1H3O B;  3REI C;  3LEL D;  5JA4 A;  2F8N D;  1AOI D;  4NE6 A;  3WAA C;  2IO5 C;  4XZQ D;  5CPJ D;  3AZE C;  3AV2 D;  3WAA A;  2Y2L A;  3REH D;  1TZY B;  1M18 A;  5B2I D;  3AZN A;  1TZY D;  3LEL A;  3W98 D;  1KX4 B;  2NZD B;  4CAY B;  1AOI A;  2CV5 B;  1P3L C;  2L5A A;  1H3O A;  3O62 C;  4R8P D;  4J8V B;  3AZL D;  3W99 B;  1KX4 D;  4KUD D;  2CV5 D;  1KX3 B;  3A1I A;  4J8V D;  3W99 D;  2HIO B;  1TZY A;  1U35 D;  4J8X D;  5AV6 C;  2BYM A;  5CP6 B;  2YFW B;  5AV8 C;  3AZG C;  2HIO D;  2NZD A;  1KX4 A;  4CAY A;  3B0B A;  2CV5 A;  3V9R B;  3F6T A;  1KX3 C;  4J8V A;  1P3I D;  3W99 A;  3FDD A;  5B1L B;  5AV9 B;  1KX3 A;  4YM6 D;  5GSU B;  3B6F B;  5CP6 C;  2HIO A;  5B1L D;  5AV9 D;  3MGR D;  3MNN B;  2HUE B;  5GSU D;  2YFW A;  3UT9 B;  4JJN C;  3WA9 B;  2Y2K A;  3MNN D;  5BNV B;  3X1U C;  3V9R A;  4J8W D;  5B1L A;  5AV9 A;  5GSU A;  5B33 D;  3C1C D;  3B6F A;  3UT9 C;  1KX5 D;  3WA9 C;  3UTA C;  3MNN A;  4Z66 B;  5JRG C;  1P3B C;  1ZLA B;  3MGP B;  3UT9 A;  3AZF B;  3WA9 A;  4KHA A;  2G5I C;  4Z66 D;  5BNV A;  3TU4 D;  1ZLA D;  3AZF D;  2ZM5 A;  5B33 A;  3X1V D;  3IP4 C;  5AVC B;  4DQY B;  3AZH B;  3AZM C;  5B24 D;  4H9P A;  3AZH D;  5AVC D;  2JCH A;  5GT3 B;  3MGP C;  4Z66 A;  3TU4 A;  1ZLA A;  3AZF A;  2VQR A;  5GT3 D;  3AZJ B;  3X1V A;  5B1M C;  2DQN C;  4H9N B;  1TAF B;  3KFU G;  3AZJ D;  1T3U A;  3AZH A;  5AVC A;  3B6G C;  5F99 B;  4WU9 B;  1BFM A;  2Y2I A;  5B0Y B;  3KSY A;  4WU8 B;  5GT3 A;  3NQJ B;  1S32 B;  5AY8 B;  4H9S C;  5AVB B;  3EG5 B;  1A7W A;  3AZJ A;  5AY8 D;  1M1A B;  3B0D C;  1PZR A;  5F99 C;  2Y2O A;  5GXQ B;  3AYW B;  4WU9 C;  1P34 C;  1TAF A;  3WTP D;  5F99 A;  4WZS B;  5B0Y C;  3AFA C;  3KUY D;  3X1T C;  4WU9 A;  4LD9 B;  5GXQ D;  1S32 C;  3MGS B;  4WU8 A;  3WKJ C;  3NQJ A;  1S32 A;  5AY8 A;  4LD9 D;  5B2J B;  3MGS D;  5AVB A;  1M1A C;  2JSS A;  3A6N B;  3KXB C;  3WTP A;  3EPJ A;  1M1A A;  5B32 B;  5B0Z B;  5B31 B;  5GXQ A;  2ARO C;  3AYW A;  5DNN D;  3W96 B;  4XUJ D;  4M6B A;  2Y2N A;  4LD9 A;  5B32 D;  4G92 C;  2RVQ D;  4EO5 B;  3MGS A;  3AZN B;  5E5A B;  3LJA C;  2LY8 A;  5CHL B;  5BT1 C;  1JFI B;  3W96 D;  1P3M D;  2FFF B;  1P3F B;  3LEL B;  2F8N B;  4XZQ B;  3A6N C;  3C1B B;  5B2J A;  2CWE A;  2Y2P A;  5CPJ B;  5E5A D;  3LZ1 B;  3EPH A;  3AV2 B;  5B0Z C;  1P3F D;  3A6N A;  3REH B;  2JE5 A;  3C1B D;  3NQU A;  5B32 A;  5B2I B;  5B31 A;  5B0Z A;  3LZ1 D;  1M18 C;  3W96 A;  1P3P D;  5BO0 B;  1P3M A;  3AZN C;  2F8N H;  3W98 B;  4Z5T D;  1Z2C B;  2BYM B;  3LEL C;  3AZI D;  5E5A A;  1JFI A;  1AOI C;  4R8P B;  5CPJ C;  1P3F A;  3AZL B;  2F8N A;  4KUD B;  3AV2 C;  1WWS A;  4XZQ A;  3C1B A;  5CPJ A;  3LZ1 A;  3AV2 A;  5B2I C;  4QLC B;  1HQ3 D;  4NFT A;  3REH A;  1U35 B;  4J8X B;  4Z5T A;  5B2I A;  1TZY C;  4QLC D;  5BO0 A;  3W98 A;  4DRA A;  3VH5 W;  1KX4 C;  2NZD C;  2CV5 C;  4R8P A;  3AZL A;  4KUD A;  4J8V C; 
#chains in the Genus database with same CATH homology
 4UPK A;  2Y2M A;  3W99 C;  4DRB A;  3W97 B;  4YM6 B;  4J8X C;  5DNM B;  4QLC A;  4G91 B;  1U35 A;  4J8X A;  3W97 D;  3MGR B;  2HIO C;  4E44 A;  5DNM D;  5AV6 D;  3AN2 B;  1P3A B;  3REK B;  2DF4 C;  4H9O B;  1P3I C;  3AN2 D;  1P3A D;  3WTP E;  3REK D;  1P3I A;  3H0L C;  4KHA B;  4J8W B;  2FJ7 B;  2Y2G A;  3W97 A;  3AV1 B;  1ULY A;  4YM6 A;  1BH9 B;  5B1L C;  5DNM A;  4ZUX D;  5B33 B;  5AV9 C;  3C1C B;  5GSU C;  2FJ7 D;  3B6F C;  3AV1 D;  1KX5 B;  3MGR A;  3AN2 A;  2ZY3 A;  1P3A A;  4H9P B;  3MNN C;  2HUE C;  3VH6 W;  3REK A;  3UTB B;  4JJN D;  1B67 A;  4H9O A;  3MGQ B;  3P5J B;  4E45 A;  5AV5 B;  3TU4 B;  1EQZ D;  5B32 G;  5B31 G;  3REJ D;  3X1U D;  4YS3 B;  3R45 B;  3UTB D;  3X1V B;  1P3K D;  1P3O D;  2XD1 A;  3MGQ D;  4J8W A;  5B33 C;  2FJ7 A;  5AV5 D;  3AV1 A;  3AZK B;  5CPK D;  4YS3 D;  1BH9 A;  5B24 B;  3KWQ D;  3C1C A;  1KX5 C;  3LZ0 B;  2F8N G;  3AZK D;  1KX5 A;  1EQZ A;  3UTA D;  3REJ A;  4Z66 C;  3TU4 C;  1ZLA C;  3UTB A;  1P3K A;  3LZ0 D;  3AZF C;  3MGQ A;  4KGC B;  5AV5 A;  3X1V C;  1M19 B;  3VH5 T;  5CPK A;  4YS3 A;  3R45 A;  5GT0 B;  1WWI A;  5B24 C;  4KGC D;  1M19 D;  1ID3 B;  3MVD D;  3AZH C;  5AVC C;  3AZK A;  5KDM B;  3AZM D;  5B24 A;  5GT0 D;  1N1J B;  3LZ0 A;  1ID3 D;  5GT3 C;  4WJ3 C;  3H0R C;  5BS7 A;  2RIQ A;  5B40 B;  2BG1 A;  5B1M D;  3AZJ C;  1M19 A;  4KGC A;  2NQB B;  5GT0 A;  4J8U B;  3WTP B;  3KUY B;  5B40 D;  1ID3 A;  2NQB D;  3B6G D;  1F1E A;  5KDM A;  4J8U D;  3X1S B;  4WU8 C;  1N1J A;  1P3G B;  5AY8 C;  3VH6 T;  3X1S D;  5G49 B;  5AVB C;  5CPI D;  2ZY4 A;  5B40 A;  3WTP C;  1P3G D;  2NQB A;  3VH5 A;  5DNN B;  4J8U A;  1P34 D;  4ZBJ B;  5GXQ C;  4XUJ B;  3AYW C;  4UUZ B;  3KUY A;  3NQU B;  4LD9 C;  3X1S A;  3MGS C;  1P3M B;  3REL B;  4HGA B;  2PYO B;  1P3G A;  5B2J C;  5G49 A;  3REL D;  2PYO D;  4ZBJ C;  4XUJ C;  4X23 D;  1HTA A;  5B32 C;  5DNN A;  5B31 C;  1P3P B;  4XUJ A;  1F66 D;  4UUZ A;  3W96 C;  4Z5T B;  1P3M C;  3AZI B;  3EPK A;  4NE5 A;  4EO5 C;  3LJA D;  5BT1 D;  5E5A C;  3REL A;  3REI B;  1P3F C;  2PYO A;  4XZQ C;  3C1B C;  4Z2M H;  3LZ1 C;  3VH6 A;  1HQ3 B;  3REI D;  2XD5 A;  2W8S A;  1P3P C;  3REH C;  3WAA D;  1KU5 A;  3AZE D;  4Z5T C;  1P3P A;  1M18 D;  3AZI C;  3AZI A;  3AL0 C;  3W98 C;  1P3L B;  3O62 B;  4R8P C;  3REI A;  3AZL C;  4KUD C;  1HQ3 C;  1P3L D;  3AZE A;  3O62 D;  1HQ3 A;  4QLC C;  3B0C T;  1U35 C;  5AV6 B;  1B6W A;  5AV8 B;  3AZG B;  2NZD D;  1P3L A;  5AV8 D;  3O62 A;  3AZG D;  2Y2Q A;  4AWL B;  4ZUX B;  3W97 C;  1KX3 D;  4YM6 C;  5DNM C;  4G91 C;  5AV6 A;  3MGR C;  5AV8 A;  3AN2 C;  1P3A C;  3AZG A;  5CP6 D;  4JJN B;  3REK C;  1EQZ B;  3REJ B;  3X1U B;  4WNN B;  4AWL C;  1P3K B;  1P3O B;  4ZUX C;  1Q9C A;  4J8W C;  5CPK B;  2FJ7 C;  4ZUX A;  3AV1 C;  2YFV B;  3KWQ B;  3C1C C;  5CP6 A;  3B6F D;  3UTA B;  5JRG B;  1EQZ C;  1P3B B;  3A1K A;  3REJ C;  4JJN A;  3UT9 D;  3UTB C;  1P3K C;  1P3O C;  3WA9 D;  3MGQ C;  5JRG D;  4WNN A;  5AV5 C;  3X1U A;  1P3B D;  5CPK C;  2UWX A;  4Z2M G;  5C3I B;  4YS3 C;  1P3O A;  3KWQ C;  2J8P A;  3MVD B;  3AZM B;  4CSR B;  1W2E A;  2YFV A;  3KWQ A;  3AZK C;  5BNX B;  4NE3 A;  2F8N K;  3LZ0 C;  3UTA A;  5JRG A;  1P3B A;  3EPL A;  5BS7 C;  2BYK B;  3MGP D;  5B1M B;  5C3I C;  2ZY2 A;  4KGC C;  1M19 C;  3MVD C;  5GT0 C;  3B6G B;  3MVD A;  1ID3 C;  3AZM A;  4CSR A;  4H9R B;  2Y2H A;  5BNX A;  3MGP A;  2BYK A;  5CPI B;  5B1M A;  3B0D B;  5B40 C;  2NQB C;  1BH8 B;  2G5H C;  5FUG B;  1P34 B;  4H9Q B;  4WV4 B;  4J8U C;  3B6G A;  3B0C W;  3X1T B;  3AFA B;  3KUY C;  5F99 D;  4WU9 D;  4H9R A;  3H0M C;  3X1S C;  5B0Y D;  3X1T D;  3AFA D;  4WU8 D;  3WKJ B;  5CPI C;  4H9S A;  1S32 D;  1P3G C;  5CPI A;  3WKJ D;  4H9N A;  5AVB D;  3KXB B;  2ZY5 A;  4X23 B;  1BH8 A;  1M1A D;  2ARO B;  5FUG A;  1P34 A;  3KXB D;  4H9Q A;  5DNN C;  3AYW D;  1F66 B;  5B0Y A;  3AFA A;  1R4V A;  3X1T A;  4G92 B;  2ARO D;  2RVQ C;  3LJA B;  3WKJ A;  3REL C;  4HGA C;  2PYO C;  5JA4 B;  2Y2J A;  4X23 C;  1P3I B;  5B2J D;  3KXB A;  4X23 A;  2IO5 B;  3A6N D;  1F66 C;  2F2A C;  3WAA B;  3AZE B;  1M18 B;  2ARO A;  5B0Z D;  5B31 D;  1F66 A;  3LJA A;  1AOI B;  3AZN D;  1H3O B;  3REI C;  3LEL D;  5JA4 A;  2F8N D;  1AOI D;  4NE6 A;  3WAA C;  2IO5 C;  4XZQ D;  5CPJ D;  3AZE C;  3AV2 D;  3WAA A;  2Y2L A;  3REH D;  1TZY B;  1M18 A;  5B2I D;  3AZN A;  1TZY D;  3LEL A;  3W98 D;  1KX4 B;  2NZD B;  4CAY B;  1AOI A;  2CV5 B;  1P3L C;  2L5A A;  1H3O A;  3O62 C;  4R8P D;  4J8V B;  3AZL D;  3W99 B;  1KX4 D;  4KUD D;  2CV5 D;  1KX3 B;  3A1I A;  4J8V D;  3W99 D;  2HIO B;  1TZY A;  1U35 D;  4J8X D;  5AV6 C;  2BYM A;  5CP6 B;  2YFW B;  5AV8 C;  3AZG C;  2HIO D;  2NZD A;  1KX4 A;  4CAY A;  3B0B A;  2CV5 A;  3V9R B;  3F6T A;  1KX3 C;  4J8V A;  1P3I D;  3W99 A;  3FDD A;  5B1L B;  5AV9 B;  1KX3 A;  4YM6 D;  5GSU B;  3B6F B;  5CP6 C;  2HIO A;  5B1L D;  5AV9 D;  3MGR D;  3MNN B;  2HUE B;  5GSU D;  2YFW A;  3UT9 B;  4JJN C;  3WA9 B;  2Y2K A;  3MNN D;  5BNV B;  3X1U C;  3V9R A;  4J8W D;  5B1L A;  5AV9 A;  5GSU A;  5B33 D;  3C1C D;  3B6F A;  3UT9 C;  1KX5 D;  3WA9 C;  3UTA C;  3MNN A;  4Z66 B;  5JRG C;  1P3B C;  1ZLA B;  3MGP B;  3UT9 A;  3AZF B;  3WA9 A;  4KHA A;  2G5I C;  4Z66 D;  5BNV A;  3TU4 D;  1ZLA D;  3AZF D;  2ZM5 A;  5B33 A;  3X1V D;  3IP4 C;  5AVC B;  4DQY B;  3AZH B;  3AZM C;  5B24 D;  4H9P A;  3AZH D;  5AVC D;  2JCH A;  5GT3 B;  3MGP C;  4Z66 A;  3TU4 A;  1ZLA A;  3AZF A;  2VQR A;  5GT3 D;  3AZJ B;  3X1V A;  5B1M C;  2DQN C;  4H9N B;  1TAF B;  3KFU G;  3AZJ D;  1T3U A;  3AZH A;  5AVC A;  3B6G C;  5F99 B;  4WU9 B;  1BFM A;  2Y2I A;  5B0Y B;  3KSY A;  4WU8 B;  5GT3 A;  3NQJ B;  1S32 B;  5AY8 B;  4H9S C;  5AVB B;  3EG5 B;  1A7W A;  3AZJ A;  5AY8 D;  1M1A B;  3B0D C;  1PZR A;  5F99 C;  2Y2O A;  5GXQ B;  3AYW B;  4WU9 C;  1P34 C;  1TAF A;  3WTP D;  5F99 A;  4WZS B;  5B0Y C;  3AFA C;  3KUY D;  3X1T C;  4WU9 A;  4LD9 B;  5GXQ D;  1S32 C;  3MGS B;  4WU8 A;  3WKJ C;  3NQJ A;  1S32 A;  5AY8 A;  4LD9 D;  5B2J B;  3MGS D;  5AVB A;  1M1A C;  2JSS A;  3A6N B;  3KXB C;  3WTP A;  3EPJ A;  1M1A A;  5B32 B;  5B0Z B;  5B31 B;  5GXQ A;  2ARO C;  3AYW A;  5DNN D;  3W96 B;  4XUJ D;  4M6B A;  2Y2N A;  4LD9 A;  5B32 D;  4G92 C;  2RVQ D;  4EO5 B;  3MGS A;  3AZN B;  5E5A B;  3LJA C;  2LY8 A;  5CHL B;  5BT1 C;  1JFI B;  3W96 D;  1P3M D;  2FFF B;  1P3F B;  3LEL B;  2F8N B;  4XZQ B;  3A6N C;  3C1B B;  5B2J A;  2CWE A;  2Y2P A;  5CPJ B;  5E5A D;  3LZ1 B;  3EPH A;  3AV2 B;  5B0Z C;  1P3F D;  3A6N A;  3REH B;  2JE5 A;  3C1B D;  3NQU A;  5B32 A;  5B2I B;  5B31 A;  5B0Z A;  3LZ1 D;  1M18 C;  3W96 A;  1P3P D;  5BO0 B;  1P3M A;  3AZN C;  2F8N H;  3W98 B;  4Z5T D;  1Z2C B;  2BYM B;  3LEL C;  3AZI D;  5E5A A;  1JFI A;  1AOI C;  4R8P B;  5CPJ C;  1P3F A;  3AZL B;  2F8N A;  4KUD B;  3AV2 C;  1WWS A;  4XZQ A;  3C1B A;  5CPJ A;  3LZ1 A;  3AV2 A;  5B2I C;  4QLC B;  1HQ3 D;  4NFT A;  3REH A;  1U35 B;  4J8X B;  4Z5T A;  5B2I A;  1TZY C;  4QLC D;  5BO0 A;  3W98 A;  4DRA A;  3VH5 W;  1KX4 C;  2NZD C;  2CV5 C;  4R8P A;  3AZL A;  4KUD A;  4J8V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...