3MGSD

Binding of cesium ions to the nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 38
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgsD00
5B0ZB 3AZIC 1TAFB 2CV5D 3AZLD 5E5AA 4H9SA 5GT0A 2NQBB 5BT1C 1P3PD 4G92C 5B2IC 5BO0A 4H9RA 1ZLAD 4Z66D 3AYWB 3O62B 4G91B 3AZHC 3AZND 5B32B 3KUYD 5AVBD 4J8XC 3X1UA 3REIB 2CV5A 3AZLA 1M18B 3WAAD 3C1BC 2AROD 3WKJD 3X1VD 1P3GC 3V9RB 1P3PA 3A6ND 4NE3A 1R4VA 4Z66A 1S32D 4YM6A 3MVDB 4R8PD 2JSSA 3KXBB 3REJD 1EQZB 4Z5TA 5B1MA 4ZUXA 1P3LB 1AOIA 4E45A 3KUYA 1F66C 5AV8B 2AROA 3WKJA 1P34C 4CAYA 3A6NA 4XZQD 5CPJC 5BO0B 1S32A 3UTBD 1P3ID 5CP6D 1H3OB 3LJAC 4JJNC 3X1TA 3W99D 5GT3D 5CPIB 1P3AC 3REJA 5DNND 4KUDB 3LZ1D 4LD9B 3AZJC 5AY8A 3KWQB 3MGQD 2BYKA 1KX5B 3B0CT 3AV2D 5E5AC 4AWLB 1ID3D 4KGCC 4H9SC 4ZBJB 5GT0C 5AV9A 1P3PB 3VH6A 3AZEB 1M19A 1P3IA 4H9OA 3B6GD 1ZLAB 5CP6A 3UTAC 1BH8A 5DNMC 3MGPD 2HIOA 3VH6T 3LZ1A 3VH5T 1P3BD 1HQ3C 1B67A 5B2JB 3AZNB 2FJ7C 5B33B 5B32G 3VH5W 5AVBB 2F8ND 5B0ZD 3X1UC 2CV5C 3AV2A 3WAAB 1ID3A 1P3OA 3WKJB 3X1VB 4H9QA 2NQBD 4UUZA 3A6NB 4Z66C 1S32B 3MGPA 4YM6C 1B6WA 1P3FA 4R8PB 4J8UB 4Z5TC 5B1MC 4ZUXC 1AOIC 5B24D 5B0ZA 1TAFA 5B0YC 3MNND 4EO5B 1HTAA 2NQBA 5AV6D 2HUEB 3MGSD 4XZQB 5BNVB 3AYWA 4H9OB 3UTBB 5AV5D 3X1TC 3W99B 3O62A 5GT3B 3W98D 2RVQD 1M1AC 5DNNB 3LZ1B 1P3LD 5F99D 5B32A 4WNNB 5GSUB 5AY8C 3MGQB 5AV8D 3WTPC 3X1SC 3V9RA 5AV9C 3AZMB 3LZ0D 3MGSA 1U35D 3RELD 1M19C 1KX3D 1TZYB 4NE6A 1WWSA 4H9NB 5B40D 3B6GB 3AZKC 1JFIB 3LELB 3MGPB 3KXBA 1EQZA 2HIOC 1P3BB 1P3LA 5F99A 3AZFC 2PYOD 5AV8A 2F8NB 3AZGD 1ID3C 1P3OC 5BNXB 5C3IC 5GXQD 4QLCD 1U35A 3RELA 4WU8C 3AZED 1H3OA 1WWIA 4WU9D 5FUGB 5CPIA 1P3FC 4KUDA 4LD9A 5B2JD 5JRGD 5B33D 3KWQA 3MGRC 5CPKB 1KX5A 5B24B 3AZGA 4HGAC 4NFTA 3MNNB 1KU5A 3R45A 5GXQA 4J8XB 3W96D 5AV6B 3AZEA 3MGSB 3AYWC 1ZLAA 5AV5B 3O62C 4G91C 3REKC 4XUJD 4J8UD 3W98B 5JA4B 5B2JA 3AZNA 5B32C 5B33A 5F99B 5AVBA 3REIC 1M18C 2F8NH 3WAAA 3X1VA 3B0DB 3AN2D 5B1LD 3LZ0B 5BS7A 1U35B 3RELB 1KX3B 4X23D 5B40B 3REHC 3B6FD 1N1JB 3MVDC 5KDMB 3W97D 4R8PA 3KXBC 4J8WD 4J8UA 1EQZC 1P3MD 1P3LC 5GSUD 2PYOB 3AFAD 3KSYA 5AV8C 4J8VB 2F8NG 3AZGB 1F1EA 2YFVB 5AVCD 3R45B 5GXQB 5B31D 3C1CD 3AZMD 4QLCB 4XZQA 5BNVA 1TZYD 2L5AA 3VH5A 3UTBA 4YS3B 1KX4D 4KGCB 5CHLB 4WU9B 3LELD 3W99A 5CPIC 5GT3A 3WA9D 5DNNA 4KUDC 3AV1D 4LD9C 4WNNA 2NZDB 5GSUA 5JRGB 3UT9D 3KWQC 3AFAA 3MGQA 1KX5C 1HQ3B 3AZLC 4AWLC 2FJ7B 4ZBJC 3C1CA 3AZMA 3W96B 1P3PC 3AZEC 1TZYA 4H9NA 3B6GA 1ZLAC 4KHAB 1JFIA 3LELA 5BT1D 5B2ID 5G49B 4XUJB 3AV1A 1P3BA 4DRAA 5B2JC 3AZNC 1BFMA 3KUYC 5AVBC 5CPKD 2F8NA 3AZHD 1P3KB 3WAAC 2AROC 5BNXA 3X1VC 3TU4B 3WKJC 4CSRA 4J8XD 4DRBA 3AN2B 5B1LB 5BS7C 3A6NC 3C1BD 1S32C 4X23B 1P3GD 3B6FB 5FUGA 2IO5B 3W97B 4R8PC 4J8WB 3REJC 3B0BA 1P3MB 5CPKA 5B24A 3AFAB 1M1AB 3AZHA 3MNNA 4EO5C 4J8XA 1F66D 4Z2MG 5AVCB 2HUEC 5B31B 5AV6A 3C1CB 4XZQC 1P34D 1P3IC 3UTBC 1KX4B 5AV5A 5CP6C 3W99C 5GT3C 5CPJD 3W98A 3WA9B 5JA4A 5DNNC 3LZ1C 3LJAD 3AZKB 4JJND 3AV1B 1P3AD 3UT9B 3MGQC 3NQUB 4J8VD 3AV2C 2F8NK 3AZMC 4CSRB 3LZ0A 3AZIB 1TZYC 1KX3A 3B6GC 5C3IB 5B40A 4YS3D 4KGCD 1N1JA 5GT0D 5KDMA 4WU8B 3MGPC 4G92B 5CPJA 5B2IB 1P3BC 3UTAD 5DNMD 2NZDD 2PYOA 4WV4B 5B0ZC 4J8VA 1HQ3D 3AZHB 2FJ7D 2YFVA 2YFWB 4QLCA 3X1UD 2NQBC 4HGAB 2BYMB 4YS3A 4KGCA 3C1BB 1BH9B 4WU9A 1P3GB 4M6BA 4NE5A 3UTAA 5DNMA 2NZDA 5JRGA 4YM6D 3REKB 5CPKC 5B24C 4Z5TD 1HQ3A 5B1MD 1P3KD 4ZUXD 3MNNC 3NQJB 3TU4D 1AOID 2FJ7A 1F66B 3W96A 5AV6C 3MGSC 5B31G 5B0YD 1P34B 4KHAA 5AV5C 2LY8A 3WTPE 5G49A 5CPJB 3W98C 4XUJA 2CWEA 3REHB 2RVQC 4WZSB 3X1TD 3LJAB 5F99C 4JJNB 1P3AB 1M1AD 1P3KA 3TU4A 3AZJB 3B0DC 4H9PA 5AY8D 3AN2A 3LZ0C 5B1LA 5B0YA 1U35C 3RELC 1KX3C 5E5AB 3X1SD 3WTPD 4X23A 5B40C 3B6FA 5GT0B 5AV9D 3W97A 1M19D 4H9RB 4J8WA 1P3MA 1A7WA 3UTAB 3AZKD 5DNMB 2HIOD 2PYOC 1M1AA 4J8VC 3AZGC 3AZFD 5GXQC 5AVCA 5B31A 4QLCC 3X1UB 3AZID 2CV5B 3AZLB 4YS3C 3X1SA 3WTPA 1P3OD 1KX4A 3B0CW 4WU9C 4WU8D 1ULYA 3WA9A 4Z66B 3AZKA 2NZDC 5JRGC 4YM6B 5B33C 3UT9A 1P3FD 3NQUA 4Z5TB 5B1MB 4ZUXB 3AZFA 3VH6W 3MGRD 1AOIB 3KUYB 4Z2MH 3W96C 4H9PB 3AZIA 5B0YB 2AROB 1Q9CA 4WU8A 4CAYB 5B2IA 3AYWD 4XUJC 4J8UC 3X1TB 3O62D 3REKD 3REJB 1P3KC 3TU4C 5B32D 2YFWA 3MGRA 3AN2C 5AY8B 3REID 2BYKB 1M18D 5B1LC 2BYMA 3C1BA 4X23C 1BH9A 3WTPB 3X1SB 3B6FC 1P3GA 5AV9B 2IO5C 3W97C 1M19B 4J8WC 1P3IB 3REHD 1P3MC 5CP6B 3MVDD 1BH8B 3REKA 5GSUC 3KXBD 1EQZD 2HIOB 3AFAC 3NQJA 3AZFB 3AZJD 1F66A 3REIA 5AVCC 5B31C 3C1CC 1M18A 3AV2B 1P34A 5E5AD 1ID3B 1P3OB 1KX4C 4H9QB 3LELC 4UUZB 3REHA 3WA9C 3AV1C 3MVDA 3LJAA 4JJNA 4E44A 5CPID 1P3AA 3UT9C 1P3FB 4KUDD 4LD9D 3AZJA 3KWQD 3MGRB 1KX5D
chains in the Genus database with same CATH superfamily
5B0ZB 3AZIC 1TAFB 2CV5D 3AZLD 5E5AA 4H9SA 5GT0A 2NQBB 5BT1C 1P3PD 4G92C 5B2IC 5BO0A 4H9RA 1ZLAD 4Z66D 3AYWB 3O62B 4G91B 3AZHC 3AZND 5B32B 2ZY5A 3KUYD 5AVBD 4J8XC 3X1UA 3REIB 2CV5A 3AZLA 1M18B 3WAAD 3C1BC 2AROD 3WKJD 3X1VD 2XD5A 1P3GC 3V9RB 1P3PA 3F6TA 1Z2CB 3A6ND 4NE3A 1R4VA 4Z66A 1S32D 2JE5A 4YM6A 3MVDB 2J8PA 4R8PD 2JSSA 3KXBB 3REJD 1EQZB 4Z5TA 5B1MA 4ZUXA 1P3LB 1AOIA 4E45A 3KUYA 1F66C 5AV8B 2AROA 3WKJA 1P34C 2Y2QA 4CAYA 3A6NA 4XZQD 5CPJC 5BO0B 1S32A 2F2AC 3UTBD 1P3ID 5CP6D 1H3OB 3LJAC 4JJNC 3X1TA 3W99D 5GT3D 5CPIB 1P3AC 3REJA 5DNND 4KUDB 3LZ1D 4LD9B 3AZJC 5AY8A 3KWQB 3MGQD 2BYKA 1KX5B 3B0CT 3AV2D 3H0RC 5E5AC 4AWLB 1ID3D 4KGCC 4H9SC 4ZBJB 5GT0C 5AV9A 3EPHA 1P3PB 3VH6A 3AZEB 1M19A 1P3IA 4H9OA 3B6GD 1ZLAB 5CP6A 3UTAC 1BH8A 5DNMC 3MGPD 2HIOA 3VH6T 3LZ1A 3VH5T 1P3BD 1HQ3C 1B67A 5B2JB 3AZNB 2FJ7C 5B33B 5B32G 3VH5W 5AVBB 2F8ND 5B0ZD 3X1UC 2CV5C 3AV2A 3WAAB 1ID3A 1P3OA 3WKJB 3X1VB 4H9QA 2Y2IA 2NQBD 4UUZA 3A6NB 4Z66C 3KFUG 1S32B 3MGPA 4YM6C 1B6WA 1P3FA 4R8PB 4J8UB 4Z5TC 5B1MC 4ZUXC 1AOIC 5B24D 5B0ZA 2RIQA 1TAFA 5B0YC 3MNND 4EO5B 1HTAA 2NQBA 5AV6D 2JCHA 2HUEB 3MGSD 4XZQB 5BNVB 3AYWA 4H9OB 3UTBB 5AV5D 3X1TC 3W99B 3O62A 5GT3B 3W98D 2RVQD 1M1AC 5DNNB 2DQNC 3LZ1B 1P3LD 5F99D 5B32A 4WNNB 5GSUB 5AY8C 3MGQB 5AV8D 2DF4C 3WTPC 3X1SC 3V9RA 5AV9C 3AZMB 3LZ0D 3MGSA 1U35D 3RELD 1M19C 1KX3D 1TZYB 4NE6A 1WWSA 2G5IC 4H9NB 5B40D 3B6GB 3AZKC 1JFIB 3LELB 3MGPB 3KXBA 1EQZA 2HIOC 1W2EA 1P3BB 1P3LA 5F99A 3AZFC 2PYOD 3P5JB 5AV8A 2F8NB 3AZGD 1ID3C 1P3OC 5BNXB 5C3IC 5GXQD 4QLCD 1U35A 3RELA 4WU8C 3AZED 1H3OA 1WWIA 2G5HC 4WU9D 5FUGB 5CPIA 1P3FC 4KUDA 4LD9A 5B2JD 5JRGD 5B33D 2VQRA 3KWQA 3MGRC 5CPKB 1KX5A 5B24B 3AZGA 4HGAC 4NFTA 3MNNB 1KU5A 3R45A 5GXQA 4J8XB 3W96D 5AV6B 3AZEA 3MGSB 3AYWC 1ZLAA 5AV5B 3O62C 4G91C 3REKC 4XUJD 4J8UD 3W98B 5JA4B 5B2JA 3AZNA 5B32C 5B33A 5F99B 2Y2HA 5AVBA 3REIC 1M18C 2F8NH 3WAAA 3X1VA 3B0DB 3AN2D 2Y2NA 5B1LD 3LZ0B 5BS7A 1U35B 3A1IA 3RELB 1KX3B 4X23D 5B40B 3REHC 3B6FD 1N1JB 3MVDC 5KDMB 3W97D 4R8PA 3KXBC 4J8WD 4J8UA 1EQZC 1P3MD 1P3LC 2ZM5A 3AL0C 5GSUD 2PYOB 3AFAD 3KSYA 5AV8C 4J8VB 2F8NG 3AZGB 1F1EA 2YFVB 3A1KA 3R45B 5GXQB 5B31D 5AVCD 3C1CD 4QLCB 3AZMD 4XZQA 5BNVA 1TZYD 2L5AA 2ZY2A 3VH5A 3EPJA 3UTBA 4YS3B 1KX4D 4KGCB 5CHLB 4WU9B 3LELD 3W99A 5CPIC 5GT3A 4DQYB 3WA9D 5DNNA 4KUDC 3AV1D 4LD9C 4WNNA 2NZDB 5GSUA 5JRGB 3UT9D 3KWQC 3AFAA 3MGQA 1KX5C 1HQ3B 3EPKA 3AZLC 4AWLC 3EG5B 2FJ7B 4ZBJC 3C1CA 3AZMA 3W96B 1P3PC 3AZEC 1TZYA 4H9NA 3B6GA 1ZLAC 4KHAB 1JFIA 3LELA 5BT1D 5B2ID 5G49B 4XUJB 3AV1A 1P3BA 2Y2PA 4DRAA 5B2JC 3AZNC 1BFMA 3KUYC 5AVBC 5CPKD 2F8NA 3AZHD 1P3KB 3WAAC 2AROC 5BNXA 3X1VC 3TU4B 3WKJC 4CSRA 4J8XD 4DRBA 2XD1A 3AN2B 5B1LB 5BS7C 3A6NC 2W8SA 3C1BD 1S32C 2Y2GA 4X23B 2BG1A 1P3GD 3B6FB 2Y2LA 5FUGA 2IO5B 3W97B 4R8PC 4J8WB 3REJC 3B0BA 1P3MB 1PZRA 2ZY3A 5CPKA 2FFFB 5B24A 3AFAB 1M1AB 3AZHA 3MNNA 4EO5C 4J8XA 1F66D 4Z2MG 5AVCB 2HUEC 5B31B 5AV6A 3C1CB 4XZQC 1P34D 1P3IC 3UTBC 1KX4B 5AV5A 5CP6C 3W99C 3H0MC 5GT3C 5CPJD 3W98A 3WA9B 5JA4A 5DNNC 3LZ1C 3LJAD 3AZKB 4JJND 3FDDA 3AV1B 1P3AD 3UT9B 3MGQC 3NQUB 4J8VD 3AV2C 2F8NK 3AZMC 4CSRB 3LZ0A 3AZIB 1TZYC 1KX3A 3B6GC 5C3IB 5B40A 4YS3D 4KGCD 1N1JA 5GT0D 5KDMA 4WU8B 3MGPC 4G92B 5CPJA 5B2IB 1P3BC 3UTAD 1T3UA 5DNMD 2NZDD 2PYOA 2UWXA 4WV4B 5B0ZC 4J8VA 1HQ3D 3AZHB 2FJ7D 2YFWB 2YFVA 4QLCA 3X1UD 2NQBC 4HGAB 2BYMB 4YS3A 2Y2MA 3C1BB 4KGCA 1BH9B 4WU9A 1P3GB 4M6BA 4NE5A 3UTAA 5DNMA 2NZDA 5JRGA 4YM6D 3REKB 5CPKC 5B24C 4Z5TD 1HQ3A 5B1MD 1P3KD 4ZUXD 3MNNC 3NQJB 3TU4D 1AOID 2FJ7A 1F66B 3W96A 5AV6C 3MGSC 5B31G 5B0YD 1P34B 4KHAA 5AV5C 2LY8A 3WTPE 5G49A 5CPJB 3W98C 4XUJA 2CWEA 2ZY4A 2RVQC 4WZSB 3REHB 3X1TD 3LJAB 5F99C 4JJNB 2Y2KA 1P3AB 1M1AD 1P3KA 3TU4A 2Y2OA 3AZJB 3B0DC 4H9PA 5AY8D 3AN2A 3LZ0C 5B1LA 5B0YA 1U35C 3RELC 1KX3C 5E5AB 3X1SD 3WTPD 4X23A 5B40C 3B6FA 5GT0B 5AV9D 3W97A 4UPKA 1M19D 4H9RB 4J8WA 1P3MA 1A7WA 3UTAB 3AZKD 5DNMB 2HIOD 2PYOC 1M1AA 4J8VC 3AZGC 3AZFD 5GXQC 5AVCA 5B31A 4QLCC 3X1UB 3AZID 2CV5B 3AZLB 2Y2JA 4YS3C 3X1SA 3WTPA 1P3OD 1KX4A 3B0CW 4WU9C 4WU8D 1ULYA 3WA9A 4Z66B 3AZKA 2NZDC 5JRGC 4YM6B 5B33C 3UT9A 1P3FD 3NQUA 4Z5TB 5B1MB 4ZUXB 3AZFA 3VH6W 3MGRD 1AOIB 3KUYB 4Z2MH 3W96C 4H9PB 3AZIA 5B0YB 2AROB 1Q9CA 4WU8A 4CAYB 5B2IA 3AYWD 4XUJC 4J8UC 3X1TB 3O62D 3REKD 3REJB 1P3KC 3TU4C 5B32D 2YFWA 3MGRA 3AN2C 5AY8B 3REID 2BYKB 1M18D 5B1LC 2BYMA 3C1BA 4WJ3C 4X23C 1BH9A 3WTPB 3X1SB 3B6FC 1P3GA 5AV9B 2IO5C 3W97C 1M19B 4J8WC 1P3IB 3REHD 1P3MC 5CP6B 3MVDD 1BH8B 3REKA 5GSUC 3KXBD 1EQZD 2HIOB 3AFAC 3NQJA 3AZFB 3AZJD 1F66A 3REIA 5AVCC 5B31C 3C1CC 1M18A 3AV2B 3H0LC 1P34A 3IP4C 5E5AD 1ID3B 1P3OB 1KX4C 4H9QB 3LELC 4UUZB 3REHA 3WA9C 3AV1C 3MVDA 3LJAA 4JJNA 4E44A 5CPID 1P3AA 3UT9C 1P3FB 4KUDD 4LD9D 3EPLA 3AZJA 3KWQD 3MGRB 1KX5D
chains in the Genus database with same CATH topology
5B0ZB 3AZIC 1TAFB 2CV5D 3AZLD 5E5AA 4H9SA 5GT0A 2NQBB 5BT1C 1P3PD 4G92C 5B2IC 5BO0A 4H9RA 1ZLAD 4Z66D 3AYWB 3O62B 4G91B 3AZHC 3AZND 5B32B 2ZY5A 3KUYD 5AVBD 4J8XC 3X1UA 3REIB 2CV5A 3AZLA 1M18B 3WAAD 3C1BC 2AROD 3WKJD 3X1VD 2XD5A 1P3GC 3V9RB 1P3PA 3F6TA 1Z2CB 3A6ND 4NE3A 1R4VA 4Z66A 1S32D 2JE5A 4YM6A 3MVDB 2J8PA 4R8PD 2JSSA 3KXBB 3REJD 1EQZB 4Z5TA 5B1MA 4ZUXA 1P3LB 1AOIA 4E45A 3KUYA 1F66C 5AV8B 2AROA 3WKJA 1P34C 2Y2QA 4CAYA 3A6NA 4XZQD 5CPJC 5BO0B 1S32A 2F2AC 3UTBD 1P3ID 5CP6D 1H3OB 3LJAC 4JJNC 3X1TA 3W99D 5GT3D 5CPIB 1P3AC 3REJA 5DNND 4KUDB 3LZ1D 4LD9B 3AZJC 5AY8A 3KWQB 3MGQD 2BYKA 1KX5B 3B0CT 3AV2D 3H0RC 5E5AC 4AWLB 1ID3D 4KGCC 4H9SC 4ZBJB 5GT0C 5AV9A 3EPHA 1P3PB 3VH6A 3AZEB 1M19A 1P3IA 4H9OA 3B6GD 1ZLAB 5CP6A 3UTAC 1BH8A 5DNMC 3MGPD 2HIOA 3VH6T 3LZ1A 3VH5T 1P3BD 1HQ3C 1B67A 5B2JB 3AZNB 2FJ7C 5B33B 5B32G 3VH5W 5AVBB 2F8ND 5B0ZD 3X1UC 2CV5C 3AV2A 3WAAB 1ID3A 1P3OA 3WKJB 3X1VB 4H9QA 2Y2IA 2NQBD 4UUZA 3A6NB 4Z66C 3KFUG 1S32B 3MGPA 4YM6C 1B6WA 1P3FA 4R8PB 4J8UB 4Z5TC 5B1MC 4ZUXC 1AOIC 5B24D 5B0ZA 2RIQA 1TAFA 5B0YC 3MNND 4EO5B 1HTAA 2NQBA 5AV6D 2JCHA 2HUEB 3MGSD 4XZQB 5BNVB 3AYWA 4H9OB 3UTBB 5AV5D 3X1TC 3W99B 3O62A 5GT3B 3W98D 2RVQD 1M1AC 5DNNB 2DQNC 3LZ1B 1P3LD 5F99D 5B32A 4WNNB 5GSUB 5AY8C 3MGQB 5AV8D 2DF4C 3WTPC 3X1SC 3V9RA 5AV9C 3AZMB 3LZ0D 3MGSA 1U35D 3RELD 1M19C 1KX3D 1TZYB 4NE6A 1WWSA 2G5IC 4H9NB 5B40D 3B6GB 3AZKC 1JFIB 3LELB 3MGPB 3KXBA 1EQZA 2HIOC 1W2EA 1P3BB 1P3LA 5F99A 3AZFC 2PYOD 3P5JB 5AV8A 2F8NB 3AZGD 1ID3C 1P3OC 5BNXB 5C3IC 5GXQD 4QLCD 1U35A 3RELA 4WU8C 3AZED 1H3OA 1WWIA 2G5HC 4WU9D 5FUGB 5CPIA 1P3FC 4KUDA 4LD9A 5B2JD 5JRGD 5B33D 2VQRA 3KWQA 3MGRC 5CPKB 1KX5A 5B24B 3AZGA 4HGAC 4NFTA 3MNNB 1KU5A 3R45A 5GXQA 4J8XB 3W96D 5AV6B 3AZEA 3MGSB 3AYWC 1ZLAA 5AV5B 3O62C 4G91C 3REKC 4XUJD 4J8UD 3W98B 5JA4B 5B2JA 3AZNA 5B32C 5B33A 5F99B 2Y2HA 5AVBA 3REIC 1M18C 2F8NH 3WAAA 3X1VA 3B0DB 3AN2D 2Y2NA 5B1LD 3LZ0B 5BS7A 1U35B 3A1IA 3RELB 1KX3B 4X23D 5B40B 3REHC 3B6FD 1N1JB 3MVDC 5KDMB 3W97D 4R8PA 3KXBC 4J8WD 4J8UA 1EQZC 1P3MD 1P3LC 2ZM5A 3AL0C 5GSUD 2PYOB 3AFAD 3KSYA 5AV8C 4J8VB 2F8NG 3AZGB 1F1EA 2YFVB 3A1KA 3R45B 5GXQB 5B31D 5AVCD 3C1CD 4QLCB 3AZMD 4XZQA 5BNVA 1TZYD 2L5AA 2ZY2A 3VH5A 3EPJA 3UTBA 4YS3B 1KX4D 4KGCB 5CHLB 4WU9B 3LELD 3W99A 5CPIC 5GT3A 4DQYB 3WA9D 5DNNA 4KUDC 3AV1D 4LD9C 4WNNA 2NZDB 5GSUA 5JRGB 3UT9D 3KWQC 3AFAA 3MGQA 1KX5C 1HQ3B 3EPKA 3AZLC 4AWLC 3EG5B 2FJ7B 4ZBJC 3C1CA 3AZMA 3W96B 1P3PC 3AZEC 1TZYA 4H9NA 3B6GA 1ZLAC 4KHAB 1JFIA 3LELA 5BT1D 5B2ID 5G49B 4XUJB 3AV1A 1P3BA 2Y2PA 4DRAA 5B2JC 3AZNC 1BFMA 3KUYC 5AVBC 5CPKD 2F8NA 3AZHD 1P3KB 3WAAC 2AROC 5BNXA 3X1VC 3TU4B 3WKJC 4CSRA 4J8XD 4DRBA 2XD1A 3AN2B 5B1LB 5BS7C 3A6NC 2W8SA 3C1BD 1S32C 2Y2GA 4X23B 2BG1A 1P3GD 3B6FB 2Y2LA 5FUGA 2IO5B 3W97B 4R8PC 4J8WB 3REJC 3B0BA 1P3MB 1PZRA 2ZY3A 5CPKA 2FFFB 5B24A 3AFAB 1M1AB 3AZHA 3MNNA 4EO5C 4J8XA 1F66D 4Z2MG 5AVCB 2HUEC 5B31B 5AV6A 3C1CB 4XZQC 1P34D 1P3IC 3UTBC 1KX4B 5AV5A 5CP6C 3W99C 3H0MC 5GT3C 5CPJD 3W98A 3WA9B 5JA4A 5DNNC 3LZ1C 3LJAD 3AZKB 4JJND 3FDDA 3AV1B 1P3AD 3UT9B 3MGQC 3NQUB 4J8VD 3AV2C 2F8NK 3AZMC 4CSRB 3LZ0A 3AZIB 1TZYC 1KX3A 3B6GC 5C3IB 5B40A 4YS3D 4KGCD 1N1JA 5GT0D 5KDMA 4WU8B 3MGPC 4G92B 5CPJA 5B2IB 1P3BC 3UTAD 1T3UA 5DNMD 2NZDD 2PYOA 2UWXA 4WV4B 5B0ZC 4J8VA 1HQ3D 3AZHB 2FJ7D 2YFWB 2YFVA 4QLCA 3X1UD 2NQBC 4HGAB 2BYMB 4YS3A 2Y2MA 3C1BB 4KGCA 1BH9B 4WU9A 1P3GB 4M6BA 4NE5A 3UTAA 5DNMA 2NZDA 5JRGA 4YM6D 3REKB 5CPKC 5B24C 4Z5TD 1HQ3A 5B1MD 1P3KD 4ZUXD 3MNNC 3NQJB 3TU4D 1AOID 2FJ7A 1F66B 3W96A 5AV6C 3MGSC 5B31G 5B0YD 1P34B 4KHAA 5AV5C 2LY8A 3WTPE 5G49A 5CPJB 3W98C 4XUJA 2CWEA 2ZY4A 2RVQC 4WZSB 3REHB 3X1TD 3LJAB 5F99C 4JJNB 2Y2KA 1P3AB 1M1AD 1P3KA 3TU4A 2Y2OA 3AZJB 3B0DC 4H9PA 5AY8D 3AN2A 3LZ0C 5B1LA 5B0YA 1U35C 3RELC 1KX3C 5E5AB 3X1SD 3WTPD 4X23A 5B40C 3B6FA 5GT0B 5AV9D 3W97A 4UPKA 1M19D 4H9RB 4J8WA 1P3MA 1A7WA 3UTAB 3AZKD 5DNMB 2HIOD 2PYOC 1M1AA 4J8VC 3AZGC 3AZFD 5GXQC 5AVCA 5B31A 4QLCC 3X1UB 3AZID 2CV5B 3AZLB 2Y2JA 4YS3C 3X1SA 3WTPA 1P3OD 1KX4A 3B0CW 4WU9C 4WU8D 1ULYA 3WA9A 4Z66B 3AZKA 2NZDC 5JRGC 4YM6B 5B33C 3UT9A 1P3FD 3NQUA 4Z5TB 5B1MB 4ZUXB 3AZFA 3VH6W 3MGRD 1AOIB 3KUYB 4Z2MH 3W96C 4H9PB 3AZIA 5B0YB 2AROB 1Q9CA 4WU8A 4CAYB 5B2IA 3AYWD 4XUJC 4J8UC 3X1TB 3O62D 3REKD 3REJB 1P3KC 3TU4C 5B32D 2YFWA 3MGRA 3AN2C 5AY8B 3REID 2BYKB 1M18D 5B1LC 2BYMA 3C1BA 4WJ3C 4X23C 1BH9A 3WTPB 3X1SB 3B6FC 1P3GA 5AV9B 2IO5C 3W97C 1M19B 4J8WC 1P3IB 3REHD 1P3MC 5CP6B 3MVDD 1BH8B 3REKA 5GSUC 3KXBD 1EQZD 2HIOB 3AFAC 3NQJA 3AZFB 3AZJD 1F66A 3REIA 5AVCC 5B31C 3C1CC 1M18A 3AV2B 3H0LC 1P34A 3IP4C 5E5AD 1ID3B 1P3OB 1KX4C 4H9QB 3LELC 4UUZB 3REHA 3WA9C 3AV1C 3MVDA 3LJAA 4JJNA 4E44A 5CPID 1P3AA 3UT9C 1P3FB 4KUDD 4LD9D 3EPLA 3AZJA 3KWQD 3MGRB 1KX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z B;  3AZI C;  1TAF B;  2CV5 D;  3AZL D;  5E5A A;  4H9S A;  5GT0 A;  2NQB B;  5BT1 C;  1P3P D;  4G92 C;  5B2I C;  5BO0 A;  4H9R A;  1ZLA D;  4Z66 D;  3AYW B;  3O62 B;  4G91 B;  3AZH C;  3AZN D;  5B32 B;  3KUY D;  5AVB D;  4J8X C;  3X1U A;  3REI B;  2CV5 A;  3AZL A;  1M18 B;  3WAA D;  3C1B C;  2ARO D;  3WKJ D;  3X1V D;  1P3G C;  3V9R B;  1P3P A;  3A6N D;  4NE3 A;  1R4V A;  4Z66 A;  1S32 D;  4YM6 A;  3MVD B;  4R8P D;  2JSS A;  3KXB B;  3REJ D;  1EQZ B;  4Z5T A;  5B1M A;  4ZUX A;  1P3L B;  1AOI A;  4E45 A;  3KUY A;  1F66 C;  5AV8 B;  2ARO A;  3WKJ A;  1P34 C;  4CAY A;  3A6N A;  4XZQ D;  5CPJ C;  5BO0 B;  1S32 A;  3UTB D;  1P3I D;  5CP6 D;  1H3O B;  3LJA C;  4JJN C;  3X1T A;  3W99 D;  5GT3 D;  5CPI B;  1P3A C;  3REJ A;  5DNN D;  4KUD B;  3LZ1 D;  4LD9 B;  3AZJ C;  5AY8 A;  3KWQ B;  3MGQ D;  2BYK A;  1KX5 B;  3B0C T;  3AV2 D;  5E5A C;  4AWL B;  1ID3 D;  4KGC C;  4H9S C;  4ZBJ B;  5GT0 C;  5AV9 A;  1P3P B;  3VH6 A;  3AZE B;  1M19 A;  1P3I A;  4H9O A;  3B6G D;  1ZLA B;  5CP6 A;  3UTA C;  1BH8 A;  5DNM C;  3MGP D;  2HIO A;  3VH6 T;  3LZ1 A;  3VH5 T;  1P3B D;  1HQ3 C;  1B67 A;  5B2J B;  3AZN B;  2FJ7 C;  5B33 B;  5B32 G;  3VH5 W;  5AVB B;  2F8N D;  5B0Z D;  3X1U C;  2CV5 C;  3AV2 A;  3WAA B;  1ID3 A;  1P3O A;  3WKJ B;  3X1V B;  4H9Q A;  2NQB D;  4UUZ A;  3A6N B;  4Z66 C;  1S32 B;  3MGP A;  4YM6 C;  1B6W A;  1P3F A;  4R8P B;  4J8U B;  4Z5T C;  5B1M C;  4ZUX C;  1AOI C;  5B24 D;  5B0Z A;  1TAF A;  5B0Y C;  3MNN D;  4EO5 B;  1HTA A;  2NQB A;  5AV6 D;  2HUE B;  3MGS D;  4XZQ B;  5BNV B;  3AYW A;  4H9O B;  3UTB B;  5AV5 D;  3X1T C;  3W99 B;  3O62 A;  5GT3 B;  3W98 D;  2RVQ D;  1M1A C;  5DNN B;  3LZ1 B;  1P3L D;  5F99 D;  5B32 A;  4WNN B;  5GSU B;  5AY8 C;  3MGQ B;  5AV8 D;  3WTP C;  3X1S C;  3V9R A;  5AV9 C;  3AZM B;  3LZ0 D;  3MGS A;  1U35 D;  3REL D;  1M19 C;  1KX3 D;  1TZY B;  4NE6 A;  1WWS A;  4H9N B;  5B40 D;  3B6G B;  3AZK C;  1JFI B;  3LEL B;  3MGP B;  3KXB A;  1EQZ A;  2HIO C;  1P3B B;  1P3L A;  5F99 A;  3AZF C;  2PYO D;  5AV8 A;  2F8N B;  3AZG D;  1ID3 C;  1P3O C;  5BNX B;  5C3I C;  5GXQ D;  4QLC D;  1U35 A;  3REL A;  4WU8 C;  3AZE D;  1H3O A;  1WWI A;  4WU9 D;  5FUG B;  5CPI A;  1P3F C;  4KUD A;  4LD9 A;  5B2J D;  5JRG D;  5B33 D;  3KWQ A;  3MGR C;  5CPK B;  1KX5 A;  5B24 B;  3AZG A;  4HGA C;  4NFT A;  3MNN B;  1KU5 A;  3R45 A;  5GXQ A;  4J8X B;  3W96 D;  5AV6 B;  3AZE A;  3MGS B;  3AYW C;  1ZLA A;  5AV5 B;  3O62 C;  4G91 C;  3REK C;  4XUJ D;  4J8U D;  3W98 B;  5JA4 B;  5B2J A;  3AZN A;  5B32 C;  5B33 A;  5F99 B;  5AVB A;  3REI C;  1M18 C;  2F8N H;  3WAA A;  3X1V A;  3B0D B;  3AN2 D;  5B1L D;  3LZ0 B;  5BS7 A;  1U35 B;  3REL B;  1KX3 B;  4X23 D;  5B40 B;  3REH C;  3B6F D;  1N1J B;  3MVD C;  5KDM B;  3W97 D;  4R8P A;  3KXB C;  4J8W D;  4J8U A;  1EQZ C;  1P3M D;  1P3L C;  5GSU D;  2PYO B;  3AFA D;  3KSY A;  5AV8 C;  4J8V B;  2F8N G;  3AZG B;  1F1E A;  2YFV B;  5AVC D;  3R45 B;  5GXQ B;  5B31 D;  3C1C D;  3AZM D;  4QLC B;  4XZQ A;  5BNV A;  1TZY D;  2L5A A;  3VH5 A;  3UTB A;  4YS3 B;  1KX4 D;  4KGC B;  5CHL B;  4WU9 B;  3LEL D;  3W99 A;  5CPI C;  5GT3 A;  3WA9 D;  5DNN A;  4KUD C;  3AV1 D;  4LD9 C;  4WNN A;  2NZD B;  5GSU A;  5JRG B;  3UT9 D;  3KWQ C;  3AFA A;  3MGQ A;  1KX5 C;  1HQ3 B;  3AZL C;  4AWL C;  2FJ7 B;  4ZBJ C;  3C1C A;  3AZM A;  3W96 B;  1P3P C;  3AZE C;  1TZY A;  4H9N A;  3B6G A;  1ZLA C;  4KHA B;  1JFI A;  3LEL A;  5BT1 D;  5B2I D;  5G49 B;  4XUJ B;  3AV1 A;  1P3B A;  4DRA A;  5B2J C;  3AZN C;  1BFM A;  3KUY C;  5AVB C;  5CPK D;  2F8N A;  3AZH D;  1P3K B;  3WAA C;  2ARO C;  5BNX A;  3X1V C;  3TU4 B;  3WKJ C;  4CSR A;  4J8X D;  4DRB A;  3AN2 B;  5B1L B;  5BS7 C;  3A6N C;  3C1B D;  1S32 C;  4X23 B;  1P3G D;  3B6F B;  5FUG A;  2IO5 B;  3W97 B;  4R8P C;  4J8W B;  3REJ C;  3B0B A;  1P3M B;  5CPK A;  5B24 A;  3AFA B;  1M1A B;  3AZH A;  3MNN A;  4EO5 C;  4J8X A;  1F66 D;  4Z2M G;  5AVC B;  2HUE C;  5B31 B;  5AV6 A;  3C1C B;  4XZQ C;  1P34 D;  1P3I C;  3UTB C;  1KX4 B;  5AV5 A;  5CP6 C;  3W99 C;  5GT3 C;  5CPJ D;  3W98 A;  3WA9 B;  5JA4 A;  5DNN C;  3LZ1 C;  3LJA D;  3AZK B;  4JJN D;  3AV1 B;  1P3A D;  3UT9 B;  3MGQ C;  3NQU B;  4J8V D;  3AV2 C;  2F8N K;  3AZM C;  4CSR B;  3LZ0 A;  3AZI B;  1TZY C;  1KX3 A;  3B6G C;  5C3I B;  5B40 A;  4YS3 D;  4KGC D;  1N1J A;  5GT0 D;  5KDM A;  4WU8 B;  3MGP C;  4G92 B;  5CPJ A;  5B2I B;  1P3B C;  3UTA D;  5DNM D;  2NZD D;  2PYO A;  4WV4 B;  5B0Z C;  4J8V A;  1HQ3 D;  3AZH B;  2FJ7 D;  2YFV A;  2YFW B;  4QLC A;  3X1U D;  2NQB C;  4HGA B;  2BYM B;  4YS3 A;  4KGC A;  3C1B B;  1BH9 B;  4WU9 A;  1P3G B;  4M6B A;  4NE5 A;  3UTA A;  5DNM A;  2NZD A;  5JRG A;  4YM6 D;  3REK B;  5CPK C;  5B24 C;  4Z5T D;  1HQ3 A;  5B1M D;  1P3K D;  4ZUX D;  3MNN C;  3NQJ B;  3TU4 D;  1AOI D;  2FJ7 A;  1F66 B;  3W96 A;  5AV6 C;  3MGS C;  5B31 G;  5B0Y D;  1P34 B;  4KHA A;  5AV5 C;  2LY8 A;  3WTP E;  5G49 A;  5CPJ B;  3W98 C;  4XUJ A;  2CWE A;  3REH B;  2RVQ C;  4WZS B;  3X1T D;  3LJA B;  5F99 C;  4JJN B;  1P3A B;  1M1A D;  1P3K A;  3TU4 A;  3AZJ B;  3B0D C;  4H9P A;  5AY8 D;  3AN2 A;  3LZ0 C;  5B1L A;  5B0Y A;  1U35 C;  3REL C;  1KX3 C;  5E5A B;  3X1S D;  3WTP D;  4X23 A;  5B40 C;  3B6F A;  5GT0 B;  5AV9 D;  3W97 A;  1M19 D;  4H9R B;  4J8W A;  1P3M A;  1A7W A;  3UTA B;  3AZK D;  5DNM B;  2HIO D;  2PYO C;  1M1A A;  4J8V C;  3AZG C;  3AZF D;  5GXQ C;  5AVC A;  5B31 A;  4QLC C;  3X1U B;  3AZI D;  2CV5 B;  3AZL B;  4YS3 C;  3X1S A;  3WTP A;  1P3O D;  1KX4 A;  3B0C W;  4WU9 C;  4WU8 D;  1ULY A;  3WA9 A;  4Z66 B;  3AZK A;  2NZD C;  5JRG C;  4YM6 B;  5B33 C;  3UT9 A;  1P3F D;  3NQU A;  4Z5T B;  5B1M B;  4ZUX B;  3AZF A;  3VH6 W;  3MGR D;  1AOI B;  3KUY B;  4Z2M H;  3W96 C;  4H9P B;  3AZI A;  5B0Y B;  2ARO B;  1Q9C A;  4WU8 A;  4CAY B;  5B2I A;  3AYW D;  4XUJ C;  4J8U C;  3X1T B;  3O62 D;  3REK D;  3REJ B;  1P3K C;  3TU4 C;  5B32 D;  2YFW A;  3MGR A;  3AN2 C;  5AY8 B;  3REI D;  2BYK B;  1M18 D;  5B1L C;  2BYM A;  3C1B A;  4X23 C;  1BH9 A;  3WTP B;  3X1S B;  3B6F C;  1P3G A;  5AV9 B;  2IO5 C;  3W97 C;  1M19 B;  4J8W C;  1P3I B;  3REH D;  1P3M C;  5CP6 B;  3MVD D;  1BH8 B;  3REK A;  5GSU C;  3KXB D;  1EQZ D;  2HIO B;  3AFA C;  3NQJ A;  3AZF B;  3AZJ D;  1F66 A;  3REI A;  5AVC C;  5B31 C;  3C1C C;  1M18 A;  3AV2 B;  1P34 A;  5E5A D;  1ID3 B;  1P3O B;  1KX4 C;  4H9Q B;  3LEL C;  4UUZ B;  3REH A;  3WA9 C;  3AV1 C;  3MVD A;  3LJA A;  4JJN A;  4E44 A;  5CPI D;  1P3A A;  3UT9 C;  1P3F B;  4KUD D;  4LD9 D;  3AZJ A;  3KWQ D;  3MGR B;  1KX5 D; 
#chains in the Genus database with same CATH topology
 5B0Z B;  3AZI C;  1TAF B;  2CV5 D;  3AZL D;  5E5A A;  4H9S A;  5GT0 A;  2NQB B;  5BT1 C;  1P3P D;  4G92 C;  5B2I C;  5BO0 A;  4H9R A;  1ZLA D;  4Z66 D;  3AYW B;  3O62 B;  4G91 B;  3AZH C;  3AZN D;  5B32 B;  2ZY5 A;  3KUY D;  5AVB D;  4J8X C;  3X1U A;  3REI B;  2CV5 A;  3AZL A;  1M18 B;  3WAA D;  3C1B C;  2ARO D;  3WKJ D;  3X1V D;  2XD5 A;  1P3G C;  3V9R B;  1P3P A;  3F6T A;  1Z2C B;  3A6N D;  4NE3 A;  1R4V A;  4Z66 A;  1S32 D;  2JE5 A;  4YM6 A;  3MVD B;  2J8P A;  4R8P D;  2JSS A;  3KXB B;  3REJ D;  1EQZ B;  4Z5T A;  5B1M A;  4ZUX A;  1P3L B;  1AOI A;  4E45 A;  3KUY A;  1F66 C;  5AV8 B;  2ARO A;  3WKJ A;  1P34 C;  2Y2Q A;  4CAY A;  3A6N A;  4XZQ D;  5CPJ C;  5BO0 B;  1S32 A;  2F2A C;  3UTB D;  1P3I D;  5CP6 D;  1H3O B;  3LJA C;  4JJN C;  3X1T A;  3W99 D;  5GT3 D;  5CPI B;  1P3A C;  3REJ A;  5DNN D;  4KUD B;  3LZ1 D;  4LD9 B;  3AZJ C;  5AY8 A;  3KWQ B;  3MGQ D;  2BYK A;  1KX5 B;  3B0C T;  3AV2 D;  3H0R C;  5E5A C;  4AWL B;  1ID3 D;  4KGC C;  4H9S C;  4ZBJ B;  5GT0 C;  5AV9 A;  3EPH A;  1P3P B;  3VH6 A;  3AZE B;  1M19 A;  1P3I A;  4H9O A;  3B6G D;  1ZLA B;  5CP6 A;  3UTA C;  1BH8 A;  5DNM C;  3MGP D;  2HIO A;  3VH6 T;  3LZ1 A;  3VH5 T;  1P3B D;  1HQ3 C;  1B67 A;  5B2J B;  3AZN B;  2FJ7 C;  5B33 B;  5B32 G;  3VH5 W;  5AVB B;  2F8N D;  5B0Z D;  3X1U C;  2CV5 C;  3AV2 A;  3WAA B;  1ID3 A;  1P3O A;  3WKJ B;  3X1V B;  4H9Q A;  2Y2I A;  2NQB D;  4UUZ A;  3A6N B;  4Z66 C;  3KFU G;  1S32 B;  3MGP A;  4YM6 C;  1B6W A;  1P3F A;  4R8P B;  4J8U B;  4Z5T C;  5B1M C;  4ZUX C;  1AOI C;  5B24 D;  5B0Z A;  2RIQ A;  1TAF A;  5B0Y C;  3MNN D;  4EO5 B;  1HTA A;  2NQB A;  5AV6 D;  2JCH A;  2HUE B;  3MGS D;  4XZQ B;  5BNV B;  3AYW A;  4H9O B;  3UTB B;  5AV5 D;  3X1T C;  3W99 B;  3O62 A;  5GT3 B;  3W98 D;  2RVQ D;  1M1A C;  5DNN B;  2DQN C;  3LZ1 B;  1P3L D;  5F99 D;  5B32 A;  4WNN B;  5GSU B;  5AY8 C;  3MGQ B;  5AV8 D;  2DF4 C;  3WTP C;  3X1S C;  3V9R A;  5AV9 C;  3AZM B;  3LZ0 D;  3MGS A;  1U35 D;  3REL D;  1M19 C;  1KX3 D;  1TZY B;  4NE6 A;  1WWS A;  2G5I C;  4H9N B;  5B40 D;  3B6G B;  3AZK C;  1JFI B;  3LEL B;  3MGP B;  3KXB A;  1EQZ A;  2HIO C;  1W2E A;  1P3B B;  1P3L A;  5F99 A;  3AZF C;  2PYO D;  3P5J B;  5AV8 A;  2F8N B;  3AZG D;  1ID3 C;  1P3O C;  5BNX B;  5C3I C;  5GXQ D;  4QLC D;  1U35 A;  3REL A;  4WU8 C;  3AZE D;  1H3O A;  1WWI A;  2G5H C;  4WU9 D;  5FUG B;  5CPI A;  1P3F C;  4KUD A;  4LD9 A;  5B2J D;  5JRG D;  5B33 D;  2VQR A;  3KWQ A;  3MGR C;  5CPK B;  1KX5 A;  5B24 B;  3AZG A;  4HGA C;  4NFT A;  3MNN B;  1KU5 A;  3R45 A;  5GXQ A;  4J8X B;  3W96 D;  5AV6 B;  3AZE A;  3MGS B;  3AYW C;  1ZLA A;  5AV5 B;  3O62 C;  4G91 C;  3REK C;  4XUJ D;  4J8U D;  3W98 B;  5JA4 B;  5B2J A;  3AZN A;  5B32 C;  5B33 A;  5F99 B;  2Y2H A;  5AVB A;  3REI C;  1M18 C;  2F8N H;  3WAA A;  3X1V A;  3B0D B;  3AN2 D;  2Y2N A;  5B1L D;  3LZ0 B;  5BS7 A;  1U35 B;  3A1I A;  3REL B;  1KX3 B;  4X23 D;  5B40 B;  3REH C;  3B6F D;  1N1J B;  3MVD C;  5KDM B;  3W97 D;  4R8P A;  3KXB C;  4J8W D;  4J8U A;  1EQZ C;  1P3M D;  1P3L C;  2ZM5 A;  3AL0 C;  5GSU D;  2PYO B;  3AFA D;  3KSY A;  5AV8 C;  4J8V B;  2F8N G;  3AZG B;  1F1E A;  2YFV B;  3A1K A;  3R45 B;  5GXQ B;  5B31 D;  5AVC D;  3C1C D;  4QLC B;  3AZM D;  4XZQ A;  5BNV A;  1TZY D;  2L5A A;  2ZY2 A;  3VH5 A;  3EPJ A;  3UTB A;  4YS3 B;  1KX4 D;  4KGC B;  5CHL B;  4WU9 B;  3LEL D;  3W99 A;  5CPI C;  5GT3 A;  4DQY B;  3WA9 D;  5DNN A;  4KUD C;  3AV1 D;  4LD9 C;  4WNN A;  2NZD B;  5GSU A;  5JRG B;  3UT9 D;  3KWQ C;  3AFA A;  3MGQ A;  1KX5 C;  1HQ3 B;  3EPK A;  3AZL C;  4AWL C;  3EG5 B;  2FJ7 B;  4ZBJ C;  3C1C A;  3AZM A;  3W96 B;  1P3P C;  3AZE C;  1TZY A;  4H9N A;  3B6G A;  1ZLA C;  4KHA B;  1JFI A;  3LEL A;  5BT1 D;  5B2I D;  5G49 B;  4XUJ B;  3AV1 A;  1P3B A;  2Y2P A;  4DRA A;  5B2J C;  3AZN C;  1BFM A;  3KUY C;  5AVB C;  5CPK D;  2F8N A;  3AZH D;  1P3K B;  3WAA C;  2ARO C;  5BNX A;  3X1V C;  3TU4 B;  3WKJ C;  4CSR A;  4J8X D;  4DRB A;  2XD1 A;  3AN2 B;  5B1L B;  5BS7 C;  3A6N C;  2W8S A;  3C1B D;  1S32 C;  2Y2G A;  4X23 B;  2BG1 A;  1P3G D;  3B6F B;  2Y2L A;  5FUG A;  2IO5 B;  3W97 B;  4R8P C;  4J8W B;  3REJ C;  3B0B A;  1P3M B;  1PZR A;  2ZY3 A;  5CPK A;  2FFF B;  5B24 A;  3AFA B;  1M1A B;  3AZH A;  3MNN A;  4EO5 C;  4J8X A;  1F66 D;  4Z2M G;  5AVC B;  2HUE C;  5B31 B;  5AV6 A;  3C1C B;  4XZQ C;  1P34 D;  1P3I C;  3UTB C;  1KX4 B;  5AV5 A;  5CP6 C;  3W99 C;  3H0M C;  5GT3 C;  5CPJ D;  3W98 A;  3WA9 B;  5JA4 A;  5DNN C;  3LZ1 C;  3LJA D;  3AZK B;  4JJN D;  3FDD A;  3AV1 B;  1P3A D;  3UT9 B;  3MGQ C;  3NQU B;  4J8V D;  3AV2 C;  2F8N K;  3AZM C;  4CSR B;  3LZ0 A;  3AZI B;  1TZY C;  1KX3 A;  3B6G C;  5C3I B;  5B40 A;  4YS3 D;  4KGC D;  1N1J A;  5GT0 D;  5KDM A;  4WU8 B;  3MGP C;  4G92 B;  5CPJ A;  5B2I B;  1P3B C;  3UTA D;  1T3U A;  5DNM D;  2NZD D;  2PYO A;  2UWX A;  4WV4 B;  5B0Z C;  4J8V A;  1HQ3 D;  3AZH B;  2FJ7 D;  2YFW B;  2YFV A;  4QLC A;  3X1U D;  2NQB C;  4HGA B;  2BYM B;  4YS3 A;  2Y2M A;  3C1B B;  4KGC A;  1BH9 B;  4WU9 A;  1P3G B;  4M6B A;  4NE5 A;  3UTA A;  5DNM A;  2NZD A;  5JRG A;  4YM6 D;  3REK B;  5CPK C;  5B24 C;  4Z5T D;  1HQ3 A;  5B1M D;  1P3K D;  4ZUX D;  3MNN C;  3NQJ B;  3TU4 D;  1AOI D;  2FJ7 A;  1F66 B;  3W96 A;  5AV6 C;  3MGS C;  5B31 G;  5B0Y D;  1P34 B;  4KHA A;  5AV5 C;  2LY8 A;  3WTP E;  5G49 A;  5CPJ B;  3W98 C;  4XUJ A;  2CWE A;  2ZY4 A;  2RVQ C;  4WZS B;  3REH B;  3X1T D;  3LJA B;  5F99 C;  4JJN B;  2Y2K A;  1P3A B;  1M1A D;  1P3K A;  3TU4 A;  2Y2O A;  3AZJ B;  3B0D C;  4H9P A;  5AY8 D;  3AN2 A;  3LZ0 C;  5B1L A;  5B0Y A;  1U35 C;  3REL C;  1KX3 C;  5E5A B;  3X1S D;  3WTP D;  4X23 A;  5B40 C;  3B6F A;  5GT0 B;  5AV9 D;  3W97 A;  4UPK A;  1M19 D;  4H9R B;  4J8W A;  1P3M A;  1A7W A;  3UTA B;  3AZK D;  5DNM B;  2HIO D;  2PYO C;  1M1A A;  4J8V C;  3AZG C;  3AZF D;  5GXQ C;  5AVC A;  5B31 A;  4QLC C;  3X1U B;  3AZI D;  2CV5 B;  3AZL B;  2Y2J A;  4YS3 C;  3X1S A;  3WTP A;  1P3O D;  1KX4 A;  3B0C W;  4WU9 C;  4WU8 D;  1ULY A;  3WA9 A;  4Z66 B;  3AZK A;  2NZD C;  5JRG C;  4YM6 B;  5B33 C;  3UT9 A;  1P3F D;  3NQU A;  4Z5T B;  5B1M B;  4ZUX B;  3AZF A;  3VH6 W;  3MGR D;  1AOI B;  3KUY B;  4Z2M H;  3W96 C;  4H9P B;  3AZI A;  5B0Y B;  2ARO B;  1Q9C A;  4WU8 A;  4CAY B;  5B2I A;  3AYW D;  4XUJ C;  4J8U C;  3X1T B;  3O62 D;  3REK D;  3REJ B;  1P3K C;  3TU4 C;  5B32 D;  2YFW A;  3MGR A;  3AN2 C;  5AY8 B;  3REI D;  2BYK B;  1M18 D;  5B1L C;  2BYM A;  3C1B A;  4WJ3 C;  4X23 C;  1BH9 A;  3WTP B;  3X1S B;  3B6F C;  1P3G A;  5AV9 B;  2IO5 C;  3W97 C;  1M19 B;  4J8W C;  1P3I B;  3REH D;  1P3M C;  5CP6 B;  3MVD D;  1BH8 B;  3REK A;  5GSU C;  3KXB D;  1EQZ D;  2HIO B;  3AFA C;  3NQJ A;  3AZF B;  3AZJ D;  1F66 A;  3REI A;  5AVC C;  5B31 C;  3C1C C;  1M18 A;  3AV2 B;  3H0L C;  1P34 A;  3IP4 C;  5E5A D;  1ID3 B;  1P3O B;  1KX4 C;  4H9Q B;  3LEL C;  4UUZ B;  3REH A;  3WA9 C;  3AV1 C;  3MVD A;  3LJA A;  4JJN A;  4E44 A;  5CPI D;  1P3A A;  3UT9 C;  1P3F B;  4KUD D;  4LD9 D;  3EPL A;  3AZJ A;  3KWQ D;  3MGR B;  1KX5 D; 
#chains in the Genus database with same CATH homology
 5B0Z B;  3AZI C;  1TAF B;  2CV5 D;  3AZL D;  5E5A A;  4H9S A;  5GT0 A;  2NQB B;  5BT1 C;  1P3P D;  4G92 C;  5B2I C;  5BO0 A;  4H9R A;  1ZLA D;  4Z66 D;  3AYW B;  3O62 B;  4G91 B;  3AZH C;  3AZN D;  5B32 B;  2ZY5 A;  3KUY D;  5AVB D;  4J8X C;  3X1U A;  3REI B;  2CV5 A;  3AZL A;  1M18 B;  3WAA D;  3C1B C;  2ARO D;  3WKJ D;  3X1V D;  2XD5 A;  1P3G C;  3V9R B;  1P3P A;  3F6T A;  1Z2C B;  3A6N D;  4NE3 A;  1R4V A;  4Z66 A;  1S32 D;  2JE5 A;  4YM6 A;  3MVD B;  2J8P A;  4R8P D;  2JSS A;  3KXB B;  3REJ D;  1EQZ B;  4Z5T A;  5B1M A;  4ZUX A;  1P3L B;  1AOI A;  4E45 A;  3KUY A;  1F66 C;  5AV8 B;  2ARO A;  3WKJ A;  1P34 C;  2Y2Q A;  4CAY A;  3A6N A;  4XZQ D;  5CPJ C;  5BO0 B;  1S32 A;  2F2A C;  3UTB D;  1P3I D;  5CP6 D;  1H3O B;  3LJA C;  4JJN C;  3X1T A;  3W99 D;  5GT3 D;  5CPI B;  1P3A C;  3REJ A;  5DNN D;  4KUD B;  3LZ1 D;  4LD9 B;  3AZJ C;  5AY8 A;  3KWQ B;  3MGQ D;  2BYK A;  1KX5 B;  3B0C T;  3AV2 D;  3H0R C;  5E5A C;  4AWL B;  1ID3 D;  4KGC C;  4H9S C;  4ZBJ B;  5GT0 C;  5AV9 A;  3EPH A;  1P3P B;  3VH6 A;  3AZE B;  1M19 A;  1P3I A;  4H9O A;  3B6G D;  1ZLA B;  5CP6 A;  3UTA C;  1BH8 A;  5DNM C;  3MGP D;  2HIO A;  3VH6 T;  3LZ1 A;  3VH5 T;  1P3B D;  1HQ3 C;  1B67 A;  5B2J B;  3AZN B;  2FJ7 C;  5B33 B;  5B32 G;  3VH5 W;  5AVB B;  2F8N D;  5B0Z D;  3X1U C;  2CV5 C;  3AV2 A;  3WAA B;  1ID3 A;  1P3O A;  3WKJ B;  3X1V B;  4H9Q A;  2Y2I A;  2NQB D;  4UUZ A;  3A6N B;  4Z66 C;  3KFU G;  1S32 B;  3MGP A;  4YM6 C;  1B6W A;  1P3F A;  4R8P B;  4J8U B;  4Z5T C;  5B1M C;  4ZUX C;  1AOI C;  5B24 D;  5B0Z A;  2RIQ A;  1TAF A;  5B0Y C;  3MNN D;  4EO5 B;  1HTA A;  2NQB A;  5AV6 D;  2JCH A;  2HUE B;  3MGS D;  4XZQ B;  5BNV B;  3AYW A;  4H9O B;  3UTB B;  5AV5 D;  3X1T C;  3W99 B;  3O62 A;  5GT3 B;  3W98 D;  2RVQ D;  1M1A C;  5DNN B;  2DQN C;  3LZ1 B;  1P3L D;  5F99 D;  5B32 A;  4WNN B;  5GSU B;  5AY8 C;  3MGQ B;  5AV8 D;  2DF4 C;  3WTP C;  3X1S C;  3V9R A;  5AV9 C;  3AZM B;  3LZ0 D;  3MGS A;  1U35 D;  3REL D;  1M19 C;  1KX3 D;  1TZY B;  4NE6 A;  1WWS A;  2G5I C;  4H9N B;  5B40 D;  3B6G B;  3AZK C;  1JFI B;  3LEL B;  3MGP B;  3KXB A;  1EQZ A;  2HIO C;  1W2E A;  1P3B B;  1P3L A;  5F99 A;  3AZF C;  2PYO D;  3P5J B;  5AV8 A;  2F8N B;  3AZG D;  1ID3 C;  1P3O C;  5BNX B;  5C3I C;  5GXQ D;  4QLC D;  1U35 A;  3REL A;  4WU8 C;  3AZE D;  1H3O A;  1WWI A;  2G5H C;  4WU9 D;  5FUG B;  5CPI A;  1P3F C;  4KUD A;  4LD9 A;  5B2J D;  5JRG D;  5B33 D;  2VQR A;  3KWQ A;  3MGR C;  5CPK B;  1KX5 A;  5B24 B;  3AZG A;  4HGA C;  4NFT A;  3MNN B;  1KU5 A;  3R45 A;  5GXQ A;  4J8X B;  3W96 D;  5AV6 B;  3AZE A;  3MGS B;  3AYW C;  1ZLA A;  5AV5 B;  3O62 C;  4G91 C;  3REK C;  4XUJ D;  4J8U D;  3W98 B;  5JA4 B;  5B2J A;  3AZN A;  5B32 C;  5B33 A;  5F99 B;  2Y2H A;  5AVB A;  3REI C;  1M18 C;  2F8N H;  3WAA A;  3X1V A;  3B0D B;  3AN2 D;  2Y2N A;  5B1L D;  3LZ0 B;  5BS7 A;  1U35 B;  3A1I A;  3REL B;  1KX3 B;  4X23 D;  5B40 B;  3REH C;  3B6F D;  1N1J B;  3MVD C;  5KDM B;  3W97 D;  4R8P A;  3KXB C;  4J8W D;  4J8U A;  1EQZ C;  1P3M D;  1P3L C;  2ZM5 A;  3AL0 C;  5GSU D;  2PYO B;  3AFA D;  3KSY A;  5AV8 C;  4J8V B;  2F8N G;  3AZG B;  1F1E A;  2YFV B;  3A1K A;  3R45 B;  5GXQ B;  5B31 D;  5AVC D;  3C1C D;  4QLC B;  3AZM D;  4XZQ A;  5BNV A;  1TZY D;  2L5A A;  2ZY2 A;  3VH5 A;  3EPJ A;  3UTB A;  4YS3 B;  1KX4 D;  4KGC B;  5CHL B;  4WU9 B;  3LEL D;  3W99 A;  5CPI C;  5GT3 A;  4DQY B;  3WA9 D;  5DNN A;  4KUD C;  3AV1 D;  4LD9 C;  4WNN A;  2NZD B;  5GSU A;  5JRG B;  3UT9 D;  3KWQ C;  3AFA A;  3MGQ A;  1KX5 C;  1HQ3 B;  3EPK A;  3AZL C;  4AWL C;  3EG5 B;  2FJ7 B;  4ZBJ C;  3C1C A;  3AZM A;  3W96 B;  1P3P C;  3AZE C;  1TZY A;  4H9N A;  3B6G A;  1ZLA C;  4KHA B;  1JFI A;  3LEL A;  5BT1 D;  5B2I D;  5G49 B;  4XUJ B;  3AV1 A;  1P3B A;  2Y2P A;  4DRA A;  5B2J C;  3AZN C;  1BFM A;  3KUY C;  5AVB C;  5CPK D;  2F8N A;  3AZH D;  1P3K B;  3WAA C;  2ARO C;  5BNX A;  3X1V C;  3TU4 B;  3WKJ C;  4CSR A;  4J8X D;  4DRB A;  2XD1 A;  3AN2 B;  5B1L B;  5BS7 C;  3A6N C;  2W8S A;  3C1B D;  1S32 C;  2Y2G A;  4X23 B;  2BG1 A;  1P3G D;  3B6F B;  2Y2L A;  5FUG A;  2IO5 B;  3W97 B;  4R8P C;  4J8W B;  3REJ C;  3B0B A;  1P3M B;  1PZR A;  2ZY3 A;  5CPK A;  2FFF B;  5B24 A;  3AFA B;  1M1A B;  3AZH A;  3MNN A;  4EO5 C;  4J8X A;  1F66 D;  4Z2M G;  5AVC B;  2HUE C;  5B31 B;  5AV6 A;  3C1C B;  4XZQ C;  1P34 D;  1P3I C;  3UTB C;  1KX4 B;  5AV5 A;  5CP6 C;  3W99 C;  3H0M C;  5GT3 C;  5CPJ D;  3W98 A;  3WA9 B;  5JA4 A;  5DNN C;  3LZ1 C;  3LJA D;  3AZK B;  4JJN D;  3FDD A;  3AV1 B;  1P3A D;  3UT9 B;  3MGQ C;  3NQU B;  4J8V D;  3AV2 C;  2F8N K;  3AZM C;  4CSR B;  3LZ0 A;  3AZI B;  1TZY C;  1KX3 A;  3B6G C;  5C3I B;  5B40 A;  4YS3 D;  4KGC D;  1N1J A;  5GT0 D;  5KDM A;  4WU8 B;  3MGP C;  4G92 B;  5CPJ A;  5B2I B;  1P3B C;  3UTA D;  1T3U A;  5DNM D;  2NZD D;  2PYO A;  2UWX A;  4WV4 B;  5B0Z C;  4J8V A;  1HQ3 D;  3AZH B;  2FJ7 D;  2YFW B;  2YFV A;  4QLC A;  3X1U D;  2NQB C;  4HGA B;  2BYM B;  4YS3 A;  2Y2M A;  3C1B B;  4KGC A;  1BH9 B;  4WU9 A;  1P3G B;  4M6B A;  4NE5 A;  3UTA A;  5DNM A;  2NZD A;  5JRG A;  4YM6 D;  3REK B;  5CPK C;  5B24 C;  4Z5T D;  1HQ3 A;  5B1M D;  1P3K D;  4ZUX D;  3MNN C;  3NQJ B;  3TU4 D;  1AOI D;  2FJ7 A;  1F66 B;  3W96 A;  5AV6 C;  3MGS C;  5B31 G;  5B0Y D;  1P34 B;  4KHA A;  5AV5 C;  2LY8 A;  3WTP E;  5G49 A;  5CPJ B;  3W98 C;  4XUJ A;  2CWE A;  2ZY4 A;  2RVQ C;  4WZS B;  3REH B;  3X1T D;  3LJA B;  5F99 C;  4JJN B;  2Y2K A;  1P3A B;  1M1A D;  1P3K A;  3TU4 A;  2Y2O A;  3AZJ B;  3B0D C;  4H9P A;  5AY8 D;  3AN2 A;  3LZ0 C;  5B1L A;  5B0Y A;  1U35 C;  3REL C;  1KX3 C;  5E5A B;  3X1S D;  3WTP D;  4X23 A;  5B40 C;  3B6F A;  5GT0 B;  5AV9 D;  3W97 A;  4UPK A;  1M19 D;  4H9R B;  4J8W A;  1P3M A;  1A7W A;  3UTA B;  3AZK D;  5DNM B;  2HIO D;  2PYO C;  1M1A A;  4J8V C;  3AZG C;  3AZF D;  5GXQ C;  5AVC A;  5B31 A;  4QLC C;  3X1U B;  3AZI D;  2CV5 B;  3AZL B;  2Y2J A;  4YS3 C;  3X1S A;  3WTP A;  1P3O D;  1KX4 A;  3B0C W;  4WU9 C;  4WU8 D;  1ULY A;  3WA9 A;  4Z66 B;  3AZK A;  2NZD C;  5JRG C;  4YM6 B;  5B33 C;  3UT9 A;  1P3F D;  3NQU A;  4Z5T B;  5B1M B;  4ZUX B;  3AZF A;  3VH6 W;  3MGR D;  1AOI B;  3KUY B;  4Z2M H;  3W96 C;  4H9P B;  3AZI A;  5B0Y B;  2ARO B;  1Q9C A;  4WU8 A;  4CAY B;  5B2I A;  3AYW D;  4XUJ C;  4J8U C;  3X1T B;  3O62 D;  3REK D;  3REJ B;  1P3K C;  3TU4 C;  5B32 D;  2YFW A;  3MGR A;  3AN2 C;  5AY8 B;  3REI D;  2BYK B;  1M18 D;  5B1L C;  2BYM A;  3C1B A;  4WJ3 C;  4X23 C;  1BH9 A;  3WTP B;  3X1S B;  3B6F C;  1P3G A;  5AV9 B;  2IO5 C;  3W97 C;  1M19 B;  4J8W C;  1P3I B;  3REH D;  1P3M C;  5CP6 B;  3MVD D;  1BH8 B;  3REK A;  5GSU C;  3KXB D;  1EQZ D;  2HIO B;  3AFA C;  3NQJ A;  3AZF B;  3AZJ D;  1F66 A;  3REI A;  5AVC C;  5B31 C;  3C1C C;  1M18 A;  3AV2 B;  3H0L C;  1P34 A;  3IP4 C;  5E5A D;  1ID3 B;  1P3O B;  1KX4 C;  4H9Q B;  3LEL C;  4UUZ B;  3REH A;  3WA9 C;  3AV1 C;  3MVD A;  3LJA A;  4JJN A;  4E44 A;  5CPI D;  1P3A A;  3UT9 C;  1P3F B;  4KUD D;  4LD9 D;  3EPL A;  3AZJ A;  3KWQ D;  3MGR B;  1KX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...