3REIA

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiA00
1U35A 3C1CA 4YM6A 3KUYC 1N1JA 3AFAA 2F8NK 5B33D 4YS3A 1KX3B 3KXBB 2L5AA 1P3LB 4JJNC 4H9PB 3B6GD 5G49A 3NQUB 3MGPB 3AZND 3WA9C 4X23A 5AV5B 4J8XB 3MNNB 1EQZB 3AV1B 2YFWB 3UT9B 1HQ3A 3REID 3C1BA 5DNMB 3REJD 3REHA 4J8VB 3B6FC 1P3IA 5KDMA 3B6GA 4KGCD 2LY8A 1ZLAD 3LELC 3AZJA 2NZDB 1BH9A 4H9SA 3X1SC 5B0YD 4H9RA 1TZYA 3R45A 5CPJA 5CPIC 3MVDB 4XZQC 2F8NA 5C3IB 4Z2MG 1HTAA 3AZIA 5JA4B 1P3FD 5AVBB 4J8UC 3W96B 5JRGB 3TU4D 3LZ0D 5BNXA 3KSYA 4CSRB 4CAYA 4EO5C 4QLCD 3VH6T 5CP6C 3O62D 3LZ1A 1P3OB 4R8PC 3AYWC 3AZMB 1P3FA 4ZUXD 5GSUD 5B40B 5GT0A 4NE5A 3AZFC 1P34C 3W97D 5B32C 4WU9B 2CV5B 1BFMA 5E5AA 4WZSB 5GSUA 5B2JC 5AV6C 3REKD 1ID3A 5FUGA 3KWQB 3UTAD 4LD9A 3X1VA 3WAAC 1P3KB 1P3LD 5CPKD 5B24B 3MGRD 2F8NG 3AZED 3MGPD 1WWIA 4AWLB 4LD9C 2HUEB 4XUJC 3X1UD 3KUYA 3MNND 1AOID 5GXQA 1EQZD 2IO5B 2PYOC 4JJNA 3WTPC 3WA9A 4X23B 5B33B 1HQ3B 2NQBC 5AV9D 3B6GB 3B6FA 3AZNB 1S32C 4XZQD 4WU8C 3LELA 1BH9B 3X1SA 3MGSC 3REIB 5BS7C 4J8UD 3X1TC 4NE3A 4J8WC 3REJB 5CPIA 3W99D 3VH6A 2F8NB 1P3GC 4XZQA 1ZLAB 1P3PD 5B1MC 3AZGC 5B0YB 3LJAC 4G91B 4UUZB 3AZFD 5BNXB 5B31D 5CP6A 1F66C 4Z5TD 5F99D 3LZ1B 3WTPE 4R8PA 4H9NB 5B1LD 3AYWA 1P3FB 3WKJD 5AV8D 5B2ID 3TU4B 3KWQD 1U35D 1P34A 5B32A 4HGAB 3O62B 5E5AB 1P3MC 3C1CD 4NE6A 4YM6D 4Z66C 4ZUXB 5GSUB 2RVQD 5AV6A 5B2JA 5CHLB 1KU5A 4YS3D 5FUGB 3AFAD 4LD9B 3WAAA 3W97B 4KHAA 1H3OB 5BO0A 3VH5T 1TAFA 4X23D 3MGQC 3KUYB 2HIOC 4XUJA 3AZHC 2BYMB 3REKB 2FJ7A 5GXQC 1P3AC 4G92C 1HQ3D 3UTAB 2PYOA 3C1BD 5B0ZC 3AZLC 4JJNB 5CPKB 1M18C 3REHD 1R4VA 3MGRB 1P3ID 3WTPA 3AZEB 3AZJD 5AVCC 3X1UB 3AN2C 2YFVA 1AOIB 4DRBA 2NQBA 3NQJA 1TZYD 4E44A 3A6NC 5BT1D 5B31G 5CPJD 1S32A 5GT3A 3B0CW 2F8ND 4WU8A 3V9RB 3X1SB 3RELC 3AZID 3MGSA 5BS7A 1KX5C 3X1TA 2BYKA 4J8WA 2AROC 1P3BC 5CPIB 5AV9B 3KXBC 3B0BA 1M1AC 4XZQB 4H9OA 1P3GA 3LZ1D 4WV4B 3AV2C 5B1MA 3AZGA 1KX4C 4J8XC 3LJAA 4J8UB 3AV1C 5GT0D 3UT9C 3W99B 5DNMC 1F66A 3VH6W 4WNNB 5E5AD 1P3PB 2NZDC 1ID3D 4LD9D 3AZFB 3X1VD 5B31B 4Z5TB 5F99B 1P3MA 5B1LB 3VH5A 3MVDC 5DNNA 5C3IC 4Z66A 4ZBJC 3WKJB 3KUYD 5AV8B 5AY8C 5B2IB 5GXQD 1BH8B 5AVBC 3UTBA 3W96C 3AZLD 5JRGC 1U35B 4JJND 3C1CB 2JSSA 4YM6B 1P3OC 3WA9D 1A7WA 3MGQA 2FJ7C 2HIOA 1N1JB 3AZMC 3AFAB 3AZHA 4YS3B 4NFTA 5B40C 1P3AA 5BNVA 5B0ZA 3AZLA 1M18A 3B6FD 4WU9C 5G49B 2CV5C 1M19C 3LELD 5AVCA 3RELD 3AN2A 3X1SD 3B0DB 3AZKC 1B6WA 2NQBB 1KX5D 3C1BB 1JFIA 3A6NA 3REHB 5CPID 1P3KC 1P3IB 5KDMB 5B24C 5GT3C 4WU8B 3AZJB 3RELA 1KX4D 4H9RB 1KX5A 2BYKB 1TZYB 3R45B 1P3BA 2AROA 2IO5C 1KX3A 5CPJB 3KXBA 5CP6D 1M1AA 4H9OB 4Z2MH 1P3GB 3AV2A 4R8PD 5B1MB 3NQUA 3AYWD 3AZIB 1KX4A 4J8XA 5B33C 3AV1A 2YFWA 3UT9A 5DNMA 4CAYB 1P34D 5B32D 4KUDC 3AZNC 2NZDA 5AY8D 5B2JD 5AV6D 5GT0B 3REIC 3WAAD 3REJC 4KGCC 3MVDA 4Z66B 1ZLAC 5DNNC 2FJ7D 4XUJD 5JA4A 5AY8A 1ID3B 5B0YC 5AVBA 3X1VB 3UTBC 3W96A 2PYOD 5JRGA 4CSRA 3WTPD 1P3OA 3VH5W 1Q9CA 3AZMA 5GXQB 5B40A 2NQBD 3AZLB 3TU4C 3LZ0C 4QLCC 4WU9A 4M6BA 2CV5A 5GT3D 3O62C 1S32D 1M19A 4WU8D 3W98C 3WA9B 4ZUXC 3KWQA 3MGSD 3AZKA 3X1TD 4J8WD 1P3KA 3W97C 5B32G 3B6FB 5B24A 1P3GD 3LELB 5B1MD 3AZGD 3RELB 3REKC 1KX5B 3LJAD 1P3BB 2AROB 3UTAC 1KX3C 1P3LC 5CPKC 1M1AB 1F66D 3AV2B 3MGRC 4KUDD 3AZEC 3MGPC 1KX4B 5AV5C 3X1UC 3MNNC 4H9QA 1AOIC 5B33A 1EQZC 4EO5B 5CP6B 4KUDA 4J8VC 4R8PB 3B0CT 3AZNA 1P3MD 3AYWB 5DNND 4Z66D 3REIA 3UTBD 1P34B 3REJA 5B32B 1ULYA 5AV9C 4KGCA 1ZLAA 4ZBJB 3MGQD 2HIOD 3AZHD 5B2JB 5AY8B 5AV6B 5B0YA 1P3AD 3WAAB 5B0ZD 4UUZA 4KHAB 3W99C 1M18D 5BO0B 3W98D 1P3PC 1TAFB 4H9NA 2FJ7B 4XUJB 5AVCD 3AN2D 1WWSA 2PYOB 3TU4A 3A6ND 5B31C 3LZ0A 4QLCA 1M19B 4Z5TC 3WTPB 5F99C 3O62A 3W98A 5B1LC 2YFVB 3WKJC 4ZUXA 3AZKB 5AV8C 5B2IC 3NQJB 1P3BD 2AROD 3KWQC 1KX3D 3KXBD 3W97A 1U35C 1M1AD 1S32B 5GT3B 3AV2D 3C1CC 4YM6C 1H3OA 1F1EA 4AWLC 5AV5D 4J8XD 2HUEC 3MGSB 2RVQC 2BYMA 3AFAC 3REKA 4YS3C 3AV1D 3X1TB 4J8WB 3UT9D 3UTAA 5DNMD 1P3LA 5CPKA 3MGRA 4J8VD 4H9PA 3AZEA 3AZGB 3MGPA 2NZDD 4X23C 4H9QB 5AV5A 4DRAA 3X1UA 3MNNA 3LJAB 1AOIA 3B0DC 1EQZA 1HQ3C 3C1BC 3REHC 1F66B 4KUDB 4J8VA 1P3IC 3B6GC 3MVDD 3AZJC 3V9RA 4H9SC 4E45A 5AVBD 3W96D 1TZYC 5BT1C 5JRGD 5CPJC 5AV9A 4KGCB 1P3MB 5DNNB 1P3OD 3AZIC 3AZMD 5B40D 4J8UA 3UTBB 4G91C 2F8NH 3W99A 4WU9D 2CV5D 1M19D 3LZ1C 4WNNA 1P3PA 3MGQB 2HIOB 3AZHB 1P3FC 1P3AB 3AZKD 5BNVB 4G92B 5GT0C 5B0ZB 3LZ0B 2CWEA 3AZFA 5B31A 1M18B 4QLCB 1P3KD 1B67A 4Z5TA 5F99A 5B24D 4HGAC 3W98B 5E5AC 5B1LA 5AVCB 3AN2B 3WKJA 5GSUC 5AV8A 5B2IA 1ID3C 1BH8A 1JFIB 3A6NB 3X1VC
chains in the Genus database with same CATH superfamily
2JCHA 1U35A 3C1CA 4YM6A 3KUYC 1N1JA 3AFAA 2F8NK 5B33D 4YS3A 1KX3B 3KXBB 2L5AA 1P3LB 4JJNC 4H9PB 3B6GD 5G49A 3NQUB 3MGPB 3AZND 3WA9C 2G5HC 4X23A 5AV5B 4J8XB 3MNNB 1EQZB 3AV1B 2YFWB 3UT9B 1HQ3A 3REID 3C1BA 5DNMB 3REJD 3REHA 4J8VB 3B6FC 1P3IA 5KDMA 3B6GA 4KGCD 2LY8A 1ZLAD 3LELC 3AZJA 2NZDB 1BH9A 4H9SA 3X1SC 2BG1A 5B0YD 4H9RA 1TZYA 3R45A 5CPJA 5CPIC 3MVDB 4XZQC 2F8NA 5C3IB 4Z2MG 1HTAA 3AZIA 5JA4B 1P3FD 2F2AC 5AVBB 3EPLA 4J8UC 3W96B 5JRGB 3TU4D 3LZ0D 5BNXA 3KSYA 4CSRB 4CAYA 4EO5C 4QLCD 3VH6T 5CP6C 3O62D 3LZ1A 1P3OB 3IP4C 4R8PC 3AYWC 3AZMB 2Y2IA 1P3FA 4ZUXD 5GSUD 5B40B 5GT0A 3EPHA 4NE5A 3AZFC 1P34C 3W97D 5B32C 4WU9B 2CV5B 2ZY2A 5E5AA 2ZY4A 1BFMA 4WZSB 5GSUA 5AV6C 5B2JC 3REKD 1ID3A 5FUGA 3KWQB 3UTAD 4LD9A 3X1VA 3WAAC 1P3KB 1P3LD 5CPKD 5B24B 3MGRD 2F8NG 3AZED 3MGPD 1WWIA 4AWLB 4LD9C 2HUEB 4XUJC 3X1UD 3KUYA 3MNND 1AOID 5GXQA 1EQZD 3A1IA 2IO5B 2PYOC 4JJNA 3WTPC 3WA9A 4X23B 5B33B 2FFFB 1HQ3B 2NQBC 3KFUG 5AV9D 3B6GB 3B6FA 3AZNB 1S32C 4XZQD 4WU8C 3LELA 1BH9B 2JE5A 3X1SA 3MGSC 2Y2KA 3REIB 5BS7C 4J8UD 3X1TC 4NE3A 4J8WC 3REJB 5CPIA 3W99D 3VH6A 2F8NB 1P3GC 4XZQA 1ZLAB 1P3PD 5B1MC 3AZGC 5B0YB 3LJAC 4G91B 4UUZB 3AZFD 5BNXB 5B31D 5CP6A 1F66C 4Z5TD 5F99D 3LZ1B 3WTPE 4R8PA 4H9NB 5B1LD 3H0RC 2VQRA 3AYWA 1P3FB 3WKJD 5AV8D 5B2ID 3TU4B 2Y2PA 3KWQD 1U35D 1P34A 5B32A 4HGAB 3O62B 5E5AB 1P3MC 3C1CD 4NE6A 4YM6D 4Z66C 4ZUXB 5GSUB 2RVQD 5AV6A 5B2JA 5CHLB 1KU5A 4YS3D 5FUGB 3AFAD 4LD9B 3WAAA 3W97B 4KHAA 1H3OB 5BO0A 3VH5T 1TAFA 4X23D 3MGQC 3KUYB 2HIOC 4XUJA 3AZHC 2BYMB 3REKB 2FJ7A 5GXQC 1P3AC 4G92C 1HQ3D 3UTAB 2PYOA 3C1BD 5B0ZC 3AZLC 4JJNB 5CPKB 1M18C 3REHD 1R4VA 3MGRB 1P3ID 3WTPA 3AZEB 3AZJD 5AVCC 3X1UB 3AN2C 2YFVA 1AOIB 4DRBA 2NQBA 3NQJA 1TZYD 4E44A 3A6NC 5BT1D 5B31G 5CPJD 1T3UA 1S32A 5GT3A 2UWXA 3B0CW 4WU8A 2F8ND 3V9RB 3X1SB 3RELC 3AZID 2DQNC 3MGSA 5BS7A 1KX5C 3X1TA 2BYKA 4J8WA 2AROC 1P3BC 5CPIB 5AV9B 3KXBC 3B0BA 1M1AC 3AL0C 2DF4C 4XZQB 4H9OA 1P3GA 3LZ1D 4WV4B 3AV2C 1Z2CB 5B1MA 3AZGA 1KX4C 4J8XC 3LJAA 4J8UB 3AV1C 5GT0D 3UT9C 3W99B 5DNMC 1F66A 3VH6W 4WNNB 5E5AD 1P3PB 2XD5A 2NZDC 2G5IC 1ID3D 4LD9D 3AZFB 3X1VD 5B31B 2Y2LA 4Z5TB 5F99B 1P3MA 5B1LB 3VH5A 3MVDC 5DNNA 5C3IC 4Z66A 1PZRA 4ZBJC 3WKJB 3KUYD 5AV8B 5AY8C 5B2IB 5GXQD 1BH8B 5AVBC 3UTBA 3W96C 3AZLD 5JRGC 1U35B 2W8SA 4JJND 3C1CB 2JSSA 4YM6B 1P3OC 3WA9D 1A7WA 3MGQA 2FJ7C 2HIOA 1N1JB 3AZMC 3AFAB 3AZHA 3EG5B 4YS3B 4NFTA 5B40C 1P3AA 5BNVA 5B0ZA 3AZLA 1M18A 3B6FD 4WU9C 5G49B 2CV5C 1M19C 3LELD 5AVCA 3RELD 3AN2A 3X1SD 3B0DB 3AZKC 1B6WA 2NQBB 1KX5D 3C1BB 1JFIA 3A6NA 3REHB 5CPID 1P3KC 1P3IB 5KDMB 5B24C 5GT3C 4WU8B 1W2EA 3AZJB 3RELA 1KX4D 4H9RB 1KX5A 2BYKB 1TZYB 3R45B 1P3BA 2AROA 2IO5C 1KX3A 5CPJB 4UPKA 3KXBA 5CP6D 1M1AA 4H9OB 4Z2MH 1P3GB 3AV2A 4R8PD 5B1MB 3NQUA 3AYWD 4WJ3C 3AZIB 1KX4A 4J8XA 5B33C 3AV1A 2YFWA 3UT9A 5DNMA 4CAYB 1P34D 5B32D 4KUDC 3AZNC 2NZDA 5AY8D 5B2JD 5AV6D 5GT0B 3REIC 3WAAD 3REJC 4KGCC 3MVDA 4Z66B 1ZLAC 5DNNC 2ZM5A 2FJ7D 4XUJD 5JA4A 5AY8A 1ID3B 5B0YC 2Y2GA 5AVBA 3X1VB 3UTBC 3W96A 2PYOD 5JRGA 4CSRA 3WTPD 1P3OA 3VH5W 1Q9CA 3AZMA 5GXQB 5B40A 2NQBD 3FDDA 3AZLB 3TU4C 3LZ0C 4QLCC 4WU9A 4M6BA 2CV5A 5GT3D 3O62C 1S32D 1M19A 4WU8D 3W98C 3WA9B 4ZUXC 3KWQA 3MGSD 3AZKA 2ZY5A 3X1TD 4J8WD 2Y2NA 2Y2QA 1P3KA 3W97C 5B32G 3B6FB 2Y2OA 5B24A 3P5JB 1P3GD 3LELB 5B1MD 3AZGD 3RELB 3REKC 1KX5B 3LJAD 2Y2MA 1P3BB 2AROB 3UTAC 1KX3C 1P3LC 5CPKC 1M1AB 1F66D 3AV2B 3MGRC 4KUDD 3EPJA 3AZEC 3MGPC 1KX4B 5AV5C 3X1UC 3MNNC 4H9QA 1AOIC 5B33A 1EQZC 3F6TA 4EO5B 5CP6B 4KUDA 4J8VC 4R8PB 3B0CT 3AZNA 2XD1A 1P3MD 3AYWB 5DNND 4Z66D 3REIA 3UTBD 1P34B 3REJA 5B32B 1ULYA 5AV9C 4KGCA 1ZLAA 4ZBJB 3MGQD 2HIOD 3AZHD 5B2JB 5AY8B 5AV6B 5B0YA 1P3AD 3WAAB 5B0ZD 4UUZA 4KHAB 3W99C 1M18D 5BO0B 3W98D 1P3PC 1TAFB 4H9NA 2FJ7B 4XUJB 5AVCD 3AN2D 1WWSA 2PYOB 3TU4A 3A6ND 5B31C 3LZ0A 4QLCA 1M19B 4Z5TC 3WTPB 5F99C 3O62A 3W98A 5B1LC 2YFVB 3WKJC 4ZUXA 3AZKB 5AV8C 5B2IC 3NQJB 1P3BD 2AROD 3KWQC 3H0MC 1KX3D 3KXBD 3W97A 1U35C 1M1AD 1S32B 5GT3B 3AV2D 3C1CC 4YM6C 1H3OA 1F1EA 4AWLC 5AV5D 4J8XD 2HUEC 3MGSB 2RVQC 2BYMA 3AFAC 3REKA 4YS3C 3AV1D 3X1TB 4J8WB 3UT9D 3UTAA 5DNMD 1P3LA 5CPKA 3MGRA 4J8VD 4H9PA 3AZEA 3AZGB 3MGPA 2NZDD 4X23C 4H9QB 5AV5A 4DRAA 3X1UA 3MNNA 3LJAB 1AOIA 3B0DC 1EQZA 3A1KA 1HQ3C 3C1BC 3EPKA 3REHC 1F66B 4KUDB 4J8VA 1P3IC 3B6GC 2Y2HA 3MVDD 2Y2JA 3AZJC 3V9RA 4H9SC 4E45A 5AVBD 2J8PA 3W96D 1TZYC 5BT1C 5JRGD 5CPJC 5AV9A 2RIQA 1P3MB 4KGCB 5DNNB 1P3OD 3AZIC 3AZMD 5B40D 4J8UA 3UTBB 4DQYB 4G91C 3H0LC 2F8NH 3W99A 4WU9D 2CV5D 1M19D 3LZ1C 4WNNA 1P3PA 3MGQB 2HIOB 3AZHB 1P3FC 1P3AB 3AZKD 5BNVB 4G92B 5GT0C 5B0ZB 3LZ0B 2CWEA 3AZFA 5B31A 1M18B 4QLCB 1P3KD 1B67A 4Z5TA 5F99A 5B24D 4HGAC 3W98B 5E5AC 2ZY3A 5B1LA 5AVCB 3AN2B 3WKJA 5GSUC 5AV8A 5B2IA 1ID3C 1BH8A 1JFIB 3A6NB 3X1VC
chains in the Genus database with same CATH topology
2JCHA 1U35A 3C1CA 4YM6A 3KUYC 1N1JA 3AFAA 2F8NK 5B33D 4YS3A 1KX3B 3KXBB 2L5AA 1P3LB 4JJNC 4H9PB 3B6GD 5G49A 3NQUB 3MGPB 3AZND 3WA9C 2G5HC 4X23A 5AV5B 4J8XB 3MNNB 1EQZB 3AV1B 2YFWB 3UT9B 1HQ3A 3REID 3C1BA 5DNMB 3REJD 3REHA 4J8VB 3B6FC 1P3IA 5KDMA 3B6GA 4KGCD 2LY8A 1ZLAD 3LELC 3AZJA 2NZDB 1BH9A 4H9SA 3X1SC 2BG1A 5B0YD 4H9RA 1TZYA 3R45A 5CPJA 5CPIC 3MVDB 4XZQC 2F8NA 5C3IB 4Z2MG 1HTAA 3AZIA 5JA4B 1P3FD 2F2AC 5AVBB 3EPLA 4J8UC 3W96B 5JRGB 3TU4D 3LZ0D 5BNXA 3KSYA 4CSRB 4CAYA 4EO5C 4QLCD 3VH6T 5CP6C 3O62D 3LZ1A 1P3OB 3IP4C 4R8PC 3AYWC 3AZMB 2Y2IA 1P3FA 4ZUXD 5GSUD 5B40B 5GT0A 3EPHA 4NE5A 3AZFC 1P34C 3W97D 5B32C 4WU9B 2CV5B 2ZY2A 5E5AA 2ZY4A 1BFMA 4WZSB 5GSUA 5AV6C 5B2JC 3REKD 1ID3A 5FUGA 3KWQB 3UTAD 4LD9A 3X1VA 3WAAC 1P3KB 1P3LD 5CPKD 5B24B 3MGRD 2F8NG 3AZED 3MGPD 1WWIA 4AWLB 4LD9C 2HUEB 4XUJC 3X1UD 3KUYA 3MNND 1AOID 5GXQA 1EQZD 3A1IA 2IO5B 2PYOC 4JJNA 3WTPC 3WA9A 4X23B 5B33B 2FFFB 1HQ3B 2NQBC 3KFUG 5AV9D 3B6GB 3B6FA 3AZNB 1S32C 4XZQD 4WU8C 3LELA 1BH9B 2JE5A 3X1SA 3MGSC 2Y2KA 3REIB 5BS7C 4J8UD 3X1TC 4NE3A 4J8WC 3REJB 5CPIA 3W99D 3VH6A 2F8NB 1P3GC 4XZQA 1ZLAB 1P3PD 5B1MC 3AZGC 5B0YB 3LJAC 4G91B 4UUZB 3AZFD 5BNXB 5B31D 5CP6A 1F66C 4Z5TD 5F99D 3LZ1B 3WTPE 4R8PA 4H9NB 5B1LD 3H0RC 2VQRA 3AYWA 1P3FB 3WKJD 5AV8D 5B2ID 3TU4B 2Y2PA 3KWQD 1U35D 1P34A 5B32A 4HGAB 3O62B 5E5AB 1P3MC 3C1CD 4NE6A 4YM6D 4Z66C 4ZUXB 5GSUB 2RVQD 5AV6A 5B2JA 5CHLB 1KU5A 4YS3D 5FUGB 3AFAD 4LD9B 3WAAA 3W97B 4KHAA 1H3OB 5BO0A 3VH5T 1TAFA 4X23D 3MGQC 3KUYB 2HIOC 4XUJA 3AZHC 2BYMB 3REKB 2FJ7A 5GXQC 1P3AC 4G92C 1HQ3D 3UTAB 2PYOA 3C1BD 5B0ZC 3AZLC 4JJNB 5CPKB 1M18C 3REHD 1R4VA 3MGRB 1P3ID 3WTPA 3AZEB 3AZJD 5AVCC 3X1UB 3AN2C 2YFVA 1AOIB 4DRBA 2NQBA 3NQJA 1TZYD 4E44A 3A6NC 5BT1D 5B31G 5CPJD 1T3UA 1S32A 5GT3A 2UWXA 3B0CW 4WU8A 2F8ND 3V9RB 3X1SB 3RELC 3AZID 2DQNC 3MGSA 5BS7A 1KX5C 3X1TA 2BYKA 4J8WA 2AROC 1P3BC 5CPIB 5AV9B 3KXBC 3B0BA 1M1AC 3AL0C 2DF4C 4XZQB 4H9OA 1P3GA 3LZ1D 4WV4B 3AV2C 1Z2CB 5B1MA 3AZGA 1KX4C 4J8XC 3LJAA 4J8UB 3AV1C 5GT0D 3UT9C 3W99B 5DNMC 1F66A 3VH6W 4WNNB 5E5AD 1P3PB 2XD5A 2NZDC 2G5IC 1ID3D 4LD9D 3AZFB 3X1VD 5B31B 2Y2LA 4Z5TB 5F99B 1P3MA 5B1LB 3VH5A 3MVDC 5DNNA 5C3IC 4Z66A 1PZRA 4ZBJC 3WKJB 3KUYD 5AV8B 5AY8C 5B2IB 5GXQD 1BH8B 5AVBC 3UTBA 3W96C 3AZLD 5JRGC 1U35B 2W8SA 4JJND 3C1CB 2JSSA 4YM6B 1P3OC 3WA9D 1A7WA 3MGQA 2FJ7C 2HIOA 1N1JB 3AZMC 3AFAB 3AZHA 3EG5B 4YS3B 4NFTA 5B40C 1P3AA 5BNVA 5B0ZA 3AZLA 1M18A 3B6FD 4WU9C 5G49B 2CV5C 1M19C 3LELD 5AVCA 3RELD 3AN2A 3X1SD 3B0DB 3AZKC 1B6WA 2NQBB 1KX5D 3C1BB 1JFIA 3A6NA 3REHB 5CPID 1P3KC 1P3IB 5KDMB 5B24C 5GT3C 4WU8B 1W2EA 3AZJB 3RELA 1KX4D 4H9RB 1KX5A 2BYKB 1TZYB 3R45B 1P3BA 2AROA 2IO5C 1KX3A 5CPJB 4UPKA 3KXBA 5CP6D 1M1AA 4H9OB 4Z2MH 1P3GB 3AV2A 4R8PD 5B1MB 3NQUA 3AYWD 4WJ3C 3AZIB 1KX4A 4J8XA 5B33C 3AV1A 2YFWA 3UT9A 5DNMA 4CAYB 1P34D 5B32D 4KUDC 3AZNC 2NZDA 5AY8D 5B2JD 5AV6D 5GT0B 3REIC 3WAAD 3REJC 4KGCC 3MVDA 4Z66B 1ZLAC 5DNNC 2ZM5A 2FJ7D 4XUJD 5JA4A 5AY8A 1ID3B 5B0YC 2Y2GA 5AVBA 3X1VB 3UTBC 3W96A 2PYOD 5JRGA 4CSRA 3WTPD 1P3OA 3VH5W 1Q9CA 3AZMA 5GXQB 5B40A 2NQBD 3FDDA 3AZLB 3TU4C 3LZ0C 4QLCC 4WU9A 4M6BA 2CV5A 5GT3D 3O62C 1S32D 1M19A 4WU8D 3W98C 3WA9B 4ZUXC 3KWQA 3MGSD 3AZKA 2ZY5A 3X1TD 4J8WD 2Y2NA 2Y2QA 1P3KA 3W97C 5B32G 3B6FB 2Y2OA 5B24A 3P5JB 1P3GD 3LELB 5B1MD 3AZGD 3RELB 3REKC 1KX5B 3LJAD 2Y2MA 1P3BB 2AROB 3UTAC 1KX3C 1P3LC 5CPKC 1M1AB 1F66D 3AV2B 3MGRC 4KUDD 3EPJA 3AZEC 3MGPC 1KX4B 5AV5C 3X1UC 3MNNC 4H9QA 1AOIC 5B33A 1EQZC 3F6TA 4EO5B 5CP6B 4KUDA 4J8VC 4R8PB 3B0CT 3AZNA 2XD1A 1P3MD 3AYWB 5DNND 4Z66D 3REIA 3UTBD 1P34B 3REJA 5B32B 1ULYA 5AV9C 4KGCA 1ZLAA 4ZBJB 3MGQD 2HIOD 3AZHD 5B2JB 5AY8B 5AV6B 5B0YA 1P3AD 3WAAB 5B0ZD 4UUZA 4KHAB 3W99C 1M18D 5BO0B 3W98D 1P3PC 1TAFB 4H9NA 2FJ7B 4XUJB 5AVCD 3AN2D 1WWSA 2PYOB 3TU4A 3A6ND 5B31C 3LZ0A 4QLCA 1M19B 4Z5TC 3WTPB 5F99C 3O62A 3W98A 5B1LC 2YFVB 3WKJC 4ZUXA 3AZKB 5AV8C 5B2IC 3NQJB 1P3BD 2AROD 3KWQC 3H0MC 1KX3D 3KXBD 3W97A 1U35C 1M1AD 1S32B 5GT3B 3AV2D 3C1CC 4YM6C 1H3OA 1F1EA 4AWLC 5AV5D 4J8XD 2HUEC 3MGSB 2RVQC 2BYMA 3AFAC 3REKA 4YS3C 3AV1D 3X1TB 4J8WB 3UT9D 3UTAA 5DNMD 1P3LA 5CPKA 3MGRA 4J8VD 4H9PA 3AZEA 3AZGB 3MGPA 2NZDD 4X23C 4H9QB 5AV5A 4DRAA 3X1UA 3MNNA 3LJAB 1AOIA 3B0DC 1EQZA 3A1KA 1HQ3C 3C1BC 3EPKA 3REHC 1F66B 4KUDB 4J8VA 1P3IC 3B6GC 2Y2HA 3MVDD 2Y2JA 3AZJC 3V9RA 4H9SC 4E45A 5AVBD 2J8PA 3W96D 1TZYC 5BT1C 5JRGD 5CPJC 5AV9A 2RIQA 1P3MB 4KGCB 5DNNB 1P3OD 3AZIC 3AZMD 5B40D 4J8UA 3UTBB 4DQYB 4G91C 3H0LC 2F8NH 3W99A 4WU9D 2CV5D 1M19D 3LZ1C 4WNNA 1P3PA 3MGQB 2HIOB 3AZHB 1P3FC 1P3AB 3AZKD 5BNVB 4G92B 5GT0C 5B0ZB 3LZ0B 2CWEA 3AZFA 5B31A 1M18B 4QLCB 1P3KD 1B67A 4Z5TA 5F99A 5B24D 4HGAC 3W98B 5E5AC 2ZY3A 5B1LA 5AVCB 3AN2B 3WKJA 5GSUC 5AV8A 5B2IA 1ID3C 1BH8A 1JFIB 3A6NB 3X1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 A;  3C1C A;  4YM6 A;  3KUY C;  1N1J A;  3AFA A;  2F8N K;  5B33 D;  4YS3 A;  1KX3 B;  3KXB B;  2L5A A;  1P3L B;  4JJN C;  4H9P B;  3B6G D;  5G49 A;  3NQU B;  3MGP B;  3AZN D;  3WA9 C;  4X23 A;  5AV5 B;  4J8X B;  3MNN B;  1EQZ B;  3AV1 B;  2YFW B;  3UT9 B;  1HQ3 A;  3REI D;  3C1B A;  5DNM B;  3REJ D;  3REH A;  4J8V B;  3B6F C;  1P3I A;  5KDM A;  3B6G A;  4KGC D;  2LY8 A;  1ZLA D;  3LEL C;  3AZJ A;  2NZD B;  1BH9 A;  4H9S A;  3X1S C;  5B0Y D;  4H9R A;  1TZY A;  3R45 A;  5CPJ A;  5CPI C;  3MVD B;  4XZQ C;  2F8N A;  5C3I B;  4Z2M G;  1HTA A;  3AZI A;  5JA4 B;  1P3F D;  5AVB B;  4J8U C;  3W96 B;  5JRG B;  3TU4 D;  3LZ0 D;  5BNX A;  3KSY A;  4CSR B;  4CAY A;  4EO5 C;  4QLC D;  3VH6 T;  5CP6 C;  3O62 D;  3LZ1 A;  1P3O B;  4R8P C;  3AYW C;  3AZM B;  1P3F A;  4ZUX D;  5GSU D;  5B40 B;  5GT0 A;  4NE5 A;  3AZF C;  1P34 C;  3W97 D;  5B32 C;  4WU9 B;  2CV5 B;  1BFM A;  5E5A A;  4WZS B;  5GSU A;  5B2J C;  5AV6 C;  3REK D;  1ID3 A;  5FUG A;  3KWQ B;  3UTA D;  4LD9 A;  3X1V A;  3WAA C;  1P3K B;  1P3L D;  5CPK D;  5B24 B;  3MGR D;  2F8N G;  3AZE D;  3MGP D;  1WWI A;  4AWL B;  4LD9 C;  2HUE B;  4XUJ C;  3X1U D;  3KUY A;  3MNN D;  1AOI D;  5GXQ A;  1EQZ D;  2IO5 B;  2PYO C;  4JJN A;  3WTP C;  3WA9 A;  4X23 B;  5B33 B;  1HQ3 B;  2NQB C;  5AV9 D;  3B6G B;  3B6F A;  3AZN B;  1S32 C;  4XZQ D;  4WU8 C;  3LEL A;  1BH9 B;  3X1S A;  3MGS C;  3REI B;  5BS7 C;  4J8U D;  3X1T C;  4NE3 A;  4J8W C;  3REJ B;  5CPI A;  3W99 D;  3VH6 A;  2F8N B;  1P3G C;  4XZQ A;  1ZLA B;  1P3P D;  5B1M C;  3AZG C;  5B0Y B;  3LJA C;  4G91 B;  4UUZ B;  3AZF D;  5BNX B;  5B31 D;  5CP6 A;  1F66 C;  4Z5T D;  5F99 D;  3LZ1 B;  3WTP E;  4R8P A;  4H9N B;  5B1L D;  3AYW A;  1P3F B;  3WKJ D;  5AV8 D;  5B2I D;  3TU4 B;  3KWQ D;  1U35 D;  1P34 A;  5B32 A;  4HGA B;  3O62 B;  5E5A B;  1P3M C;  3C1C D;  4NE6 A;  4YM6 D;  4Z66 C;  4ZUX B;  5GSU B;  2RVQ D;  5AV6 A;  5B2J A;  5CHL B;  1KU5 A;  4YS3 D;  5FUG B;  3AFA D;  4LD9 B;  3WAA A;  3W97 B;  4KHA A;  1H3O B;  5BO0 A;  3VH5 T;  1TAF A;  4X23 D;  3MGQ C;  3KUY B;  2HIO C;  4XUJ A;  3AZH C;  2BYM B;  3REK B;  2FJ7 A;  5GXQ C;  1P3A C;  4G92 C;  1HQ3 D;  3UTA B;  2PYO A;  3C1B D;  5B0Z C;  3AZL C;  4JJN B;  5CPK B;  1M18 C;  3REH D;  1R4V A;  3MGR B;  1P3I D;  3WTP A;  3AZE B;  3AZJ D;  5AVC C;  3X1U B;  3AN2 C;  2YFV A;  1AOI B;  4DRB A;  2NQB A;  3NQJ A;  1TZY D;  4E44 A;  3A6N C;  5BT1 D;  5B31 G;  5CPJ D;  1S32 A;  5GT3 A;  3B0C W;  2F8N D;  4WU8 A;  3V9R B;  3X1S B;  3REL C;  3AZI D;  3MGS A;  5BS7 A;  1KX5 C;  3X1T A;  2BYK A;  4J8W A;  2ARO C;  1P3B C;  5CPI B;  5AV9 B;  3KXB C;  3B0B A;  1M1A C;  4XZQ B;  4H9O A;  1P3G A;  3LZ1 D;  4WV4 B;  3AV2 C;  5B1M A;  3AZG A;  1KX4 C;  4J8X C;  3LJA A;  4J8U B;  3AV1 C;  5GT0 D;  3UT9 C;  3W99 B;  5DNM C;  1F66 A;  3VH6 W;  4WNN B;  5E5A D;  1P3P B;  2NZD C;  1ID3 D;  4LD9 D;  3AZF B;  3X1V D;  5B31 B;  4Z5T B;  5F99 B;  1P3M A;  5B1L B;  3VH5 A;  3MVD C;  5DNN A;  5C3I C;  4Z66 A;  4ZBJ C;  3WKJ B;  3KUY D;  5AV8 B;  5AY8 C;  5B2I B;  5GXQ D;  1BH8 B;  5AVB C;  3UTB A;  3W96 C;  3AZL D;  5JRG C;  1U35 B;  4JJN D;  3C1C B;  2JSS A;  4YM6 B;  1P3O C;  3WA9 D;  1A7W A;  3MGQ A;  2FJ7 C;  2HIO A;  1N1J B;  3AZM C;  3AFA B;  3AZH A;  4YS3 B;  4NFT A;  5B40 C;  1P3A A;  5BNV A;  5B0Z A;  3AZL A;  1M18 A;  3B6F D;  4WU9 C;  5G49 B;  2CV5 C;  1M19 C;  3LEL D;  5AVC A;  3REL D;  3AN2 A;  3X1S D;  3B0D B;  3AZK C;  1B6W A;  2NQB B;  1KX5 D;  3C1B B;  1JFI A;  3A6N A;  3REH B;  5CPI D;  1P3K C;  1P3I B;  5KDM B;  5B24 C;  5GT3 C;  4WU8 B;  3AZJ B;  3REL A;  1KX4 D;  4H9R B;  1KX5 A;  2BYK B;  1TZY B;  3R45 B;  1P3B A;  2ARO A;  2IO5 C;  1KX3 A;  5CPJ B;  3KXB A;  5CP6 D;  1M1A A;  4H9O B;  4Z2M H;  1P3G B;  3AV2 A;  4R8P D;  5B1M B;  3NQU A;  3AYW D;  3AZI B;  1KX4 A;  4J8X A;  5B33 C;  3AV1 A;  2YFW A;  3UT9 A;  5DNM A;  4CAY B;  1P34 D;  5B32 D;  4KUD C;  3AZN C;  2NZD A;  5AY8 D;  5B2J D;  5AV6 D;  5GT0 B;  3REI C;  3WAA D;  3REJ C;  4KGC C;  3MVD A;  4Z66 B;  1ZLA C;  5DNN C;  2FJ7 D;  4XUJ D;  5JA4 A;  5AY8 A;  1ID3 B;  5B0Y C;  5AVB A;  3X1V B;  3UTB C;  3W96 A;  2PYO D;  5JRG A;  4CSR A;  3WTP D;  1P3O A;  3VH5 W;  1Q9C A;  3AZM A;  5GXQ B;  5B40 A;  2NQB D;  3AZL B;  3TU4 C;  3LZ0 C;  4QLC C;  4WU9 A;  4M6B A;  2CV5 A;  5GT3 D;  3O62 C;  1S32 D;  1M19 A;  4WU8 D;  3W98 C;  3WA9 B;  4ZUX C;  3KWQ A;  3MGS D;  3AZK A;  3X1T D;  4J8W D;  1P3K A;  3W97 C;  5B32 G;  3B6F B;  5B24 A;  1P3G D;  3LEL B;  5B1M D;  3AZG D;  3REL B;  3REK C;  1KX5 B;  3LJA D;  1P3B B;  2ARO B;  3UTA C;  1KX3 C;  1P3L C;  5CPK C;  1M1A B;  1F66 D;  3AV2 B;  3MGR C;  4KUD D;  3AZE C;  3MGP C;  1KX4 B;  5AV5 C;  3X1U C;  3MNN C;  4H9Q A;  1AOI C;  5B33 A;  1EQZ C;  4EO5 B;  5CP6 B;  4KUD A;  4J8V C;  4R8P B;  3B0C T;  3AZN A;  1P3M D;  3AYW B;  5DNN D;  4Z66 D;  3REI A;  3UTB D;  1P34 B;  3REJ A;  5B32 B;  1ULY A;  5AV9 C;  4KGC A;  1ZLA A;  4ZBJ B;  3MGQ D;  2HIO D;  3AZH D;  5B2J B;  5AY8 B;  5AV6 B;  5B0Y A;  1P3A D;  3WAA B;  5B0Z D;  4UUZ A;  4KHA B;  3W99 C;  1M18 D;  5BO0 B;  3W98 D;  1P3P C;  1TAF B;  4H9N A;  2FJ7 B;  4XUJ B;  5AVC D;  3AN2 D;  1WWS A;  2PYO B;  3TU4 A;  3A6N D;  5B31 C;  3LZ0 A;  4QLC A;  1M19 B;  4Z5T C;  3WTP B;  5F99 C;  3O62 A;  3W98 A;  5B1L C;  2YFV B;  3WKJ C;  4ZUX A;  3AZK B;  5AV8 C;  5B2I C;  3NQJ B;  1P3B D;  2ARO D;  3KWQ C;  1KX3 D;  3KXB D;  3W97 A;  1U35 C;  1M1A D;  1S32 B;  5GT3 B;  3AV2 D;  3C1C C;  4YM6 C;  1H3O A;  1F1E A;  4AWL C;  5AV5 D;  4J8X D;  2HUE C;  3MGS B;  2RVQ C;  2BYM A;  3AFA C;  3REK A;  4YS3 C;  3AV1 D;  3X1T B;  4J8W B;  3UT9 D;  3UTA A;  5DNM D;  1P3L A;  5CPK A;  3MGR A;  4J8V D;  4H9P A;  3AZE A;  3AZG B;  3MGP A;  2NZD D;  4X23 C;  4H9Q B;  5AV5 A;  4DRA A;  3X1U A;  3MNN A;  3LJA B;  1AOI A;  3B0D C;  1EQZ A;  1HQ3 C;  3C1B C;  3REH C;  1F66 B;  4KUD B;  4J8V A;  1P3I C;  3B6G C;  3MVD D;  3AZJ C;  3V9R A;  4H9S C;  4E45 A;  5AVB D;  3W96 D;  1TZY C;  5BT1 C;  5JRG D;  5CPJ C;  5AV9 A;  4KGC B;  1P3M B;  5DNN B;  1P3O D;  3AZI C;  3AZM D;  5B40 D;  4J8U A;  3UTB B;  4G91 C;  2F8N H;  3W99 A;  4WU9 D;  2CV5 D;  1M19 D;  3LZ1 C;  4WNN A;  1P3P A;  3MGQ B;  2HIO B;  3AZH B;  1P3F C;  1P3A B;  3AZK D;  5BNV B;  4G92 B;  5GT0 C;  5B0Z B;  3LZ0 B;  2CWE A;  3AZF A;  5B31 A;  1M18 B;  4QLC B;  1P3K D;  1B67 A;  4Z5T A;  5F99 A;  5B24 D;  4HGA C;  3W98 B;  5E5A C;  5B1L A;  5AVC B;  3AN2 B;  3WKJ A;  5GSU C;  5AV8 A;  5B2I A;  1ID3 C;  1BH8 A;  1JFI B;  3A6N B;  3X1V C; 
#chains in the Genus database with same CATH topology
 2JCH A;  1U35 A;  3C1C A;  4YM6 A;  3KUY C;  1N1J A;  3AFA A;  2F8N K;  5B33 D;  4YS3 A;  1KX3 B;  3KXB B;  2L5A A;  1P3L B;  4JJN C;  4H9P B;  3B6G D;  5G49 A;  3NQU B;  3MGP B;  3AZN D;  3WA9 C;  2G5H C;  4X23 A;  5AV5 B;  4J8X B;  3MNN B;  1EQZ B;  3AV1 B;  2YFW B;  3UT9 B;  1HQ3 A;  3REI D;  3C1B A;  5DNM B;  3REJ D;  3REH A;  4J8V B;  3B6F C;  1P3I A;  5KDM A;  3B6G A;  4KGC D;  2LY8 A;  1ZLA D;  3LEL C;  3AZJ A;  2NZD B;  1BH9 A;  4H9S A;  3X1S C;  2BG1 A;  5B0Y D;  4H9R A;  1TZY A;  3R45 A;  5CPJ A;  5CPI C;  3MVD B;  4XZQ C;  2F8N A;  5C3I B;  4Z2M G;  1HTA A;  3AZI A;  5JA4 B;  1P3F D;  2F2A C;  5AVB B;  3EPL A;  4J8U C;  3W96 B;  5JRG B;  3TU4 D;  3LZ0 D;  5BNX A;  3KSY A;  4CSR B;  4CAY A;  4EO5 C;  4QLC D;  3VH6 T;  5CP6 C;  3O62 D;  3LZ1 A;  1P3O B;  3IP4 C;  4R8P C;  3AYW C;  3AZM B;  2Y2I A;  1P3F A;  4ZUX D;  5GSU D;  5B40 B;  5GT0 A;  3EPH A;  4NE5 A;  3AZF C;  1P34 C;  3W97 D;  5B32 C;  4WU9 B;  2CV5 B;  2ZY2 A;  5E5A A;  2ZY4 A;  1BFM A;  4WZS B;  5GSU A;  5AV6 C;  5B2J C;  3REK D;  1ID3 A;  5FUG A;  3KWQ B;  3UTA D;  4LD9 A;  3X1V A;  3WAA C;  1P3K B;  1P3L D;  5CPK D;  5B24 B;  3MGR D;  2F8N G;  3AZE D;  3MGP D;  1WWI A;  4AWL B;  4LD9 C;  2HUE B;  4XUJ C;  3X1U D;  3KUY A;  3MNN D;  1AOI D;  5GXQ A;  1EQZ D;  3A1I A;  2IO5 B;  2PYO C;  4JJN A;  3WTP C;  3WA9 A;  4X23 B;  5B33 B;  2FFF B;  1HQ3 B;  2NQB C;  3KFU G;  5AV9 D;  3B6G B;  3B6F A;  3AZN B;  1S32 C;  4XZQ D;  4WU8 C;  3LEL A;  1BH9 B;  2JE5 A;  3X1S A;  3MGS C;  2Y2K A;  3REI B;  5BS7 C;  4J8U D;  3X1T C;  4NE3 A;  4J8W C;  3REJ B;  5CPI A;  3W99 D;  3VH6 A;  2F8N B;  1P3G C;  4XZQ A;  1ZLA B;  1P3P D;  5B1M C;  3AZG C;  5B0Y B;  3LJA C;  4G91 B;  4UUZ B;  3AZF D;  5BNX B;  5B31 D;  5CP6 A;  1F66 C;  4Z5T D;  5F99 D;  3LZ1 B;  3WTP E;  4R8P A;  4H9N B;  5B1L D;  3H0R C;  2VQR A;  3AYW A;  1P3F B;  3WKJ D;  5AV8 D;  5B2I D;  3TU4 B;  2Y2P A;  3KWQ D;  1U35 D;  1P34 A;  5B32 A;  4HGA B;  3O62 B;  5E5A B;  1P3M C;  3C1C D;  4NE6 A;  4YM6 D;  4Z66 C;  4ZUX B;  5GSU B;  2RVQ D;  5AV6 A;  5B2J A;  5CHL B;  1KU5 A;  4YS3 D;  5FUG B;  3AFA D;  4LD9 B;  3WAA A;  3W97 B;  4KHA A;  1H3O B;  5BO0 A;  3VH5 T;  1TAF A;  4X23 D;  3MGQ C;  3KUY B;  2HIO C;  4XUJ A;  3AZH C;  2BYM B;  3REK B;  2FJ7 A;  5GXQ C;  1P3A C;  4G92 C;  1HQ3 D;  3UTA B;  2PYO A;  3C1B D;  5B0Z C;  3AZL C;  4JJN B;  5CPK B;  1M18 C;  3REH D;  1R4V A;  3MGR B;  1P3I D;  3WTP A;  3AZE B;  3AZJ D;  5AVC C;  3X1U B;  3AN2 C;  2YFV A;  1AOI B;  4DRB A;  2NQB A;  3NQJ A;  1TZY D;  4E44 A;  3A6N C;  5BT1 D;  5B31 G;  5CPJ D;  1T3U A;  1S32 A;  5GT3 A;  2UWX A;  3B0C W;  4WU8 A;  2F8N D;  3V9R B;  3X1S B;  3REL C;  3AZI D;  2DQN C;  3MGS A;  5BS7 A;  1KX5 C;  3X1T A;  2BYK A;  4J8W A;  2ARO C;  1P3B C;  5CPI B;  5AV9 B;  3KXB C;  3B0B A;  1M1A C;  3AL0 C;  2DF4 C;  4XZQ B;  4H9O A;  1P3G A;  3LZ1 D;  4WV4 B;  3AV2 C;  1Z2C B;  5B1M A;  3AZG A;  1KX4 C;  4J8X C;  3LJA A;  4J8U B;  3AV1 C;  5GT0 D;  3UT9 C;  3W99 B;  5DNM C;  1F66 A;  3VH6 W;  4WNN B;  5E5A D;  1P3P B;  2XD5 A;  2NZD C;  2G5I C;  1ID3 D;  4LD9 D;  3AZF B;  3X1V D;  5B31 B;  2Y2L A;  4Z5T B;  5F99 B;  1P3M A;  5B1L B;  3VH5 A;  3MVD C;  5DNN A;  5C3I C;  4Z66 A;  1PZR A;  4ZBJ C;  3WKJ B;  3KUY D;  5AV8 B;  5AY8 C;  5B2I B;  5GXQ D;  1BH8 B;  5AVB C;  3UTB A;  3W96 C;  3AZL D;  5JRG C;  1U35 B;  2W8S A;  4JJN D;  3C1C B;  2JSS A;  4YM6 B;  1P3O C;  3WA9 D;  1A7W A;  3MGQ A;  2FJ7 C;  2HIO A;  1N1J B;  3AZM C;  3AFA B;  3AZH A;  3EG5 B;  4YS3 B;  4NFT A;  5B40 C;  1P3A A;  5BNV A;  5B0Z A;  3AZL A;  1M18 A;  3B6F D;  4WU9 C;  5G49 B;  2CV5 C;  1M19 C;  3LEL D;  5AVC A;  3REL D;  3AN2 A;  3X1S D;  3B0D B;  3AZK C;  1B6W A;  2NQB B;  1KX5 D;  3C1B B;  1JFI A;  3A6N A;  3REH B;  5CPI D;  1P3K C;  1P3I B;  5KDM B;  5B24 C;  5GT3 C;  4WU8 B;  1W2E A;  3AZJ B;  3REL A;  1KX4 D;  4H9R B;  1KX5 A;  2BYK B;  1TZY B;  3R45 B;  1P3B A;  2ARO A;  2IO5 C;  1KX3 A;  5CPJ B;  4UPK A;  3KXB A;  5CP6 D;  1M1A A;  4H9O B;  4Z2M H;  1P3G B;  3AV2 A;  4R8P D;  5B1M B;  3NQU A;  3AYW D;  4WJ3 C;  3AZI B;  1KX4 A;  4J8X A;  5B33 C;  3AV1 A;  2YFW A;  3UT9 A;  5DNM A;  4CAY B;  1P34 D;  5B32 D;  4KUD C;  3AZN C;  2NZD A;  5AY8 D;  5B2J D;  5AV6 D;  5GT0 B;  3REI C;  3WAA D;  3REJ C;  4KGC C;  3MVD A;  4Z66 B;  1ZLA C;  5DNN C;  2ZM5 A;  2FJ7 D;  4XUJ D;  5JA4 A;  5AY8 A;  1ID3 B;  5B0Y C;  2Y2G A;  5AVB A;  3X1V B;  3UTB C;  3W96 A;  2PYO D;  5JRG A;  4CSR A;  3WTP D;  1P3O A;  3VH5 W;  1Q9C A;  3AZM A;  5GXQ B;  5B40 A;  2NQB D;  3FDD A;  3AZL B;  3TU4 C;  3LZ0 C;  4QLC C;  4WU9 A;  4M6B A;  2CV5 A;  5GT3 D;  3O62 C;  1S32 D;  1M19 A;  4WU8 D;  3W98 C;  3WA9 B;  4ZUX C;  3KWQ A;  3MGS D;  3AZK A;  2ZY5 A;  3X1T D;  4J8W D;  2Y2N A;  2Y2Q A;  1P3K A;  3W97 C;  5B32 G;  3B6F B;  2Y2O A;  5B24 A;  3P5J B;  1P3G D;  3LEL B;  5B1M D;  3AZG D;  3REL B;  3REK C;  1KX5 B;  3LJA D;  2Y2M A;  1P3B B;  2ARO B;  3UTA C;  1KX3 C;  1P3L C;  5CPK C;  1M1A B;  1F66 D;  3AV2 B;  3MGR C;  4KUD D;  3EPJ A;  3AZE C;  3MGP C;  1KX4 B;  5AV5 C;  3X1U C;  3MNN C;  4H9Q A;  1AOI C;  5B33 A;  1EQZ C;  3F6T A;  4EO5 B;  5CP6 B;  4KUD A;  4J8V C;  4R8P B;  3B0C T;  3AZN A;  2XD1 A;  1P3M D;  3AYW B;  5DNN D;  4Z66 D;  3REI A;  3UTB D;  1P34 B;  3REJ A;  5B32 B;  1ULY A;  5AV9 C;  4KGC A;  1ZLA A;  4ZBJ B;  3MGQ D;  2HIO D;  3AZH D;  5B2J B;  5AY8 B;  5AV6 B;  5B0Y A;  1P3A D;  3WAA B;  5B0Z D;  4UUZ A;  4KHA B;  3W99 C;  1M18 D;  5BO0 B;  3W98 D;  1P3P C;  1TAF B;  4H9N A;  2FJ7 B;  4XUJ B;  5AVC D;  3AN2 D;  1WWS A;  2PYO B;  3TU4 A;  3A6N D;  5B31 C;  3LZ0 A;  4QLC A;  1M19 B;  4Z5T C;  3WTP B;  5F99 C;  3O62 A;  3W98 A;  5B1L C;  2YFV B;  3WKJ C;  4ZUX A;  3AZK B;  5AV8 C;  5B2I C;  3NQJ B;  1P3B D;  2ARO D;  3KWQ C;  3H0M C;  1KX3 D;  3KXB D;  3W97 A;  1U35 C;  1M1A D;  1S32 B;  5GT3 B;  3AV2 D;  3C1C C;  4YM6 C;  1H3O A;  1F1E A;  4AWL C;  5AV5 D;  4J8X D;  2HUE C;  3MGS B;  2RVQ C;  2BYM A;  3AFA C;  3REK A;  4YS3 C;  3AV1 D;  3X1T B;  4J8W B;  3UT9 D;  3UTA A;  5DNM D;  1P3L A;  5CPK A;  3MGR A;  4J8V D;  4H9P A;  3AZE A;  3AZG B;  3MGP A;  2NZD D;  4X23 C;  4H9Q B;  5AV5 A;  4DRA A;  3X1U A;  3MNN A;  3LJA B;  1AOI A;  3B0D C;  1EQZ A;  3A1K A;  1HQ3 C;  3C1B C;  3EPK A;  3REH C;  1F66 B;  4KUD B;  4J8V A;  1P3I C;  3B6G C;  2Y2H A;  3MVD D;  2Y2J A;  3AZJ C;  3V9R A;  4H9S C;  4E45 A;  5AVB D;  2J8P A;  3W96 D;  1TZY C;  5BT1 C;  5JRG D;  5CPJ C;  5AV9 A;  2RIQ A;  1P3M B;  4KGC B;  5DNN B;  1P3O D;  3AZI C;  3AZM D;  5B40 D;  4J8U A;  3UTB B;  4DQY B;  4G91 C;  3H0L C;  2F8N H;  3W99 A;  4WU9 D;  2CV5 D;  1M19 D;  3LZ1 C;  4WNN A;  1P3P A;  3MGQ B;  2HIO B;  3AZH B;  1P3F C;  1P3A B;  3AZK D;  5BNV B;  4G92 B;  5GT0 C;  5B0Z B;  3LZ0 B;  2CWE A;  3AZF A;  5B31 A;  1M18 B;  4QLC B;  1P3K D;  1B67 A;  4Z5T A;  5F99 A;  5B24 D;  4HGA C;  3W98 B;  5E5A C;  2ZY3 A;  5B1L A;  5AVC B;  3AN2 B;  3WKJ A;  5GSU C;  5AV8 A;  5B2I A;  1ID3 C;  1BH8 A;  1JFI B;  3A6N B;  3X1V C; 
#chains in the Genus database with same CATH homology
 2JCH A;  1U35 A;  3C1C A;  4YM6 A;  3KUY C;  1N1J A;  3AFA A;  2F8N K;  5B33 D;  4YS3 A;  1KX3 B;  3KXB B;  2L5A A;  1P3L B;  4JJN C;  4H9P B;  3B6G D;  5G49 A;  3NQU B;  3MGP B;  3AZN D;  3WA9 C;  2G5H C;  4X23 A;  5AV5 B;  4J8X B;  3MNN B;  1EQZ B;  3AV1 B;  2YFW B;  3UT9 B;  1HQ3 A;  3REI D;  3C1B A;  5DNM B;  3REJ D;  3REH A;  4J8V B;  3B6F C;  1P3I A;  5KDM A;  3B6G A;  4KGC D;  2LY8 A;  1ZLA D;  3LEL C;  3AZJ A;  2NZD B;  1BH9 A;  4H9S A;  3X1S C;  2BG1 A;  5B0Y D;  4H9R A;  1TZY A;  3R45 A;  5CPJ A;  5CPI C;  3MVD B;  4XZQ C;  2F8N A;  5C3I B;  4Z2M G;  1HTA A;  3AZI A;  5JA4 B;  1P3F D;  2F2A C;  5AVB B;  3EPL A;  4J8U C;  3W96 B;  5JRG B;  3TU4 D;  3LZ0 D;  5BNX A;  3KSY A;  4CSR B;  4CAY A;  4EO5 C;  4QLC D;  3VH6 T;  5CP6 C;  3O62 D;  3LZ1 A;  1P3O B;  3IP4 C;  4R8P C;  3AYW C;  3AZM B;  2Y2I A;  1P3F A;  4ZUX D;  5GSU D;  5B40 B;  5GT0 A;  3EPH A;  4NE5 A;  3AZF C;  1P34 C;  3W97 D;  5B32 C;  4WU9 B;  2CV5 B;  2ZY2 A;  5E5A A;  2ZY4 A;  1BFM A;  4WZS B;  5GSU A;  5AV6 C;  5B2J C;  3REK D;  1ID3 A;  5FUG A;  3KWQ B;  3UTA D;  4LD9 A;  3X1V A;  3WAA C;  1P3K B;  1P3L D;  5CPK D;  5B24 B;  3MGR D;  2F8N G;  3AZE D;  3MGP D;  1WWI A;  4AWL B;  4LD9 C;  2HUE B;  4XUJ C;  3X1U D;  3KUY A;  3MNN D;  1AOI D;  5GXQ A;  1EQZ D;  3A1I A;  2IO5 B;  2PYO C;  4JJN A;  3WTP C;  3WA9 A;  4X23 B;  5B33 B;  2FFF B;  1HQ3 B;  2NQB C;  3KFU G;  5AV9 D;  3B6G B;  3B6F A;  3AZN B;  1S32 C;  4XZQ D;  4WU8 C;  3LEL A;  1BH9 B;  2JE5 A;  3X1S A;  3MGS C;  2Y2K A;  3REI B;  5BS7 C;  4J8U D;  3X1T C;  4NE3 A;  4J8W C;  3REJ B;  5CPI A;  3W99 D;  3VH6 A;  2F8N B;  1P3G C;  4XZQ A;  1ZLA B;  1P3P D;  5B1M C;  3AZG C;  5B0Y B;  3LJA C;  4G91 B;  4UUZ B;  3AZF D;  5BNX B;  5B31 D;  5CP6 A;  1F66 C;  4Z5T D;  5F99 D;  3LZ1 B;  3WTP E;  4R8P A;  4H9N B;  5B1L D;  3H0R C;  2VQR A;  3AYW A;  1P3F B;  3WKJ D;  5AV8 D;  5B2I D;  3TU4 B;  2Y2P A;  3KWQ D;  1U35 D;  1P34 A;  5B32 A;  4HGA B;  3O62 B;  5E5A B;  1P3M C;  3C1C D;  4NE6 A;  4YM6 D;  4Z66 C;  4ZUX B;  5GSU B;  2RVQ D;  5AV6 A;  5B2J A;  5CHL B;  1KU5 A;  4YS3 D;  5FUG B;  3AFA D;  4LD9 B;  3WAA A;  3W97 B;  4KHA A;  1H3O B;  5BO0 A;  3VH5 T;  1TAF A;  4X23 D;  3MGQ C;  3KUY B;  2HIO C;  4XUJ A;  3AZH C;  2BYM B;  3REK B;  2FJ7 A;  5GXQ C;  1P3A C;  4G92 C;  1HQ3 D;  3UTA B;  2PYO A;  3C1B D;  5B0Z C;  3AZL C;  4JJN B;  5CPK B;  1M18 C;  3REH D;  1R4V A;  3MGR B;  1P3I D;  3WTP A;  3AZE B;  3AZJ D;  5AVC C;  3X1U B;  3AN2 C;  2YFV A;  1AOI B;  4DRB A;  2NQB A;  3NQJ A;  1TZY D;  4E44 A;  3A6N C;  5BT1 D;  5B31 G;  5CPJ D;  1T3U A;  1S32 A;  5GT3 A;  2UWX A;  3B0C W;  4WU8 A;  2F8N D;  3V9R B;  3X1S B;  3REL C;  3AZI D;  2DQN C;  3MGS A;  5BS7 A;  1KX5 C;  3X1T A;  2BYK A;  4J8W A;  2ARO C;  1P3B C;  5CPI B;  5AV9 B;  3KXB C;  3B0B A;  1M1A C;  3AL0 C;  2DF4 C;  4XZQ B;  4H9O A;  1P3G A;  3LZ1 D;  4WV4 B;  3AV2 C;  1Z2C B;  5B1M A;  3AZG A;  1KX4 C;  4J8X C;  3LJA A;  4J8U B;  3AV1 C;  5GT0 D;  3UT9 C;  3W99 B;  5DNM C;  1F66 A;  3VH6 W;  4WNN B;  5E5A D;  1P3P B;  2XD5 A;  2NZD C;  2G5I C;  1ID3 D;  4LD9 D;  3AZF B;  3X1V D;  5B31 B;  2Y2L A;  4Z5T B;  5F99 B;  1P3M A;  5B1L B;  3VH5 A;  3MVD C;  5DNN A;  5C3I C;  4Z66 A;  1PZR A;  4ZBJ C;  3WKJ B;  3KUY D;  5AV8 B;  5AY8 C;  5B2I B;  5GXQ D;  1BH8 B;  5AVB C;  3UTB A;  3W96 C;  3AZL D;  5JRG C;  1U35 B;  2W8S A;  4JJN D;  3C1C B;  2JSS A;  4YM6 B;  1P3O C;  3WA9 D;  1A7W A;  3MGQ A;  2FJ7 C;  2HIO A;  1N1J B;  3AZM C;  3AFA B;  3AZH A;  3EG5 B;  4YS3 B;  4NFT A;  5B40 C;  1P3A A;  5BNV A;  5B0Z A;  3AZL A;  1M18 A;  3B6F D;  4WU9 C;  5G49 B;  2CV5 C;  1M19 C;  3LEL D;  5AVC A;  3REL D;  3AN2 A;  3X1S D;  3B0D B;  3AZK C;  1B6W A;  2NQB B;  1KX5 D;  3C1B B;  1JFI A;  3A6N A;  3REH B;  5CPI D;  1P3K C;  1P3I B;  5KDM B;  5B24 C;  5GT3 C;  4WU8 B;  1W2E A;  3AZJ B;  3REL A;  1KX4 D;  4H9R B;  1KX5 A;  2BYK B;  1TZY B;  3R45 B;  1P3B A;  2ARO A;  2IO5 C;  1KX3 A;  5CPJ B;  4UPK A;  3KXB A;  5CP6 D;  1M1A A;  4H9O B;  4Z2M H;  1P3G B;  3AV2 A;  4R8P D;  5B1M B;  3NQU A;  3AYW D;  4WJ3 C;  3AZI B;  1KX4 A;  4J8X A;  5B33 C;  3AV1 A;  2YFW A;  3UT9 A;  5DNM A;  4CAY B;  1P34 D;  5B32 D;  4KUD C;  3AZN C;  2NZD A;  5AY8 D;  5B2J D;  5AV6 D;  5GT0 B;  3REI C;  3WAA D;  3REJ C;  4KGC C;  3MVD A;  4Z66 B;  1ZLA C;  5DNN C;  2ZM5 A;  2FJ7 D;  4XUJ D;  5JA4 A;  5AY8 A;  1ID3 B;  5B0Y C;  2Y2G A;  5AVB A;  3X1V B;  3UTB C;  3W96 A;  2PYO D;  5JRG A;  4CSR A;  3WTP D;  1P3O A;  3VH5 W;  1Q9C A;  3AZM A;  5GXQ B;  5B40 A;  2NQB D;  3FDD A;  3AZL B;  3TU4 C;  3LZ0 C;  4QLC C;  4WU9 A;  4M6B A;  2CV5 A;  5GT3 D;  3O62 C;  1S32 D;  1M19 A;  4WU8 D;  3W98 C;  3WA9 B;  4ZUX C;  3KWQ A;  3MGS D;  3AZK A;  2ZY5 A;  3X1T D;  4J8W D;  2Y2N A;  2Y2Q A;  1P3K A;  3W97 C;  5B32 G;  3B6F B;  2Y2O A;  5B24 A;  3P5J B;  1P3G D;  3LEL B;  5B1M D;  3AZG D;  3REL B;  3REK C;  1KX5 B;  3LJA D;  2Y2M A;  1P3B B;  2ARO B;  3UTA C;  1KX3 C;  1P3L C;  5CPK C;  1M1A B;  1F66 D;  3AV2 B;  3MGR C;  4KUD D;  3EPJ A;  3AZE C;  3MGP C;  1KX4 B;  5AV5 C;  3X1U C;  3MNN C;  4H9Q A;  1AOI C;  5B33 A;  1EQZ C;  3F6T A;  4EO5 B;  5CP6 B;  4KUD A;  4J8V C;  4R8P B;  3B0C T;  3AZN A;  2XD1 A;  1P3M D;  3AYW B;  5DNN D;  4Z66 D;  3REI A;  3UTB D;  1P34 B;  3REJ A;  5B32 B;  1ULY A;  5AV9 C;  4KGC A;  1ZLA A;  4ZBJ B;  3MGQ D;  2HIO D;  3AZH D;  5B2J B;  5AY8 B;  5AV6 B;  5B0Y A;  1P3A D;  3WAA B;  5B0Z D;  4UUZ A;  4KHA B;  3W99 C;  1M18 D;  5BO0 B;  3W98 D;  1P3P C;  1TAF B;  4H9N A;  2FJ7 B;  4XUJ B;  5AVC D;  3AN2 D;  1WWS A;  2PYO B;  3TU4 A;  3A6N D;  5B31 C;  3LZ0 A;  4QLC A;  1M19 B;  4Z5T C;  3WTP B;  5F99 C;  3O62 A;  3W98 A;  5B1L C;  2YFV B;  3WKJ C;  4ZUX A;  3AZK B;  5AV8 C;  5B2I C;  3NQJ B;  1P3B D;  2ARO D;  3KWQ C;  3H0M C;  1KX3 D;  3KXB D;  3W97 A;  1U35 C;  1M1A D;  1S32 B;  5GT3 B;  3AV2 D;  3C1C C;  4YM6 C;  1H3O A;  1F1E A;  4AWL C;  5AV5 D;  4J8X D;  2HUE C;  3MGS B;  2RVQ C;  2BYM A;  3AFA C;  3REK A;  4YS3 C;  3AV1 D;  3X1T B;  4J8W B;  3UT9 D;  3UTA A;  5DNM D;  1P3L A;  5CPK A;  3MGR A;  4J8V D;  4H9P A;  3AZE A;  3AZG B;  3MGP A;  2NZD D;  4X23 C;  4H9Q B;  5AV5 A;  4DRA A;  3X1U A;  3MNN A;  3LJA B;  1AOI A;  3B0D C;  1EQZ A;  3A1K A;  1HQ3 C;  3C1B C;  3EPK A;  3REH C;  1F66 B;  4KUD B;  4J8V A;  1P3I C;  3B6G C;  2Y2H A;  3MVD D;  2Y2J A;  3AZJ C;  3V9R A;  4H9S C;  4E45 A;  5AVB D;  2J8P A;  3W96 D;  1TZY C;  5BT1 C;  5JRG D;  5CPJ C;  5AV9 A;  2RIQ A;  1P3M B;  4KGC B;  5DNN B;  1P3O D;  3AZI C;  3AZM D;  5B40 D;  4J8U A;  3UTB B;  4DQY B;  4G91 C;  3H0L C;  2F8N H;  3W99 A;  4WU9 D;  2CV5 D;  1M19 D;  3LZ1 C;  4WNN A;  1P3P A;  3MGQ B;  2HIO B;  3AZH B;  1P3F C;  1P3A B;  3AZK D;  5BNV B;  4G92 B;  5GT0 C;  5B0Z B;  3LZ0 B;  2CWE A;  3AZF A;  5B31 A;  1M18 B;  4QLC B;  1P3K D;  1B67 A;  4Z5T A;  5F99 A;  5B24 D;  4HGA C;  3W98 B;  5E5A C;  2ZY3 A;  5B1L A;  5AVC B;  3AN2 B;  3WKJ A;  5GSU C;  5AV8 A;  5B2I A;  1ID3 C;  1BH8 A;  1JFI B;  3A6N B;  3X1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...